• Home
• com.zenecture
• neuroflow-playground_2.12
• 1.8.2
• source code
• reduced.txt

×

Project download

Many resources are needed to download a project. Please understand that we have to compensate our server costs. Thank you in advance.
Project price only 1 $

You can buy this project and download/modify it how often you want.

file.newsgroup.reduced.txt Maven / Gradle / Ivy

marshattfeserveccpurdueedu zauberer saysin article aprolecdaccom ssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars todayhave v enginesv i dont know of anyv legend mr mrv dont know of any are you serioustry thedeep breath mustangcamarooptional on nearly every truck ever built corvettes caprices bmw i caddie eldorado fleetwood sevilleinfiniti qjeep grand cherokee lexus ls lexus sc lincon mark viiitown carmb sel and the mercury grand marquis to name a few v jaguar xjs how aboutv viperv must be one somewherebelieve bugattis cominghas out one something like turbosand mucho macho hp one cool price too as i heard at any ratethe point is im pretty sure there is indeed one in productiontho rather limiteddrewfrom aaspocwruedu andrew a spencersubject nissan nomenclature was re manual shift bigots wantedin a previous article jkjecwestminsteracuk shazad barlas saysthe best autoshifters on the street and not the track are those from porsche they wont change if you floor the gas during a turn a few years back a was in a sx auto you guys call it a sx without turboand was going round a corner i floored it and next thing i know i was pointing backwards the other drivers seemed quite amused shazyou are sure that what you call a sx we call a just curiouswe also have a nissan predacessor sp to the called a whichcame in turbo and nonturbo but i dont think weve ever had a turbojust curiousbtw im in the us if that mattersdrewfrom ckauxacsouiucedu oriolefanuiucsubject re opel ownersmliggettsilverucsindianaedu matthew liggett writesin ctbdgnewscsouiucedu ckauxacsouiucedu oriolefanuiuc writesboylecactusorg craig boyle writesin article csxijbnewscsouiucedu ckauxacsouiucedu oriolefanuiuc writesgibbonsafrasersfuca darren gibbons writesim looking for information on opel cars now you ask which modelwell the sad truth is im not entirely sure but its a twoseaterwith rollover headlights hard top and really sporty looking myfriend has one sitting in his yard in really nice conditionbodywise but he transmission has seized up on him so it hasnt runfor a while does anyone have any info on these cars the enginecompartment looks really tight to work on but it is in fine shape andi am quite interested in itthanksdarren gibbonsgibbonsasfucathis would be the manta would it not sold through buick dealers in the mid s as the price leadersounds a lot more like an opel gt to me id guess that this is on the samechassis as the kadett rather than the bigger manta but i could easilybe wrong i think the later kadetts were sold here as buick opelscraigi think the manta is the european name for the gt im pretty surethat the only kadetts sold here wereare the pontiac lemans i think thegt is just an early s to mid s manta chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areabzztthe manta was a twodoor sedan in the usit had a enginewas sometimes referred to as an opel mantas are also ve hot and fun cars too mliggettsilverucsindianaedu mliggettiugoldbitnet junk collector toys r us kid antiauthoritarian and fan of frogs iguanas and other herps funny the mantas over in europe look surprisingly like the opelalluded to by the original poster chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom ckauxacsouiucedu oriolefanuiucsubject re opel ownersmatmcinnnusccnussg matthew macintyre at the national university of senegal writesby the way what do people think about the opel calibrai want one and i dont want to move to europe to buy one please makeit the next pontiac fcar of course ill have to wait till to buy it chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom nigel allen nigelallencanremcomsubject alternative fuel vehicleshere is a press release from the us department of energy energy secretary hails presidents plan for alternative fuelvehicles to national desk environment and energy reporters contact larry hart of the us department of energy washington april secretary of energyhazel r oleary today said president clintons executive order onalternative fuels will make the federal government a driving forcebehind efforts to increase the availability of both alternativefuel vehicles and fuel supplies president clinton signed the order today which calls forfederal purchases of alternative fuel vehicles in numbers over thenext three years at least percent higher than those called forin the energy policy act of president clinton also announced that texas land commissionergary mauro will head up the federal fleet conversion task force toadvise oleary on implementation of the executive order i am delighted that i will be working with gary mauro to makethis happen oleary said as land commissioner gary mauro hashelped make texas a national leader in converting the state fleetto alternative fuels and has been a tireless proponent of naturalgas vehicles in speeches across the country the task force is to issue a report within days recommendinga plan and schedule of implementation the department of energy and all of us in government must leadby example if the option of alternative fuels is going to become apractical affordable choice for fleet owners across the countryoleary said increased use of domesticallyproduced alternativefuels means reducing pollution while creating jobs we believethat energy efficiency protecting the environment and a healthyeconomy are complimentary goals oleary said that plans call for the department of energy tocoordinate the agencies fiveyear purchase plans help withfunding for extra purchase or conversion costs and work with gsato encourage development of the fuel infrastructure needed to makefleet conversions practical under the order the department of energy will also be workingwith states local governments and industry to coordinate vehiclepurchases and encourage manufacturers and fuel suppliers to makealternative fuel vehicles and alternative fuels more widelyavailable canada remote systems toronto ontariofrom rrgrtpfibercomcom rhonda gainessubject hyundai sonataopinionsinfo wantedid like to hear stories on experiences with the hyundai sonata iknow consumer reports has trashed them but the people i know thathave them swear by them they also havent had the problems withthem that consumer reports claims i havent driven one yet ihave driven a hyundai elantra which consumer reports alsotrashed and was very impressed with it the local hyundaidealership nohaggle policy is offering an elantra gls w powermoonroof for they also have a sonata base w sunroof for i know my preference is for a sonata gls w sunroof andspd automatic ill decide which engine i prefer after testdriving both the cyl and the v the sonata is also offering a rebate hmmm thats another question is the followingscenario the appropriate manner to handle negotiation make offer subtract rebate from offer talk trade subtract trade from offer to get final price rhonda gaines systemsnetwork administrator internet gainesfibercomcomfibercom inc po box uucp uunetfibercomgainesroanoke va fax phone or x from grahamtphantomgatechedu graham e thomassubject re nissan nomenclature was re manual shift bigots wantedaaspocwruedu andrew a spencer writesyou are sure that what you call a sx we call a just curiouswe also have a nissan predacessor sp to the called a whichcame in turbo and nonturbo but i dont think weve ever had a turbojust curiousbtw im in the us if that mattersdrew what we currently know as the sx is known elsewhere as a sx graham e thomas blah blah blah blah blah georgia institute of technology blah blah blah blah blah internet grahamtoitgatechedu blah blah blah blah blah from eliotlanmolaengrwashingtonedu eliotsubject re mr noisy enginein article roecusenetinscwruedu aaspocwruedu andrew a spencer writesnice theory too bad the mrs never came with a four cylinder over liters more like or did they were the nonturbo mriis orsome suchfoot in mouth again drew the first generation mr s were s which were very smooth id be real surprised if the original poster was talkingabout a st generation car the second generation cars were for thenon turbo and for the turbo i drove the non turbo and calling itunpleasant is to be kind to it i also understand that anyone using balancing shafts on four cylinders mustpay saab a royalty for using their patented designlike porsches iwrong and wrong mitsubishi owns the patent which has since expiredwhich is why everybody with a shred of integrity is putting balanceshafts into their big s the notable exception is nissan and onlyfor the us market suckers i guess we need to write to cd and starttelling them to publish graphs for engine vibration over rpm thenyoull see usenet discussions of the form engine a has peakvibrations db less than engine b therefore engine a is better thanengine b eliotfrom jkjecwestminsteracuk shazad barlassubject re is car saftey importanti of course car safety is important i for one used to think that these guys are going way ott with their airtbags sorry del button dont work and side impact bars and crash zones and the list goes on just tpo make the car heavbier and all its penalties bur recently i had a little accident onmy bike and not as bad as johns but after the accident it made me realizer i should have worn a helmet my mom always insistede i should i wasmore concerned about my hair stylea few days agi i read a report in which the old rea rea shit renault had an accident and its roof caved inwards and crushed the occupents headsfrom dlbtamutstamuedu daryl biberdorfsubject plymouth sundancedodge shadow experiencesanother user recently requested info about the shadowsundancecars but i havent seen any public responseswhat are peoples experiences with these carsdaryl daryl biberdorf ngjm dbiberdorftamuedu sola gratia sola fide sola scripturafrom martcsritorontoedu mart mollesubject re changing oil by selfbobmlmxmsdmsdmeasurexcom bob lagesse writeslong silly discussion deleted and while youre at it why bother with removingthe drain plug when you could remove the dipstick instead and suck it out fromthere with your mouth and then spit it outthis suggestion isnt as farfetched as it sounds years ago in anothertime and place i used to do oil changes in boats powered by automotiveengines in many cases there was no way to get any sort of a tray underthe oil pan because it was boxed in by the bottom of the hull and variousfloation chambers on each side and if you did get something there youdspill all the oil out of it for sure trying to get it back out againso we used a small pump powered by an electric drill to suck the oil outthe dipstick hole there was a longthin hose on the inlet side designedto fit down the dipstick tube and another thickershorter hose on theoutlet side that you put into any convenient container im sure thesegadgets are still available from marine hardware suppliers if you want onemart l mollecomputer systems research instituteuniversity of torontotoronto canada ms afrom johnsonspectracom boyd johnsonsubject re warningplease readin article cjgcajjdovenistgov keysstarchildncslnistgov lawrence b keys writesthis isnt anything new back in i was driving under a highoverpass at night on i in san diego when i caught a glimpse ofsomeone on the overpass as i passed under a rock slammed against themetal between the winshield and right front window my girlfriend wasin the seat next to it i called the police from the next exit but idoubt if they were foundabout five years ago in san diego someone was put into a coma from abrick being thrown through his sunroof as he was driving andsubsequently crashed i dont think he ever came out of the coma and ihavent heard anything about it for a couple yearsi know that this isnt the group for it but since you brought it updoes anyone have any idea why they havent bombed the waco cult probably because there are many children there also the minor factthat other than defending themselves from some people attacking themthey havent threatened or attacked anyone outside the compound inyears being a promiscuous religious nut does not constitute groundsfor a mass murder of koresh and his followerssorry for posting this to this group but i thought the previous postneeded a rebuttal if you followup to this portion please crosspostand direct followups to a more appropriate newsgroup boyd johnson noscspectracomjohnson san diego california intermittent newsfeed at best and only to selected groupsmy opinions certainly dont match those of my employerfrom pamuelleingrcom phil mueller subject re used bmw question in article apruaixuaedu rpaturihoenguaedu ravi writeshii am dying to get the answer for the pricing polocy of a dealerhere in san jose california i moved to caal from alyou moved from alabama to california my sympathiesyearmodeldescriptionmilagepriceblack looks good kksp manual ac cassette sun roof white same as aboove k kmake sure that they have all maintenance records oil should be changedevery months the mileage on the cars is finebe sure that these have the valve engine the valve is a bmw in name only didnt you have a line on a i for k jump on it phil mueller pamuelleingrcom or pamuellencbingrcomama dod suzuki bandit bmw rfrom parracsucalgaryca charles parrsubject re saturn puzzled by its pricingin article marmagnusacsohiostateedu jnielsenmagnusacsohiostateedu john f nielsen writesin article pcgvojarmorycenterlinecom jimfcenterlinecom jim frost writesjnielsenmagnusacsohiostateedu john f nielsen writesbecause i want to get the lowest price possible its called capitalismi have news for you capitalism is the practice of maximizingprofitssame difference if you lower your costs you increase your profitspersonally im not at all bothered by the saturn pricing scheme if idont want to pay as much as theyre selling it for i can go buy adifferent car from a different dealer and they get nothing thatscompetition for you if the dealer can be competitive charging whatthey do and making that kind of profit thats capitalism at its bestand more power to emid rather have the consumer dictate what things will cost not thedealerssorry but neither dictates the cost its a negotiationwhether its up front at a honda dealership in an all out dickering war or more removed on a larger economic scaleie if saturn cant sell at its price the price dropsor the company stops building them it remains a negotiatedvalue controlled by market forces to think that the consumer controls price is ludicrous if the consumer controledprice then cars would be freeand no one would build carsregards charles within the span of the last few weeks i have heard elements ofseparate threads which in that they have been conjoined in timestruck together to form a new chord within my hollow and echoinggourd unknown netpersonfrom kurt godden goddengmrcomsubject gm may build toyotabadged carthis appeared today in the the japan economic journal reported gm plans to build a toyotabadged carin the us for sale in japan bruce macdonald vp of gm corporatecommunications yesterday confirmed that gm president and ceo jack smithhad a meeting recently with tatsuro toyoda president of toyota this meeting the two discussed business opportunities to increase gmexports to japan including further component sales as well as completedvehicle salesparts sales the two presidents agreed conceptually to pursue anarrangement whereby gm would build a toyotabadged righthand drivevehicle in the us for sale by toyota in japan a working group has beenformed to finalize model specifications exact timing and other detailsfrom sorlinmagnusacsohiostateedu steven j orlinsubject re changing oil by selfin article aprnewscsbrandeisedu andyhchaoscsbrandeisedu andrew j huang writesin article aprmagnusacsohiostateedu sorlinmagnusacsohiostateedu steven j orlin writesi take the electrodes of the ampohmvolt meter whatever and connect oneto each earlobe then symmetrically insert my fingers in each of thespark plug boots no cheating guys both hands must be usedi have just a couple of questions about this techniquefirst what firing order should i use do i start with my pointerfinger or my pinky left hand or rightplace your hands flat on a table and arrange the firing order from left torightand secondly i have a cyl and there are two cylinders unaccountedfor any suggestionswell you have friends dont you cylinders might be more excitement than one person can takefrom danmggrokcolumbiascncrcom daniel adamssubject re bmw series for in article qllinnpruwmedu qazicsdcsduwmedu aamir hafeez qazi writes from article eabudialinslipntsuciedu by eabuorionoacuciedu alvin is there going to be a bmw in could be isnt the liter six supposed to be enlarged to liters in the nottoodistant future makes sense since the new mercedes benz engines go from l to a lnothing in between btw i beleive the numbers on those mb engines are and hp respectively the oneupmanship in hp might induce bmwto create a larger six also the e has lagged behind the er for some time wrt hp i am sure the bavarians wouldnt want to beshownup by the schwabiansps those mb engines havent been released over here yetdanielfrom dcdsehoustongeoquestslbcom dan daysubject re warningplease readin article ckmkuconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writesif i hear someone screwing with my car ie setting off the alarm andtaunting me to come out you can be damn sure that my colt delta elitewill also be coming with me its not the screwing with the car thatdget them shot its the potential physical danger if theyretaunting like that its very possible that they also intend to robme andor do other physically harmful thingshere in houston last year a woman heard the sound of someone in hergarage so she went to investigate with a gun in her hand shefound a guy in the process of stealing her bicycle she quitereasonably asked him to stop he refused began taunting her andas the woman was quoted in the police report he told me to goahead and shoot him so i did the moron survived and nocharges were filed against the womanfrom gwmsplsplloralcom gary w mahansubject re its a rush was re too fast why should a good driver be terrified at mph the only thing i feargoing at are drivers who switch to the left lane without usingeither rearviewmirror or flashers doing to aint a rushfor me but its fun and i get where i want to go much fasterin defense of the drivers who are in the right lane here in the states people simply do not expect when they are driving to be overtaken at a speed differential of mph i dont think this is because they are stupid of course there are exceptions they are just programmed because of the mph limit do you in the states when you look in the rearview always calculate future positions of cars based on a speed differential dont get me wrong i love to drive in the left lane fast but when i overtakecars who are on the right i slow down a tad bit if i were to rely on the judgement of the other car to recognize the speed differential i would be the stupid one btw if no one else is around then go for itfrom armcbnewsmcbattcom arlenrmartinsubject squeekin windowsconsumer reports once wrote about the s blazer that it shook and rattledlike a tired taxi cab there is one noise that is expecially irritating the back window squeaks i believe its because the whole tailgate assemblyand window are not solid anyway has anyone had the same problem and haveyou found any fixesarlen martinatt microelectronicsattattmestcarmfrom bbensonsscvxsscgovsubject re mazda just does not feel rightin article mxmmsiumnedu mxmsmsiumnedu ram v mohan writes ive a mazda with about miles on it recently i do not get a good feeling of the road esp on a wet pavement when driving the car it feels as if the car is wandering and there is no grip on the road the tires are the original ones and have threads on them passes the penny head test i had the shocks and struts and alignment checked and things are fine however i feel like that i dont have the grip of the road and feel as if the car is wandering esp on turns any help in this is appreciated thanks two shots at it check the tires again if you can see the wear barsyoure down to problem area and some tires pass a penny test between thebars thats no guide at all your problem in the wet is call hydroplaningyou may not have enough tread left to channel water out from under thetire so it goes fishy on you as it lifts off the road tires age in particular soft tire compounds get harder as you putthem thru more heat cycles harder compounds dont grip as well assoft ones effect is very noticable on tires that get very hot veryoften such as in competition but it hits all tiresbob benson from bhaskarorionmeuiucedu bhaskar mandasubject re its a rush was re too fast gwmsplsplloralcom gary w mahan writeswhy should a good driver be terrified at mph the only thing i feargoing at are drivers who switch to the left lane without usingeither rearviewmirror or flashers doing to aint a rushfor me but its fun and i get where i want to go much fasterin defense of the drivers who are in the right lane here in the states people simply do not expect when they are driving to be overtaken at a speed differential of mph i dont think this is because they are stupid of course there are exceptions they are just programmed because of the mph limit do you in the states when you look in the rearview always calculate future positions of cars based on a speed differential dont get me wrong i love to drive in the left lane fast but when i overtakecars who are on the right i slow down a tad bit if i were to rely on the judgement of the other car to recognize the speed differential i would be the stupid one btw if no one else is around then go for itkeep up the good work guysafterall the cops need to be occupied with someone so that lessermortals like us can be left alonebhaskarorionmeuiucedufrom callisonuokmaxecnuoknoredu james p callisonsubject re dumbest automotive concepts of all timein article drutxattcom klfdruwaattcom franklinkl writesin article chhgmrmconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writes in article aprslcsslbcom dcdsehoustongeoquestslbcom dan day writes in article qinnbctronnewsctroncom smithctroncom writes its a big aftermarket business almost no cars come from the factory with vynal any more and any fake convertible job definitely came from some aftermarket place what amazes me is how much people are willing to pay for bad taste how about those really ugly fake wheel compartments stuck onto the trunk or side or both sides of some tacky luxury cars some of em arent fake if youre talking about the continental kit named after the lincoln continental the first car to sport one i personally would love to have a tbird with a continental kit and the supercharged v that is one of the most beautiful cars ever built imho james the continental may have been the first modern era auto to mount thespare on the rear of the car but it was hardly the first car to sport onevarious mounting techniques for rear mounting the spare were quite commonin early automobiles both us and foreignthe lincoln continental was the first car to sport the continentalkit the continental kit is not to be confused with ye olde outsidemounting bracket a continental kit is a very specific ornamentstoragecompartment the continental has a neat trunk it looks ratherlike a laundry hamper imho jamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom callisonuokmaxecnuoknoredu james p callisonsubject re sho and scin article aprganglionannarbormius davidganglionannarbormius david hwang writesin article unisqluucp wratunisqluucp wharfie writesin article chrisscqbdbnetcomcom chrissnetcomcom chris silvester writeswagon which i have heard is somehow slightly faster than the coupewagon has an automatic its slowercould be due to the rearend ratio also usually automatics have different rearends than manuals frommy limited experience anywaysyoull have fun looking for the rearend gears on an shothe taurusis a frontwheeldrive vehiclei went back and checked the article again the sho wagon is quickerthan the sho automatic but significantly slower than the real showhy anyone would order an sho with an automatic transmission isbeyond me if you cant handle a stick you should stick with aregular taurus and leave the sho to real drivers that is not tosay that there arent real drivers who cant use the stick egdisabled persons but they arent in any position to use ansho anyway i would be willing to bet that if we removed the automatictransmissions from all performancetype cars like the lmustangs camaros and the like wed cut down on the number ofaccidents each year autos are fine for sedate little sedansbut they have no business in performance cars imhojamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom opugliesacademmtyitesmmx ing orlando pugliesesubject is this a good price hi everybody i will buy a honda civic ex coupe the dealer ask for itincluding ac installed but not including stereo tax registrationfees i live in mexico so i dont have time to go to a lot of dealersand compare their prices the dealer is in mcallen tx is this a goodprice for that car if not how much should i pay for it please email asap if you dont want to post thanks a lot orlando pugliese opugliesmtecvmtyitesmmx orlando pugliese n instituto tecnologico y de estudios superiores de monterrey depto de informacion academica monterrey nl mexico ext from rjwaderainbowecnpurdueedu robert j wadesubject re plymouth sundancedodge shadow experiencesin article qmqtinnltamsuntamuedu dlbtamutstamuedu daryl biberdorf writesanother user recently requested info about the shadowsundancecars but i havent seen any public responseswhat are peoples experiences with these carsdarylthey are pretty much junk stay away from them they will be replaced nextyear with all new models from smartincbnewsmcbattcom stevencmartinsubject re car buying story was christ another dealer service scamfrom article aprnewsgatespsmotcom by markmbigfootspsmotcom mark monninger this kind of behavior is what i was shocked by in my experience for crying out loud how do these turkeys think they can talk to customers this way and still stay in business again i dont expect sales people to bow scrape and grovel in my presence but i sure dont expect to be abused either i was very surprised by the way the sales people talked to me and in other negotiating sessions i overheard in neighboring sales cubicles evidently their success rate is high enough that they continue to do business this way there must be a lot of people out there who are easy to intimidate a couple of months ago i went to a dealership to test drive a car afterwardswe sat down to discuss prices i explained that i wanted a car just like theone i drove but in a different color he said he could get one exactly likei wanted from the dealer network within a day we then negotiated a price andsigned the dealnext day i get a call he explains that they goofed and they had neglectedto take into account a price increase the last price increase had occurredover months prior to my visit if i still wanted the car i wouldhave to fork over another as an alternative they would honor theprice if i bought the car i test drove which had been sitting around for months and had a few miles on it i said goodbye this was a goodexample of how they can lowball you and still cover their butts its toobad more people dont demand honesty or these types of dealers wouldno longer be in business the next dealership i went to was straightforward and honest first thing thesalesman said was letss see what you have for dealer cost and work outhow much profit i should make the deal went through with no problemsstevefrom alqiclabscnraincom alan petermansubject re electronic odometerin article cfpbcomegatestcom alungmegatestcom aaron lung writesif im not mistaken altering the odometer is illegal furthermorei surmise itll be tough to alter bmws odometer if you got at itsome of the newer bmws have electronic odometers making it evenmore tamperproofon the cars mentioned series from the late s the electronicodometer is really a mechanical drum type odometer that is drivenby pulses from a speed sensor on the rear axle these pulses are converted into mechanical pulses that turn the odometer and speedometerno way changing or erasing an eprom is going to change the mileagereading it also means the odometer is just as easy or hard tochange as any other mechanical odometeron the other hand it is a bit easier to disconnect the speed sensorand run the car with no speedometer or odometer readinga simpleswitch will do the job it also will disable the speed limiterwhich will enable the car to reach its full speed alan l peterman hm work alqiclabscnraincomits odd how as i get older the days are longer but the years are shorterfrom bakerdfwvxdallasgeoquestslbcomsubject insurance says car is totalledon wednesday morning another driver decided to illegallyturn left in front of me doing great damage to my carhonda civici have yet to pay off the car and the body shop says theinsurance company wants to total the car i haventbeen able to get in touch with the person handling my claimso i checked on some things my payout is blue book retail is loan value is tradein value is could anyone give me any advice on what i shouldcould doif the insurance company does not give me a reasonableamount for the loss of the carthanksjames bakerbakerdfwvxdallasgeoquestslbcomfrom parracsucalgaryca charles parrsubject options that would be great to havea list of options that would be useful they can be existingoptions on a car or things youd like to have tripmeter great little gadget lets you keep rough track of mileage makes a good second guesser for your gas gauge full size spare built in mountings and power systems for radar detectors a fitting that allows you to generate household current withthe engine running and plug ins in the trunk engine compartmentand cabinfeel free to add onregards charlesx within the span of the last few weeks i have heard elements ofseparate threads which in that they have been conjoined in timestruck together to form a new chord within my hollow and echoinggourd unknown netpersonfrom parracsucalgaryca charles parrsubject dumb options listthe idea here is to list pointless options you know stuff youget on a car that has no earthly use power windowsadd as you wishregards charles within the span of the last few weeks i have heard elements ofseparate threads which in that they have been conjoined in timestruck together to form a new chord within my hollow and echoinggourd unknown netpersonfrom aaspocwruedu andrew a spencersubject re its a rush was re too fastin a previous article gwmsplsplloralcom gary w mahan sayswhy should a good driver be terrified at mph the only thing i feargoing at are drivers who switch to the left lane without usingeither rearviewmirror or flashers doing to aint a rushfor me but its fun and i get where i want to go much fasterin defense of the drivers who are in the right lane here in the states people simply do not expect when they are driving to be overtaken at a speed differential of mph i dont think this is because they are stupid of course there are exceptions they are just programmed because of the mph limit do you in the states when you look in the rearview always calculate future positions of cars based on a speed differential dont get me wrong i love to drive in the left lane fast but when i overtakecars who are on the right i slow down a tad bit if i were to rely on the judgement of the other car to recognize the speed differential i would be the stupid one just to satiate my curiosity why would this make you the stupid one it seemsto me everybody should be aware enough of what is going on you do not needto calculate the future position you need to look at your mirrors a littlemore if you glance around you will be able to tell how much faster than youthe car is going maybe not precisely but well enough to know if you shouldlet him around before you try to pass i know what you are talking aboutabout the other driver being startled because i myself have been startledby drivers cruising by at around mph when im doin the problemthough as i saw it was not their fault for barreling around me but my faultfor not paying the attention to my taskathand that i should have beenoddly enough since the nd timehappened x in around mo when id had myliscence for around mo i havent been startledand ive been passed bycars doing roughly twice the speed of my car another odd occurance is thefact that this only seems to happen on long tripsand if i drive along withthem it doesnt happen at all even on the long trips adrenalinewill do that to youive had bad cop experiences with speeding so anythingover the limit is adrenalizing for mescared ill get caught maybethey should raise the limit so we can pay better attentionjust curious and my otwodrewfrom jburrillboihpcom jim burrillsubject re squeekin windowsarlenrmartin armcbnewsmcbattcom wrote consumer reports once wrote about the s blazer that it shook and rattled like a tired taxi cab there is one noise that is expecially irritating the back window squeaks i believe its because the whole tailgate assembly and window are not solid anyway has anyone had the same problem and have you found any fixesi can relate to this ive tried everything on my greasing every pointwd etc grease on the two cheap hinges on the tailgate seems to quiet itdown for a time until the grease works out of the hinges hinge pins appearto be made out of penny nails another vibration seems to get worse with age and that is a vibration in thetransmission in th gear my s has k miles on it i bought it new treatedit very easily no fast offroad stuff cant gm build chevies like they usedto ford explorers look nice until you look at the pricejim burrillfrom mjepookiepasswayneedu michael j edelmansubject re saturns pricing policyi just ordered a saturn sl after considering a few imports frankly the saturnway of doing business and service was a very big plus i hadnt bought a newcar since i bought my honda wd back in and i was unbelieveably offended bymost salespeople i metsaturn was indeed very different i made three different visits to the dealer wherei bought my car and was never pressured saturn also had the best aftersalessupport and the fixed pricing made it very easy for me to decide exactly whati wanted to buy another big selling point was running into my mechanic at thedealer hes been fixing imports for yearsand bought a saturn based onwhat hes seen and heard from his customers saturn also has a good extended warranty program for yeark miles fully refunded if you dont use it that works out to an actual cost of orso based on the year treasury rates using savings account rates its morelike in the first three years it also buys you free rental during anywarranty work without counting against the refundmikefrom amoedsegticom robert lopersubject re sho and scin article clreconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writesin article aprganglionannarbormius davidganglionannarbormius david hwang writesin article unisqluucp wratunisqluucp wharfie writesin article chrisscqbdbnetcomcom chrissnetcomcom chris silvester writeswhy anyone would order an sho with an automatic transmission isbeyond me if you cant handle a stick you should stick with aregular taurus and leave the sho to real drivers that is not tosay that there arent real drivers who cant use the stick egdisabled persons but they arent in any position to use ansho anyway i would be willing to bet that if we removed the automatictransmissions from all performancetype cars like the lmustangs camaros and the like wed cut down on the number ofaccidents each year autos are fine for sedate little sedansbut they have no business in performance cars imhojamesi have to disagree with this i have a z with a and a speed autow overdrive and it is really better that way chevy autos are reknownedfor their long life and ability to handle copious amount of power i live in the dallas area and a manual would be much harder to drive in the traffic here now if i still lived out in the sticks like i used to a manual would bemore fun safetywise an auto is less distractingi would hate to have to be shifting gears while i was trying to ease into traffic in the freeways hereperformancewise i can hold my own against any stock mustang or camaro w a five speed all of this imho robert l loper infinity is a notion best contemplated robertllflopndsegticom in a warm bed texas instruments inc my opinions are my own not tis from wratunisqluucp wharfiesubject re too fastin article qkonrearmorycenterlinecom jimfcenterlinecom jim frost writeslarger engine thats what the sho is a slightly modified familysedan with a powerful engine they didnt even bother improving thebrakesthat shows how much you know about anything the brakes on thesho are very different inch or i forget discs all aroundvented in front the normal taurus setup is smaller discs front drums rearyour argument still boils down to an sho shouldnt be drivenfast because i jim frost say it isnt designed to go fastpfffffttttttif you think so you sure dont pay attention to my postingsdamn straight youre one of those people who makes stuffup and tries to pawn it off as gods own truth if i want lies i cango listen to televisionthe wharf ratfrom wratunisqluucp wharfiesubject re where can i get a new york taxiin article ncrcancanadancrca tnelsonncrcancanadancrca tim nelson writesthe older ny taxis were made by the checker car company and i would loveto have oneor is the checker car company still in businesschecker motors went out of business in its hard to getold checkers that are worth restoring since almost every one wasa fleet vehicle that was driven into the ground if you can get a body in decent shape the mechanicals should all be available somewhere checker used whatever parts were around for instance i had a chevystraight six and a gmc truck radiator and a ford rear in minethe model that i am looking for is the checker marathonactually you want a checker special if you can find onegood luck im sorry i let mine gofrom greggxenonstanfordedu gregg l kastensubject differences in insurance companies ratesi am considering buying an new car so i called three insurancecompanies in california to get estimates i asked for the samecoverage and same deductibles most of the companies charge youaccording to your zip code others charge according to your cityanyhow i gave the same zip code and city to all three places hereswhat i found for a integra gsaaa yrstate farm yrallstate yraaa is nonprofit so they said i could also expect to receive about back at the end of the yearstill there is a huge gap between all of these companies state farmwants more than twice as much as allstate i think i should besuspicious but ive never heard anybody else complainany commentsthanksgregg l kastengreggcsstanfordedufrom hamachiadobecom gordon hamachisubject re honda accord brake problemjoni ciarletta writes my honda accord just hit the magic mile mark and now all sorts of things are beginning to go bad the latest problem i am experiencing is with my brakes they still stop the car fine but once i am stopped completely my brake pedal will sink another or inches all by itself if feels really strange and i am worried my brakes will quit working one of these days i checked my brake fluid and the reservoir was full but the fluid itself looked really dirty like dirty oil i called my mechanic and he told me i need a new brake master cylinder which will cost me a whopping you are not alone my honda accord with miles on it started showing the same behaviori replaced the brake master cylinder myself it took about an hour and cost about sure beats paying to have someone else do it if i wanted to rebuild my own master cylinder instead of putting in a rebuilt one it would have cost only to for the rebuild kitthe honda brake master cylinder is easy to get to two bolts attach it to the engine compartment two brake lines enter the master cylinder the tricky part was that the brake lines were stuck tight my craftsmen open end wrench rounded off the bolt heads i had to use vise grips to loosen those suckers wow best invention since sliced bread after that it was very easy bolt the new part in place add new brake fluid and bleed the brakesthis is quite easy even for a beginner my local auto parts store had a repair manual for the honda accord it had detailed diagrams of the master brake cylinder and a stepbystep procedure for replacing itfrom akyfnysuedu john r dakersubject re options that would be great to havein a previous article parracsucalgaryca charles parr saysa list of options that would be useful they can be existingoptions on a car or things youd like to have tripmeter great little gadget lets you keep rough track of mileage makes a good second guesser for your gas gauge full size spare built in mountings and power systems for radar detectors a fitting that allows you to generate household current withthe engine running and plug ins in the trunk engine compartmentand cabinfeel free to add on power windows dod darkman the significant problems we face cannot be solved at the same level of thinking we were at when we created them albert einstein the eternal championfrom mjepookiepasswayneedu michael j edelmansubject manual shift bigotsnow my ego with regards to my shifting ability is as big as anyone elses buti just ordered my first car with an auto trans i wasnt planning on it butafter driving a few i was convinced things have changed since the days of slip n slide withe powerglide they shift better than i do theres noclutch to wear out honda wanted for my wd wagon last year got it donefor it only costs about in gas milage on the highway and it makes iteasier to concentrate on all the radios in my car oddly enough while two of my best friends both in the auto industry here in the motor city have switched wholeheartedly to autos their wives insist on manual shift envybraggadocio aside given todays technology and the warranties theyre handing out the auto trans seemed like an excellent choice call me a convert mikefrom mjepookiepasswayneedu michael j edelmansubject re saturn manual transmission problemin article kacrdnnscrdgecom cimjfgsnuticagecom writes after many trips to the dealer who has admittedly been patient with methey are admittedly going to do nothing about itthe dealer did however follow the bulletin and review proper shifingprocedures with the ownermy next attempt at satisfaction in the customer number but from the firstround it doesnt sound too hopefulim surprised i know of a local case where a guy took his saturn back fivetimes to complain they hadnt properly eliminated a rattling noiseso saturngave him a new carcall that numberfrom aaspocwruedu andrew a spencersubject re too fastin a previous article wratunisqluucp wharfie saysin article qkonrearmorycenterlinecom jimfcenterlinecom jim frost writeslarger engine thats what the sho is a slightly modified familysedan with a powerful engine they didnt even bother improving thebrakesthat shows how much you know about anything the brakes on thesho are very different inch or i forget discs all aroundvented in front the normal taurus setup is smaller discs front drums rearone i saw had vented rears tooit was on a lotof course the sales man was a fooltitanium wheelsyeah rightthen later told me they were magnesiummore believable but stillcrap since al is so m uch cheaper and just as goodi tend to agree tho that this still doesnt take the sho up to standardfor running on a regular basis the brakes should be bigger like or sotake a look at the ones on the corradoswhere they havebraking regulationsdrewfrom aaspocwruedu andrew a spencersubject re sho and scin a previous article amoedsegticom robert loper saysin article clreconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writesin article aprganglionannarbormius davidganglionannarbormius david hwang writesin article unisqluucp wratunisqluucp wharfie writesin article chrisscqbdbnetcomcom chrissnetcomcom chris silvester writeswhy anyone would order an sho with an automatic transmission isbeyond me if you cant handle a stick you should stick with aregular taurus and leave the sho to real drivers that is not tosay that there arent real drivers who cant use the stick egdisabled persons but they arent in any position to use ansho anyway i would be willing to bet that if we removed the automatictransmissions from all performancetype cars like the lmustangs camaros and the like wed cut down on the number ofaccidents each year autos are fine for sedate little sedansbut they have no business in performance cars imhojamesi have to disagree with this i have a z with a and a speed autow overdrive and it is really better that way chevy autos are reknownedfor their long life and ability to handle copious amount of power i live in the dallas area and a manual would be much harder to drive in the traffic here now if i still lived out in the sticks like i used to a manual would bemore fun safetywise an auto is less distractingi would hate to have to be shifting gears while i was trying to ease into traffic in the freeways hereperformancewise i can hold my own against any stock mustang or camaro w a five speed all of this imho all of my hos disagree with your hos i loved dallas rush hour in my stickdetested it in the autolike i did any other time in the auto of coursedalls rush hours are nothing from what i hearif i lived in la i mightbe of a different persuasion and just for the record rarely do you shiftgears when merging into trafficthat is what speeds are good forth isgood up through around most of the time so you can just wind it outits not going to hurt anything and keeps it in the powerband anywayonly shift into top gear when you are exceeding redline in thfairly rareunless you drive a ferrari or some such id bet or when you hit cruising speed where you feel comfortableor when my mother is sitting in the passanger seat complaining about how you wind her poor little engine waytoo hi just my hosdrewfrom lrrpsuvmpsuedusubject re dents on carall you have to do is turn it in to the police like you would an accidentget a report and send it in to your insurance company and they will contactthe other guys insurance company and they will have to pay just as theywould in an accident they caused thus no need to go to court a friend ofmine did this and he got the money so it does workfrom rdbcbnewsjcbattcom ronaldjdeblockjrsubject re ultimate awd vehiclesin article bcdbecsumassedu sylvesteecsumassedu writesbefore the s became the s it was called the turbo quattro vthis model did come in a wagon a very quick wagon very rare also mike sylvester umassyes i saw a turbo quattro wagon on i in nj on monday i thoughtaudi stopped selling wagons in the us after the this is exactly thetype of vehicle i would like to own i bet its price is times mycar budget ron deblock rdbhomxbattcom thats a number in rdb not letter latt bell labs somerset nj usafrom gwalkerrtfmmlbflus grayson walkersubject re questions about insurance companies esp geicoin article cunfyeidovenistgov keysstarchildncslnistgov lawrence b keys writesin article cuiuaomurdochaccvirginiaedu jmhhoppervirginiaedu jeffrey hoffmeister writesin article aprjulianuwoca wlsmithvalveheartrriuwoca wayne smith writesin article mimsyumdedu davewcsumdedu david g wonnacott writesim considering switching to geico insurance but have heard thatthey do not assign a specific agent for each policy or claim i wasworried that this might be a real pain when you make a claim i havealso heard that they try to get rid of you if you have an accidentdont worry about this theyll drop you like a hot potato after you do make a claim theyll just make filing the claim a pain but it will end when they leave you in the lurchive read in this group that geico has funded the purchasing of radarguns by police depts im not sure wheremore than that geico funded the company that developed lidar when locals showed a reluctance to buy the units geico started giving them away i know theyve given units to the florida highway patrol county sheriffs a and some local governmentsthe real question is why this is the hook geico and other ins cos can tell which drivers represent risk this is a determination they can make after you receive a speeding ticket from one of geicos lidar units most drivers do not represent increased risk even after a ticket or two but this gives them the opportunity to raise rates for equal risk its called extra profits they also know how silly the nsl is and how it is almost universally ignored driving in excess of the nsl gets you a ticket an increase in your rates points on your license but it doesnt make you a riskier driver to insurelike the sound of this like the people who thought up the scheme go geicounless you have some driving history problems youre usually better to gowith one of the major companies and stay there youll get long term customerdiscounts on your premiums now about the of your premium that is paid ascommission thats another story for another dayfrom gwalkerrtfmmlbflus grayson walkersubject re questions about insurance companies esp geicobob excellent to the point and correct spread the word subject lexus and infinitifrom wtiggerstcloudmsusedufirst off the correct spelling of nissans luxury automobile divisionis infiniti not infinity i would also like to clear up the questionof what kind of engines power lexus and infiniti automobiles since aperson had remarked in earlier posts that most lexus and infiniti modelshad v engines while at the same time saying that several of eachmanufacturer used v engineslexus ls v gs v es v sc v sc vinfiniti q v j v g inline i must admit that i cannot remeber for sure herei hope this helpsbsbfrom monetcarsonuwashingtonedu diana smithsubject borgward questionmy exhusband i used to own borgwards havent seen any for a longtime they were really good cars does ayone out there know anythingabout them now i heard they were being made in mexico but of coursethey wouldnt be the original german if thats even true when ivebeen in mexico i havent seen any we loved ours even tho they wereugly they had names one was humphrey borgwardfrom petebreelofiitedu brent a petersonsubject re the mustangin article cxtpmtbmurdochaccvirginiaedu jmhhoppervirginiaedu jeffrey hoffmeister writesin article aprvirginiaedu jmmhvirginiaedu the blade runner writesi just have got to remind all of you that this is it yesthats right somtime this fall ford the granddaddy of carswill be introducing an allnew megacoolwaytoofastforaccorddrivers mustang its supposed to be streamlined looking similar to the mach iii concept carford came out with around january i cant wait anyone outthere hear anything about it recentlyif everything ive read is correct ford is doing nothing but reskinning the existing mustang with minor suspension modificationsand the pictures ive seen indicate they didnt do a very good jobof it the new mustang is nothing but a recycle of a year old carjeffgee is it alreadyyes it will still be on the fox program chasis anything that will be differenton the new car as far as mechanicals is unknown the suspension will mostlikely be changed as well as the drive drain from what has been printed onit there is no clear idea of what will be done as some say it will havethe modular v and others the current small block just have to wait and seealso is far as styling goes from what i seen is good a return to traditionc scoop on the sides and roof line much like a or fastback bpfrom tommybooleattcom tommy reingoldsubject re likelihood of radio being stolenthe question is not whether your radio will be stolen the question iswhen your radio will be stolen tommy reingoldatt bell labs holmdel njtommybooleattcom or attbooletommyfrom ivabchpcutexasedu albert wusubject ac service ripoffi went to a place called american car care centers to check my car for acleak after checking i was told that there is a leak in the compressorseal at the end in addition to the labor for the check i was charged dollars for a pound of freon although they evacuated my ac afterwardsbecause of the leak first is it fair for him to charge me for a pound offreon plus tax second what can i do about this if this is unfair albert wufrom bpitactpcom bob pitassubject re its a rush was re too fastin article aprcsalblgov jtchewcsalblgov ad absurdum per aspera writeswharf wrat ritesthey were designed for speeds of upwards of i forget theexact spec but for military vehicles thats in a dodge powerwagon not in a ford taurusever once in a while you still see a reference to the superslab system as interstate and defense highways but whetherthe military has much of anything that goes on the road isanother matter a few of their most whompedup diesel trucksmaybe load permitting the military surplus stuff ivedriven jeep classic willyskaiseramc preindependentsuspension and power wagons slant in a crewcab pickupactually ive heard that some m abrams tank commanders take the governers off their turbine engines and can acheive mph on apaved road never seen it myself but i believe itwerent exactly congenial at highway speeds and i wouldntswear any of them would do except as a bedload on a semistuff deletedjoejust another personal opinion from the peoples republic of berkeley mustang gt bob pitas ush bpitactpcom up at ned epping nh cambridge ma geddy lee in yyzdisclaimer these opinions are mine obviously since they end with my sigfrom bpitactpcom bob pitassubject re warningplease readin article rddsagateberkeleyedu bhanarrescsberkeleyedu brian harvey writesrfelixnetcomcom robbie felix writeshow about the thousands of kind teenagers who volunteer at localagencies to help children seniors the homelesshear hear thanks robbieyou also dont read that much about violence against teenagers such asgeorge bush burying alive tens of thousands of unarmed iraqi yearoldswho were trying to surrender with bulldozerson the other hand i think it is true without singling out teenagersfor blame that violence is more socially acceptable than it used to bethose of us whod like to discourage violence have plenty of work to dowith people of all ageswell this isnt the right group for this but i have to say that i dontthink violence is any more socially acceptable now by any means howcan you say that when we used to have of pistoltoting gunslingers as heros or even gangland thugs being considered romantic do you thinkour great grandparent got yelled at by their parents for playing cowboysand indians i dont think so that behavior was somewhat encouragedback then in facti think the only difference between now and then is that nowadays whensome teenager kills another one in a classroom in california we here about it in ma the same day back in the old days theyd never hear about something like that period sorry about posting to recautos but this is where it came up mustang gt bob pitas ush bpitactpcom up at ned epping nh cambridge ma geddy lee in yyzdisclaimer these opinions are mine obviously since they end with my sigfrom bowmanjcsnorg jerry bowmansubject re v v v v vxin article aprengrwashingtonedu eliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines a degree v ya gotta love it eliotfrom mcostelloasysdtnavymil malcolm g costellosubject re locking lugnuts tire rebalancein recautos masskclamonsantocom writesxif you put a locking lugnut on your tires do you need to have yourxtires rebalancedxxjohn masxxemail address masskclamonsantocomsince the wheeltire is balanced off the car ie the lugnuts arenot normally involved how would they do that i would think thatsince the lugs are so close to the center of rotation any slightdifference in weight between a normal lugnut and a locking one wouldnot have any noticable effect on the balance i could be wrong it isfriday afternoonmack costello mcostelloasysdtnavymil code formerly david taylor model basin carderock division hq nswc bethesda md phone from bowmanjcsnorg jerry bowmansubject re v v v v vxin article natarajageode natarajartsgmotcom kumaravel natarajan writesmliggettsilverucsindianaedu matthew liggett writesin aprolecdaccom ssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars todayhave v enginesv i dont know of anyditto seems to me that i heard that some early saabs were cycle vs then again who could possibly care v legend mr mrwhats an mr or mrmost any gm w the vv dont know of anymustang camaros firebirdssome mercedeslexus ls scinfinity qv jaguar xjssome mercedesbmw illamborghini countachlamborghini diablo please add to the list vel natarajan natarajartsgmotcom motorola cellular arlington hts il from jaomegatestcom john oswaltsubject re legal car buying problemsrboudriechpcorg rob boudrie writes in article stratusswdcstratuscom bobrunwayswdcstratuscom bob hutson writes after agreeing to terms i signed the contract and drove home in my new car later that same night i noticed that the terms in the were different from the terms i had agreed to i made the stupid mistake of not checking everything on the contract this all happened last saturday i have heard that there is a coolingoff law allowing me three days to reconsider the contract is this true can anyone point me to the law the transaction happened at the dealership if it matters this cooling off period applies only in certain situations lik ewhen you are solicited at home i also think the cooling off period ends if you actually accept the merchandise if this were not the case any car buyer would have the right to return a slightly used highly devalued car days after buying it yeah thats the trick if i want to buy a new car id have a firend buy return one then go in and negotiate a better deal on a preowned used carhowever if you agree some terms and then when about to sign thedealer slips you a contract with different terms and leads you tobelieve that it embodies the terms you verbally agreed to thatis fraud there is no day limit on restitution for fraudyou may have to sue and win to get out of this you will almostcertainly have to threaten to sue john oswalt jaomegatestcom or jaonetcomcomfrom yjwondecacsumnedu youjip wonsubject information neededhi this is my first time to post on this news group now a days i have stucked at a certain problem i have mazda mx non turbo fuel injection there is a engine warning signal on the dash board while driving this signal turns on but not always what does this mean in the manual they say go to authorized mazda dealer it is really good idea dont you think so i wanna know how the engine warning signal comes is anybody out there who can give me same advice as authorized mazda dealer can give youjip wonyjwoncsumnedufrom eliotlanmolaengrwashingtonedu eliotsubject re lexus and infinitiin article aprmsusmsusedu wtiggerstcloudmsusedu writesfirst off the correct spelling of nissans luxury automobile divisionis infiniti not infinitywho cares about typos of these meaningless synthetic names if thecars were named after a person eg honda id be more respectfullexus gs v es v sc vwrong the gs and sc use straight sixes while the es uses av only a giant like toyota can afford to have both a v and inline in its lineup but that wont last for longeliotfrom bowmanjcsnorg jerry bowmansubject re helpwith buick regalin article cwykplulowellulowelledu gvahecsulowelledu gerry vahe writeshhheeelllpppim going crazy i have a buick regal with over miles on itjust recently when i go over a bump of any size the rear driverss side of the car feels like there is something hitting the floor board the noise is amplified when i am going around a corner when there is less weight above the tire when i hit a bumpi had the whole brake drum off today checked under the car to see if the muffler was hitting or something and i cant seem to find anything at all everything seems to be tightany ideas could it bee a shock absorber is there any way i can tellanything will help and be greatly appreciatedgerry check out the shocks where they mount at both ends if you have the type that have a loopfrom lack of a better term and a bolt like piece sticking through there should be a rubber bushing between the loop and the bolt is it there is it crushed and allowing metal to metal contact i hope you can make some sense of this good luckfrom reaperwixerbgacom keath milligansubject re the mustangin article gjgmbgsuedu gjgandybgsuedu greg gantzer writesin article aprvirginiaedu jmmhvirginiaedu theblade runner wrote i just have got to remind all of you that this is it yes thats right somtime this fall ford the granddaddy of cars will be introducing an allnew megacool waytoofastforaccorddrivers mustang its supposed to be streamlined looking similar to the mach iii concept car ford came out with around january i cant wait anyone out there hear anything about it recentlyyeah it looks like shit nothing like the mach iii check out thelatest issue of popular mechanics they have a picture of one it lookslike a cross between a dodge daytona and an eagle talon only much uglier this car looks like it should have been produced in not ill pick up that pm and have a look maybe the picture in there is notthe actual car but a prototypei saw the mach iii and was not all that impressed it looked way toojapanese for me the tear drop headlights reminded me of a nissan nxglad i didnt hold out for the and bought a maybe theyll work onthe design a little bit listen to consumers and come out with nicelooking or it always takes a while to work out the kinks in a new designeg the fbody camarofirebirds btw the new camaros look like shit too keath milligan software engineer videotelecom corporation austin texasjkmvtelcom reaperwixerbgacomtry realtime communications or telnet wixerbgacomfrom bowmanjcsnorg jerry bowmansubject re improvements in automatic transmissionsin article cweqeignewsrichbnrca herlingcrchhnosubdomainnodomain brent herling writesin article aprwestminsteracuk jkjecwestminsteracuk shazad barlas writes i just wanted to know to wheelspin in an auto you keep the gear in n gas it then stick the gear in d ive never tried this but am sure it works but does this screw up the autobox were having a bit of a debate about it hereah yes the neutral slami know that gm tested the old ths and ths by shifting from reverse toforward gears repeatedly while holding the engine at high rpms the units holdup incredibly well this is also the recommended technique to rock a stuckvehicle out of the mud i think the hydraulics are up to the task but themechanicals of the driveline may object by breaking somethingericy i agree about the durability of the old th trannies from gm while i never intentionally slamed my firebird ci conv into gear i would leave the trannie in low read st grab hold hit the pedal and once the tires grabbed take off when i reached about mph the turbo auto would shift to s read super or nd and leave about to foot of double stripped rubber on the ground most everyone i knew at the time was quite impressed with peeling out at mph the trannie held up just finemotor mounts would last about a year until i tied the motor down with largechains oh yeafyi pontiac ci bored over large valve heads holley spread bore crain blazer cam dont remember the specs positrac hooker headers dual exhaust get this conv leather seats power windows power top ac cruise etc oh yea i also pulled the cocktail shakers weights from the front and removed the lead pellet from the accelerator pedal damn us regulations oh how i miss that car under sec and about to mpg well i dont miss the mpg front wheels off the ground with three quick jabs at the pedal bent pushrods stripped rocker studs every months i really wonder what kind of revs i was turning no tachre improvements in automatic transmissions anyone seen one of these lately id buy it back in a secopen top brent am i the only one that smells a little el caca del toro here from arun g jayakumar ajandrewcmuedusubject vascari know this is the wrong place to post this but i couldnt find anyrelevant newsgroups in my areafor those of you who are from pa where is vascar where the copsmeasure your speed from the time it takes you to cross the distancebetween two white lines on the road right most commonly used imespecially interested in the pittsburgh area specific locations priorexperiences if possible for those pa and nonpa if they use vascarin your state is it most common in rural city highway areas etc what im interested in mainly is where i can speed with the least riskof being caught you can always detect radar but theres no way tofight vascar unless you know where all the white lines arethanks a lot arun jayakumarfrom goosevaxeline kevin gossonsubject honda crx dx honda crx dx white wblue int original owner miles mostly highway recent tuneup new battery oil changed every miles kenwood high power cassette receiver w spkrs or best reasonable offer if interested please email me at gooseftpcom or call after pm ask for kevinfrom uuicvmuicedusubject re best radar detector valentineive had a valentine for about months now and i agree that it is the best detector available the point here is trust and reliability ive been able to trust the valentine more than any other detector ive owend if the valentine says that there is a moderate to strong radar source in front of me then its more than likely to be a speed trap with my other detectors ive gotten so many falses that ive begun to ignore someo of the warnings because i didnt want to drive like i had one foot on the brake and one on the gas pedalthat directional indicator really really helps plus more info is almost always better than less info no matter how smart radar detectors get the human brain is usually smarter so if im going to make a decisio based on information at hand i want all the info i can get plus if you divide the overall strength of the radar signal by the number of bogeys reported youll find that eachbogey is pretty weak and therefore not a radar threat with other detectors youll just get one strong warning my logic may be faulty on this but i think it works okayalthough i must admit that i havent really noticed the reflection problem ofone radar soucethomasfrom uuicvmuicedusubject re saturn extended warrantyi agree with gaia even though the saturn has proved to be a very reliable carso far a little money spent now is worth the peace of mindin my opinion getting the powertrain warranty is enough in my case thats because anything that needed repairing in the interior sunroof windows doors etc i could do myself i just didnt want to mess with the engine and suchplus i think the extra years of hour roadside assistance must be worthe someting i opted for the year plan for thomasfrom yjkimtonberkeleyedu youngjin kimsubject toyota camry toyota camry le dr sedanac at power windows and locksk miles asking pls call or send email to this accountfrom tcorapicaarmymil tom coradeschisubject re its a rush was re too fastboylecactusorg craig boyle wrote marshattfeserveccpurdueedu zauberer writes wratunisqluucp wharfie writes remember roads in america are not designed for speeds above meaning they would be safe at roads like the autobahn are smoother straiter wider and slightly banked well thats news before the speed limit on texas highways was the speed limit on the new jersey turnpike i was there were no speed limits in nevada or montana i guess i wasnt clear enough here i said the roads were designed for speeds of or so and still be safe the current will add a saftey margin actually the roads were designated as safe at when they were built in the s taking into account the kinds of cars then available the number would be much higher today because the cars tires and just about everything else has imprivoved a lotexcept the drivers tom coradeschi tcorapicaarmymil usenet is like a herd of performing elephants with diarrhea massivedifficult to redirect aweinspiring entertaining and a source of mindboggling amounts of excrement when you least expect it gene spafford from kchongmothrantsuciedu keith chongsubject re lexus and infinitiin article aprmsusmsusedu wtiggerstcloudmsusedu writesfirst off the correct spelling of nissans luxury automobile divisionis infiniti not infinity i would also like to clear up the questionof what kind of engines power lexus and infiniti automobiles since aperson had remarked in earlier posts that most lexus and infiniti modelshad v engines while at the same time saying that several of eachmanufacturer used v engineslexus ls v gs v es v sc v sc vthe gs and sc have an inline infiniti q v j v g inline i must admit that i cannot remeber for sure hereinline is correcti hope this helpsbsbkeithfrom briangothamcityjscnasagov brian donnellsubject val vs belsti was re best radar detectorin article aprconvexcom tobiasconvexcom allentobias wrote i live in the backyard of the folks who make the stalker radar system the valentine has saved me many many many times from the stealth revenue enhancement traps of the local area i have had all the major brand detectors and imho nothing else even comes close to the v i hadnt heard of the valentine before cardriver and other automagazinesrecommend bel detectors i was considering their latest the sti which picks up super wideband ka and laser as well it also avoids radar detector detectors although i really dont care about this since idoubt ill be driving in virginia anytime soon or have any other statesalso made detectors iilegalhow does the valentine compare with the bel productsbrian donnellfrom mliggettsilverucsindianaedu matthew liggettsubject re v enginesin pweslipknotmitedu pweslipknotmitedu paul w emery writeson the subject of the vford in the uk used v engines exstensively intheir ford transit vansthis brings back a memory from the seventiesiplayed in a band at the time and for something like pounds four ofus bought a tranny to cart the gear around init was in terribleshape cosmetically because its last owner was a pig farmerwe spentdays cleaning it up and putting in a partition and more seating but tilthe day it died everytime you turned on the fan to the defroster driedpig shit came flying out the vents back to the engine if i remember right it was a cc v and thatthing could haulwe could fill it with equipment and up to people andit went like a bat out of hellof course there were no pollution controlson the engine and the gas was leaded and higher octane than we get now when the mechanical fuel pump quit we put in an electric one from a morris minor that worked great ah fond memoriessaab sonnet iii too i believe pweslipknotmitedu id like to own a squadron of tankspaul w emery ron nastythe rutlesm i t magnet lab cambridge mass usa costellobeatlesspinaltapfawltytowersmuttsavengersstartrektngenglandrutles mliggettsilverucsindianaedu mliggettiugoldbitnet junk collector toys r us kid antiauthoritarian and fan of frogs iguanas and other herps from ncraycom jim knollsubject thanks nova advicei want to thank all the people that responded to my posta few weeks ago about buying an chev nova with over mii decided to buy the car and have had it for about a monthi replaced the front brake pads and changed the oil so farno problems have surfacedi received many suggestions and encouragement on thispurchase and figured a late thank you was better than nonethanks to alljimfrom mliggettsilverucsindianaedu matthew liggettsubject re v v v v vxin aprcstulaneedu finnegannrlsscnavymil writesin article aprengrwashingtonedueliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines eliotwouldnt that make them an i or would they really be an henceforth referred to asunderscore horizontally opposed or boxergreat idea actuallysmooth running low center of gravityalso used in some honda gullwings corvairs porsches otherskennethfinnegannrlsscnavymil mliggettsilverucsindianaedu mliggettiugoldbitnet junk collector toys r us kid antiauthoritarian and fan of frogs iguanas and other herps from tflynnencorecom tonya r flynnsubject re wife wants convertiblein article cunfjpausenetucsindianaedu tom wetzel twetzelucsindianaedu writesin article rtthbiusenetinscwruedu andrew a spenceraaspocwruedu writes my wife has informed me that she wants a convertible for her next cari was about to recommend you consider a targa top over a convertible but drew made the point very well when my wife and i were in our s wedid the convertible thing with triumphs now in our mids we stillappreciate the open air but prefer targa types there is much less windnoise objectspapers blowing around foreign objects getting into thecar and one still has almost all the advantages of the convertible my last car had ttops big ttops my current car is a convertibleimho if youre after that convertible feel ttops opentopsunroofs moonroofs whatever just dont cut it theres nosubstitute for a convertible if youre not after that sun beatingdown on you the wind in your hair and teeth the flopsum andjetsum getting in the car and the noises associated with thewhooshing of the wind youre not after that convertible feelso go with something with at least a hole above the driver but dont callit a convertibleand i do wonder how those targa tops would compare against my rollbar in a rollover situation of course id rather not test itin my car i too am in my early sa convertibleaccept no substitute tonya id rather be sailing flynn w sunrise blvd ft lauderdale fl lets just punch through that uucp uunetgouldtflynnsand barcrew of natty dread internet tflynnencorecomfrom kenwnetaxscom kenneth warrensubject re wife wants convertibleand heres my two centsthe best convertible for the money imo is the miata yes its small butyoure buying it as a second car i hope so you dont need the cargo roomof a big car its got enough power for fun its rwd like a sports carought to be im gonna regret that and the top while manual operateslike a dream seconds and one hand to lower and not much longer to raisethe targatype cars are nice but theyre not real convertibles ken warren the secrets of a good life are early nights good food excercise and clean living email kenwnetaxscombut the secrets of a happy life are late nights wild parties kinky sex and junk foodfrom hamachiadobecom gordon hamachisubject re mercury villager minivan good buyi came across this interesting information in my local public library while researching minivans it is the dealer price and the retail price for a minivan i am thinking about purchasing someone told me that the number for base price was slightly lower than the current price but this should still give you some idea about pricing and how much you can negotiatemercury villager gs dealer retailbase price air conditioning rear defroster calif emissions passenger seating amfm radio no cassette std stdautomatic transmission std stdantilock brakes std stddestination the total dealer cost is the total retail price is nissan quest xe dealer retailbase price air conditioning std stdrear defroster std stdcalif emissions passenger seating std stdamfm cassette std stdautomatic transmission std stdantilock brakes destination the total dealer cost is the total retail price is from wesfboihpcom wes fujiisubject re improvements in automatic transmissionsshazad barlas jkjecwestminsteracuk wrote to wheelspin in an auto you keep the gear in n gas it then stick the gear in d ive never tried this but am sure it works but does this screw up the autobox were having a bit of a debate about it hereive known more people to leave their rear ends in pieces doing this especially if they have reasonable power to transmit and good tractionon the road surfaceyoure better off powerbrakingwes fujii a real motor is an oldsmobile rocket hurst this is not the new generation of olds wes banzai fujii olds boise idaho wesfhpdmdboihpcom from rvklemailspsmotcom tom mathessubject re locking lugnuts tire rebalancein article aprskclamonsantocom masskclamonsantocom writesif you put a locking lugnut on your tires do you need to have yourtires rebalancedjohn masemail address masskclamonsantocomwell it depends on what kind of locking lugnuts you have my previouscar had locking lugnuts that weighed about oz more than the others the locking lugnuts were factory equipment and according to the factoryservice manual after tire balancing the technicianmechanic wassupposed to put a oz counterweight on the rim opposite the lockingnut i always had vibration problems with those stupid lugnuts since noone ever did the service correctly i eventually got rid of the lockinglugnuts and replaced them with the standard lugnuts unfortunately ifound out about the counterweighting technique months after i got ridof the locking nuts my present car a saturn sc has locking lugnuts that i bought at thedealer and are made specifically for the saturn they have been made tobe exactly the same weight as the nonlocking lugnuts said so on thepackage and i verified it myself i havent had any vibration problemswith the tires at all due to the nuts in of ownership i didhave some other vibration problems but it was due to a poor job of tirebalancingtomfrom alterrchlandvnetibmcom eric altersubject re the mustangin article cxtpmtbmurdochaccvirginiaedu jmhhoppervirginiaedu jeffrey hoffmeister writes in article aprvirginiaedu jmmhvirginiaedu the blade runner writes i just have got to remind all of you that this is it yes thats right somtime this fall ford the granddaddy of cars will be introducing an allnew megacool waytoofastforaccorddrivers mustang its supposed to be streamlined looking similar to the mach iii concept car ford came out with around january i cant wait anyone out there hear anything about it recently if everything ive read is correct ford is doing nothing but re skinning the existing mustang with minor suspension modifications and the pictures ive seen indicate they didnt do a very good job of it the new mustang is nothing but a recycle of a year old car jeff what i heard there was a new engine slated for the mustangsomethinglike hp ok it was from one of their other lines eric alterfrom georgehowellgoucherwbffvamprorg george howell subject some taurus misc maint are there any fairly cheap or so ways to increase the performance on this car unfortunately a taurus is not exactly a muscle car so im looking for ways to increase the performancethere is a company in florida that sells computer chips that supposedlyget a few hp and torque out of the dont have the address but sawthe ad in hot rod and some other car magazines also you could open upthe exhaust get an exhaust with a larger idhope this helps if you find anything else let me know ive got a taurus lgeorge howellgeorgehowellgoucherwbffvamprorg from qwertytunisiasscgov kris schludermannsubject re rfi art of clutchless shiftingin article aprraoccom luskyccwfccutexasedu jonathan r lusky writes shifting without the clutch on a transmission with syncros can and will cause transmission damage the only question being how long it takesto grenade something for the trans in my pulsar se it was about k miles but it had a weak tranny in the first placeplease explain the why of this i have over k miles usage of clutchlessshift and no problemskrispyfrom andrewfripwvtekcom andrew klossnersubject re mercury villager minivan good buythe villagerquest seem like the best of the cravanvoyagercopies to come along since the mazda mpvill agree about villager but not mpv its so small that id classit as a suv with an extra seat shoehorned in to get any rear cargospace you shove the back seat up against the middle seat eliminatingall leg roomback to the villager only the price is controversialand the use of attack belts instead of point belts that killed itfor me andrew klossner andrewfripwvtekcomfrom seoveariellercnasagov eric overtonsubject shifting without clutch whileis it ok to take the car out of gear without using the clutchwhile the car is turned offthanks in advanceplease reply by mailericfrom markwdcwdcspsmotcom mark shawsubject re dirty dieselsin article ceylongtecom hhdharveygtecom horace dediu writes in article natarajaopal natarajartsgmotcom kumaravel natarajan writes i heard the diesels are considered cleanerburning than gas engines because the emit less of carbon monoxide hydrocarbons and oxides of nitrogen co hc nox but they can put out a lot of particulate matter i heard something about legislation being discussed to clean up diesel emissions is there anything in the works to install scrubbers for diesels how about the feasibility of installing them on trucks and cars would it be any different than a catylitic converter id assume easier since were removing particulate matter instead of converting gasses lets hear peoples opinions this really bugs me the emissions of diesels are the cleanest of any vechicle but they are considered so polluting that they are banned in passenger cars in california what a bunch of crap diesel is the fuel of choice for enviromental benefit in europe while here its illegal for the same reason the particulates are nothing but carbon they are just an annoyance at worst nothing beats the diesel cycle for efficiency and emissions torque or engine durability its also cheaperdiesels fall into the same emissions mythology as alcohol fuels the main reasonthey are considered cleaner is because they are better at the emissions weactually measure and regulate but they also contribute additional emissionswhich have long been determined to be as harmful but no suitable control orlimits have been defined current evidence is pointing to most visible smog actually being diesel emissionsand suspended particles and less of a photochemical reaction diesel particulatesare now becoming a major concern in decreased lung capacity and alcohols emitsignifcantly more aldehydes a known carcinigen than gasoline the evidenceis mounting that while we have been beating the gasoline engine to death we mayhave been ignoring the effects of the alternativesand anyone who thinks diesels are so great should go and spend a few hours inrush hour traffic in some cities in europe there the stench of the diesels isawful and it can even burn the eyes diesels being clean is only relative to our current standards markfrom dmunroevcdhpcom dave gaugesubject choice of gaugesif you had free reign to design your own instrument cluster whichgauges would you choose to have beyond the basic seti consider the basic set to be tach coolant temp or cylinder head temp for aircooled engines oil pressure amps speedo fuelothers that are nice to have volts maybe this should be in the basic set vacuumboosti can think of a few others but what are your ideas and whydavefrom dreitmanoregonuoregonedu daniel r reitman attorney to besubject re legal car buying problemsin article aprchpcorg rboudriechpcorg rob boudrie writesin article stratusswdcstratuscom bobrunwayswdcstratuscom bob hutson writesafter agreeing to terms i signed the contract and drove home in my newcar later that same night i noticed that the terms in the weredifferent from the terms i had agreed to i made the stupid mistakeof not checking everything on the contract this all happened lastsaturdayi have heard that there is a coolingoff law allowing me three daysto reconsider the contract is this true can anyone point me to thelaw the transaction happened at the dealership if it mattersthis cooling off period applies only in certain situations lik ewhenyou are solicited at home i also think the cooling off period endsif you actually accept the merchandiseif this were not the case any car buyer would have the right to returna slightly used highly devalued car days after buying it yeah thats the trick if i want to buy a new car id have a firend buy return one then go in and negotiate a better deal on a preownedused carfor discussion purposes onlyon the other hand if it can be proven its possible the changed terms could be thrown out the question will be whether the agreement contains a merger clause see ucc parol evidence if were talking about warranties then of course ucc should be looked atbut we have so little information that none of us can say anything conclusivedaniel reitmanthe uniform commercial code protects the innocent purchaser but it is not a shield for the sly conniver the blindly naive or the hopelessly gullibleatlas auto rental corp v weisberg misc d nysd ny city civ ct from joestelxonmistelxoncom joe staudtsubject re v v v v vxin article rufkfrusenetinscwruedu aaspocwruedu andrew a spencer writesin a previous article finnegannrlsscnavymil saysin article aprengrwashingtonedueliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines eliotwouldnt that make them an i or would they really be an henceforth referred to asunderscore i think that it is technicaly known as a degree vee configurationcould be wrongthis is how ive seen them referred todrewive always heard them referred to horizontally opposedjoe joseph staudt telxon corp joestelxoncompo box usenet is like tetris for people who stillakron oh remember how to read x j hellerfrom frankbsadhpcom frank ballsubject re rfi art of clutchless shifting im not familiar with the trannies used in winston cup but in the transam cars ive played with the transmissions were the racing variety with dog clutches instead of sychros in a transmission with dog clutches the gears are always engaged with each other and moving the dog clutches engages the gears to the shafts motorcycle transmissions are the same way shifting without the clutch on a transmission with syncros can and will cause transmission damage the only question being how long it takesto grenade something for the trans in my pulsar se it was about k miles but it had a weak tranny in the first place just out of curiosity how is this dog clutch any different from a synchro transmission what you described sounds the same to me in fact what little ive studied on trannies the instructor referred to the synchros as dogs and said they were synonymous the gears are always meshed in a synchronized gearbox and you slip the synchro gears back and forth by shifting or at least that is what i was taught explain por favourmotorcycle transmissions dont have synchros the engagment dogs are verycorse and sloppy there are maybe teeth dogs on the side of thegears that engage the next gear over as the forks slide the gears backand forth to shift start to apply pressure at the same time theclutch is pulled the clutch is a hand lever and shift quickly if you try a slow lazy shift it will grind you just have to pop it intothe next gear before it has a chance to grind there isnt a neutralbetween gears obviously there is but you cant select it with theshifter so double clutching is not a possibility speed shiftingwhich is what i have always heard clutchless shifting called workspretty well for upshifts with some practice but i usually use theclutchespecially for the lower gearsi think auto as in automobile trannys are similar except that theengagment dogs are very fine with no slop and the addition ofsyncho rings the gear teeth are always engaged in auto transmissionsthat are synchronized but may not be in nonsynchro gears reverseand sometimes first frank ball urm frankbsadhpcom workhewlett packard fax home valley house drive it xt seca f plrohnert park ca kcwug law ama dod im the nrafrom jgossgaiatorolabibmcom jeff gosssubject re mercury villager minivan good buyin article ruckinncmfgapcaltechedu wenkingcscaltechedu wenking su writes path eclipseyktnewswatsonibmcomhawnewswatsonibmcomnewsgatewatsonibmcomnewsansneteuropaenggtefsdcomhowlandrestonansnetuscelroyjplnasagovnntpservercaltecheduwenking from wenkingcscaltechedu wenking su newsgroups recautos date apr gmt organization california institute of technology lines references rejinnkjgapcaltechedu rcrinnvarsumaxseattleuedu nntppostinghost neptunecscaltechedu keywords mercury villager minivan van cars jittlov in article rcrinnvarsumaxseattleuedu smorrissumaxseattleuedu steven a morris writes the villagerquest seem like the best of the cravanvoyager copies to come along since the mazda mpv the nissan maxima engine paired with the maxima speed auto trans should be an excellent drive train and the rest of the vehicle seems well engineered only the price is controversial hmm the last time i checked villagerquest does not have a maxima engine and is very much under powered for its weight same engine different state of tune less hp and maybe more torque myfriend at work regularly takes people in his and it seems to haul aroundjust finejeff gossfrom davewcsumdedu david g wonnacottsubject re questions about insurance companies esp geicoin article mimsyumdedu davewcsumdedu david g wonnacott writesim considering switching to geico insurance i got numerous complaints about geico and several helpful pointers toother good insurance companies i have decided to go with the erieinsurance exchange which seems to combine high ratings from the netand consumer reports with low rates at least for me thanks for allthe responsesfrom bobncubecom bob kehoesubject re mercury villager minivan good buyi have tested both vehicles identicallyequipped both for weeklong periodscuriously and consider these are testvehicles i found the mercury higherin build quality than the nissaneither choice is good but beware thati did not experience reasonable mileagewith the v average city driving wasmpg with about avg on the highwayboth were optioned to the hilt the nissanhad leather the villager was in thek range and the nissan was over kbobfrom gwmsplsplloralcom gary w mahansubject re its a rush was re too fast dont get me wrong i love to drive in the left lane fast but when i overtakecars who are on the right i slow down a tad bit if i were to rely on the judgement of the other car to recognize the speed differential i would be the stupid one just to satiate my curiosity why would this make you the stupid one it seemsto me everybody should be aware enough of what is going on you do not needi couldnt agree more that is how it should work people should also always see motorcycles tooi constantly scan behind me i have one of those wink mirrors and two outside mirrors i actually spend just as much time checking my six cops you knowi still get caught off guard every now and then maybe i didnt word it right the first time what i was trying to say was that if you plan to blow by somebody at a very high speed differential and you assume you are safe because the guy sees you you are stupid of course it depends on the circumstances i have had some very scary instances when i assumed this and i dont think all of the fault was the other guy now if he was going in a thats a whole different storyfrom aaspocwruedu andrew a spencersubject re dumb options listin a previous article parracsucalgaryca charles parr saysthe idea here is to list pointless options you know stuff youcan get on a car that has no earthly use a fitting that allows you to generate household current withthe engine running and plug ins in the trunk engine compartmentand cabinfeel free to add onregards charlesx within the span of the last few weeks i have heard elements ofseparate threads which in that they have been conjoined in timestruck together to form a new chord within my hollow and echoinggourd unknown netpersonfrom aaspocwruedu andrew a spencersubject re its a rush was re too fastin a previous article gwmsplsplloralcom gary w mahan saysdont get me wrong i love to drive in the left lane fast but when i overtakecars who are on the right i slow down a tad bit if i were to rely on the judgement of the other car to recognize the speed differential i would be the stupid one just to satiate my curiosity why would this make you the stupid one it seemsto me everybody should be aware enough of what is going on you do not needi couldnt agree more that is how it should work people should also always see motorcycles tooi constantly scan behind me i have one of those wink mirrors and two outside mirrors i actually spend just as much time checking my six cops you knowi still get caught off guard every now and then maybe i didnt word it right the first time what i was trying to say was that if you plan to blow by somebody at a very high speed differential and you assume you are safe because the guy sees you you are stupid of course it depends on the circumstances i have had some very scary instances when i assumed this and i dont think all of the fault was the other guy now if he was going in a thats a whole different storyok i can agree to this because as we have both proved what is ideallysupposed to happen isnt always and even though im rearely the one doingthe passing i dont see where it makes you stupid but i agree that if you think you are safe because the other guy is supposed to have been paying attention then yes you are just as dumb as the othermaybe dumberhastadrewfrom laszlocsdcsduwmedu tyson f nusssubject re dumbest automotive concepts of all timefrom article pqiafnewsysuedu by akyfnysuedu john r daker cup holders driving is an importantant enough undertaking ashtrays smokers seem to think its just fine to use the roadoh sure sorry but the absence of a cupholder is not gonnadiscourage anyone from eatingdrinking in the car lets just put onein anyway so at least they dont have the further distraction of tryingnot to spill itfurthermore you are obviously not a smoker on a cold day ittakes a certain skill to toss a butt out of a cracked window without havingit winddeflect into the back seat also just cause some smokers usethe window doesnt mean all of us dothis reminds me of one pleasant feature in the otherwiseergonomicallyhellish interior of the alfa romeo milano you could ashyour cigarette without even removing your hand from the wheel the traywas rightthere fake convertible roofs and vinyl roofs any gold trimthese i will agree are abominations right along with the fakecontinental sparetire kit its sad watching those little old ladies try to load their groceries into the trunk with that huge tiremedallionin the waymost pitiful fake convertible top on a cadillac cimarron withall the chrome door trim still visible not fooling anyoneof course there was that hyundai excel i once saw a laszlocsdcsduwmedu redhead afficionado extraordinaire and v little canadias minister of fine tobaccoso cigaret brands sampled importluxury handrolling these opinions are not necessarily mine or mine either can anyone bum me a sigfrom laszlocsdcsduwmedu tyson f nusssubject re dumbest automotive concepts of all tim in article maruncavxuncaedu bwillarduncavxuncaedu wrote saab ignition is on flooractually this started as a great idea before steeringcolumnlocks became popular saab installed a gearshift lock put the carin reverse remove the key and the car stays in reversealso suppose you get into your car and a thug comes up anddemands your keys at gunpoint you hand them over he gets in andhas no idea where to put the key at this he will run away or perhapsshoot you anyway i heard this actually happened somewherebtw i hear that the saab s new successor will have theignition on the console between the seats where it belongs a laszlocsdcsduwmedu redhead afficionado extraordinaire and v little canadias minister of fine tobaccoso cigaret brands sampled importluxury handrolling these opinions are not necessarily mine or mine either can anyone bum me a sigfrom infanteacpubdukeedu andrew infantesubject re changing oil by selfin article aprdsdescom bmossgrinchsimescom brent woody moss writesin article aprmagnusacsohiostateedu sorlinmagnusacsohiostateedu steven j orlin writes in article aprcbnewsjcbattcom rdbcbnewsjcbattcom ronaldjdeblockjr writes you can avoid these problems entirely by installing an oil drain valve in place of the bolt i have one on both of my cars there have been no leaks in miles combined miles on both cars yes but then someone would have no problem draining your oil in a parking lot all they have to do is reach underneath turn a valve and forget the trip home but there is less likelyhood they have a wrench with them i personally recommend installing a special locking drain plug to keep vandals away stevei was worried about someone stealing my oil once also i finally decided to just have my drain plug welded shut it works great i figure that when i add three or four quarts when the oil lightcomes on every month or so that its just as good or better thanthe old wives tale of changing the oil and filter every milesworks for me i must say either ive just fallen for this or you guysare really paranoidyoure actually worried about somebody stealing your oilcmon you think a vandalll do thatthats absolutely ridiculousbesides how hard is it to get under the car to change the oili can say from experience on the cars that ive driven andchanged the oil on my mazda is pretty much a pain butonce youve done it once you dont forget how and itgets easieri cant imagine any other cars are much worse than mine andy infante you can listen to what everybody says but the fact remains bmw r that youve got to get out there and do the thing yourself dod joan sutherland my opinions dammit have nothing to do with anyone else from rwfnscclehighedu robert william fusisubject for sale toyota camry toyota camry for sale deluxe package speed grey power windows power door locks amfm cassette power steering power brakes k highway miles excellent condition rob fusi rwflehighedu after pm email me for more info day until ask for bob fusi from wratunisqluucp wharfiesubject re questions about insurance companies esp geicoin article buckgranite buckgranitemabullcom ken buck writesunless you live in an area that gets frequent damaging hail stormsnahhh only about once a week march through may and sometimesin the fall from panterauxacsouiucedu doddek david jsubject re slick any goodmadafermiclasvirginiaedu michael a davis writes chances are that this has been discussed to death already andif so could someone who has kept the discussion mail me or direct me to an archive site basicallyi am just wondering if slick really does all it says that it doesand also is there any data to support the claim thanks for any infomike davisi dont have any written data but i know what i have experienced i use s in everything including my lawnmowers in my car it smoothed the idleand reduced the operating temp by degrees i havent used it long enough to test for wear but some people i know have a farmer that lives near by used to have to overhaul his big deisel tractorsat least every other year if not every year since he has been using she has went years without an overhaulalso a friend at a machine shop has in the past rebuilt engines with kmiles on them because the coustomer thought it was time these coustomershad ran s since almost new it was found when measuring the internalsof the engine that they showed only about the amount of wear that would beexpected of k miles not kin my opinion it worksbeware the cat is on the prowel disclamer hey im a studenta cat hungry as hell i dont need onedetomaso pantera efi twin turbo david j doddekwith liscence to fly it flies uofi panterauxacsouiucedufrom rfelixnetcomcom robbie felixsubject re warningplease readin article aprctpcom bpitactpcom bob pitas writesin article rddsagateberkeleyedu bhanarrescsberkeleyedu brian harvey writesrfelixnetcomcom robbie felix writeshow about the thousands of kind teenagers who volunteer at localagencies to help children seniors the homelesshear hear thanks robbieyou also dont read that much about violence against teenagers such asgeorge bush burying alive tens of thousands of unarmed iraqi yearoldswho were trying to surrender with bulldozerson the other hand i think it is true without singling out teenagersfor blame that violence is more socially acceptable than it used to bethose of us whod like to discourage violence have plenty of work to dowith people of all ageswell this isnt the right group for this but i have to say that i dontthink violence is any more socially acceptable now by any means howcan you say that when we used to have of pistoltoting gunslingers as heros or even gangland thugs being considered romantic do you thinkour great grandparent got yelled at by their parents for playing cowboysand indians i dont think so that behavior was somewhat encouragedback then in facti think the only difference between now and then is that nowadays whensome teenager kills another one in a classroom in california we here about it in ma the same day back in the old days theyd never hear about something like that period yeah people act really shocked about violence as though it were newto our specieswhat about the holocaust the crusades the salem witch trials thereligious persecutions of the middleages what about violent acts carried out in the name of religion all overthe world what about the early christians put to death by the romansthe jews persecuted by christiansthere are a lot more humans today than there have ever been i do notknow the stats but there are far more people on the planet than therewere or hundred years ago the per capita acts of violence areprobably not significantly different than they were a hundred or athousand years agothere is nothing new about violencerffrom cstkocrsvdelcoelectcom spiros triantafyllopoulossubject re v v v v vxin article cwphpklmegatestcom alungmegatestcom aaron lung writesvs vs and vsmancan you imagine doinga valve adjustment on one that has multiple nonhydraulicvalves in each cylinderaaroni was at the indianapolis motor speedway museum the other day and one oftheir very early winners was valves per cylinder and either frontwheel drive or all wheel drive i think front wheel drive and thatwas in spiros spiros triantafyllopoulos cstkocrsvdelcoelectcomsoftware technology delco electronics gm hughes electronics kokomo in i post therefore i armmfrom rootconvexcom superusersubject re val vs belsti was re best radar detectorin article brianhotsparearcnasagov briangothamcityjscnasagov brian donnell writesin article aprconvexcom tobiasconvexcom allentobias wrote i live in the backyard of the folks who make the stalker radar system the valentine has saved me many many many times from the stealth revenue enhancement traps of the local area i have had all the major brand detectors and imho nothing else even comes close to the v i hadnt heard of the valentine before cardriver and other automagazinesrecommend bel detectors i was considering their latest the sti which picks up super wideband ka and laser as well it also avoids radar detector detectors although i really dont care about this since idoubt ill be driving in virginia anytime soon or have any other statesalso made detectors iilegalhow does the valentine compare with the bel productsbrian donnellno comparison the bel is just a hooped up wideband escort like detectorno directional indicators no bogey counter no radar signature analysis noremote display option not as sensitive not as well built had it sent it backatfrom rjwaderainbowecnpurdueedu robert j wadesubject re saturn extended warrantyin article rninnieshelleyuwashingtonedu gaiacarsonuwashingtonedu iwe are gaia writesin article rbqginneiroundupcrhcuiucedu vivekcrhcuiucedu vivek chickermane writesadvice on saturn extended warranty i placed an order for a saturn sl and it is expected next week thesaturn retailer gave me some pamphlets about the extended warranty planand i have been thinking about it being a first time new car buyer i amseeking advice from veterans esp those who have bought saturns latelyfyi i have listed some of the features of the saturn extended warranty planthe car comes with a years mile bumpertobumper warrantyplan iextended powertrain coveragecovers the cost of repairs to engine transaxle front wheel drive hour roadside assistance programcoverage term yearsmilesdeductible i say extended warranties are a ripoff highprofit item for dealersbut what i really want to point out here is that you are not buyingk k k you get yrk free so what you are buying isk k k keep that in mind when you look at the cost vs coverageanother point is that many car companies routinely fix car problems that areout of warrantywhy designmanufacturing defects that the company owns upto keeping customer happy etcfrom bradbuckviewlogiccom bradford kelloggsubject re changing oil by selfin article hnbakcmuvmcsvcmichedu john foster hnbakcmuvmcsvcmichedu writes i find this method much better myself too although i do really hate it when the bolt finally comes loose and the wrench and my hand both come crashing into my face after coming to which is about minutes later i change my clothes because by this time all the oil has drained on me and ice my entire face and suck down about tylenol to ease the pain later in the day i then proceed with refilling the engine oil its just crazy how i try and change the oil on my cars in one weekendi go through about bottles of tylenol and bags of iceoh thats not so bad every time i try to change the oil i forget toshut off the engine first the hot oil comes out and scalds me blindsme then the engine starts to overheat and while im screaming in agonyand trying to crawl out from under the car i grab the red hot exhaustpipe and get third degree burns on my hands my screams intensify as ifinally emerge from under the car and i struggle to my feet in front ofthe car whereupon the radiator hose ruptures and sprays me with superheated coolant then the engine seizes but not before the cylinder headexplodes piercing my flesh with fragments of red hot ironthis happens every time im starting to think i should pay the mechanic instead paying the hospital and the dealer for a newcar this gets costly when you change the oil every miles toadfacefrom davewcsumdedu david g wonnacottsubject re infoopinions wanted on cars in this articlein article csthfnsnodakedu bellplainsnodakedu robert bell writesin article aprmagnusacsohiostateedu jnielsenmagnusacsohiostateedu john f nielsen writesin article fibercomcom rrgrtpfibercomcom rhonda gaines writesim in the market for a new car currently i own a mazda mx dxwhich has served me just fine however id like to geta door car since i dont relish the thought of moving a carseataround in a door car my criteria are door ac amfm cassettequick acceleration cruise control decent rear seat legroom myhusband is a footer it must also be under kpreferably closer to the k range which will probably rule outthe accord the cars that have caught my eye are toyota corolla toyata camry mazda pontiac grand am pontiac grand prix honda accord and civic if its roomy enough and still comes in a door model hyundai sonata and maybe even a small oldsmobile although not the achieva all opinions benchmarksrecommendations etc are welcomethe civic does still come in a door model my wife and i lookedquite seriously at the prizm corolla and civic as well assome other cars our impressions all three seemed well built and hadthe features we wanted these are similar to the features you wantexcept for cruise control and we want a manual transmission and areconsidering antilock brakes i also hate automatic seatbelts and weboth think having an airbag is a plus in general comfort andperformance were both significantsome specific s and s are listed belowmazda very comfortable and roomy can theoretically get abs on dx model though in practice this is hard to find base price for base model includes numerous little things like tach variable speed wipers rear defroster split folding rear seat more expensive than many other cars listed belowhonda civic dx gets significantly better mileage than other cars listed here comfortable front seat adjustable seat belt mounting no abs without ex model includes s of other things like a sunroofgeo prizmtoyota corolla seats not very comfortable to us your mileage may vary adjustable seat belt mounting can get abs without lots of other extrassaturn sl was quite comfortable though sl less so motorized attack beltsdodge spirit no real outstanding s but seemed generally ok rear seat does not fold downchevy corsica comes with abs standard lower would you buy that car again and safety ratings in consumer reports than first cars above suspension didnt feel as stiff as the others this would be a for somethe honda accord and toyota camry were both more expensive than the and in our minds not significantly betterwe probably gave disproportionately low consideration to the big due a to my wifes familys general dislike of chrysler productsb some unimpressive gm products owned by my parents and a housemateof mine c the taurus comes with automatic transmission i find theseat of the tempo very uncomfortable and the escort has attack beltsand no air bagwell probably end up with a i saw a dx with ac andcassette advertised for just under washington post april i think and my local dealer says they can match that price i willprobably get the maybe tomorrow the main question in my mindis whether or not i will have to do a factory order or preferenceorder to get one with abs and whether or not the dealership willrun the price up a lot if i do sofrom rjwaderainbowecnpurdueedu robert j wadesubject re saturn extended warrantyin article uuicvmuicedu uuicvmuicedu writesi agree with gaia even though the saturn has proved to be a very reliable carso far a little money spent now is worth the peace of mindthis is an interesting point some people are not really buying the coveragethey are buying peace of mind marketing folks love selling that i suggestthat people choose to not engage their minds in peaceless worry rather thanbuying that peace of mindin my opinion getting the powertrain warranty is enough in my case thats because anything that needed repairing in the interior sunroof windows doors etc i could do myself i just didnt want to mess with the engine and suchyoud be surprised how much the little knickknack stuff can cost what if your ac goes out steering rack dont get me wrongim against allextended warrantiesthey are a ripoffplus i think the extra years of hour roadside assistance must be worthe someting i opted for the year plan for extra yrs you realize the first yrk is free warranty that comes with the carthomasfrom cstkocrsvdelcoelectcom spiros triantafyllopoulossubject re ad said nissan altima best sellerin article rvkinnaftcronkitecentralsuncom dbernardclesuncentralsuncom writesi too was puzzled by this obvious untruth what i think is going on is thatnissan claims that the altima is the best selling new car namelplate inthe us i think i have this near verbatim lee iaccocas statisticsdept would have been proud of that sentencenote that the corollaprism are also new designs but hey are not new nameplates i guess nissan doesnt even sell as many altimas astoyota does corollas or there would be no nameplate qualifierbut waiiiiiit isnt nissan officially registering the car as far asgovernment paperwork goes nissan stanza altima to avoid costly andlengthy paperwork i read this on the net a while ago and someoneactually may have said theres a little stanza logo on the altimasomewhereyou can have it both ways spiros spiros triantafyllopoulos cstkocrsvdelcoelectcomsoftware technology delco electronics gm hughes electronics kokomo in i post therefore i armmfrom cregkocrsvdelcoelectcom ron gaskinssubject re dumbest automotive concepts of all timin article aprexuericssonse exuloxexuericssonse lasse ohlsson ttdt writes in article casorg sdmcasorg writes imho the dumbest thing we ever did in copying the japanese was moving the dimmer switch from the floor to the lever controlling the turn signalcruise the federal government has mandated that all passenger cars by model year return to the floor mounted dimmer switcha study by the national highway traffic safety administration nhtsa hasfound that an unacceptable percentage of after dusk collisions were thedirect result of unskilled drivers getting their left foot stuck in thesteering wheel ron gaskins cregkoptswdelcoelectcomautomotive electronic systems delco electronicsgm hughes electronics kokomo in ron gaskins cregkoptswdelcoelectcomautomotive electronic systems delco electronicsgm hughes electronics kokomo in from ctvrkocrsvdelcoelectcom thomas redmondsubject re warningplease readin article rddsagateberkeleyedu bhanarrescsberkeleyedu brian harvey writes rfelixnetcomcom robbie felix writes how about the thousands of kind teenagers who volunteer at local agencies to help children seniors the homeless hear hear thanks robbie you also dont read that much about violence against teenagers such as george bush burying alive tens of thousands of unarmed iraqi yearolds who were trying to surrender with bulldozers on the other hand i think it is true without singling out teenagers for blame that violence is more socially acceptable than it used to be those of us whod like to discourage violence have plenty of work to do with people of all agesi didnt know george could drive a bulldozerfrom hovnaniaiftccucaboeingcom paul hovnaniansubject re re toyota land cruiser worth it in response to a post about suvs i got several unsolicited recommendations to check out the land cruiser despite its astronomical price the toyota dealer told me its a cult car if a car is good enough to create a passionate and loyal following there must be something really extraordinary about it so all you land crusher cultists here is your chance to convert me jonathan edwardsedwardsintranetcom intranet incbased on my experience with a fj the hardtop jeepstyle model i would definitely give a new model consideration if i were in the market theolder models are very well built unless toyota lost its mind i wouldassume until proven otherwise that the newer models have inherited someif not all of the qualities of their ancestorstwo major differences in the running gear that im aware of need studymy has a solid front axle housing whereas the newer models haveindependant front suspension the solid axle is theoretically stronger andmore reliable than the newer model but only experience will tell theindependant front suspension is no doubt a compromise made to satisfythe typical user who will never need a real utility vehicle the seconddifference is the type of transfer case used on the newer models imnot sure but i think tioyota went to a fulltime wd or allwheel drivesystem the older landcruisers have a lockup type both have theiradvantages and disadvantagespaul hovnanianhovnaniaatcboeingcomstd disclaimers applyfrom jimfcenterlinecom jim frostsubject re is car saftey importantjnielsenmagnusacsohiostateedu john f nielsen writesin article rjrmvarmorycenterlinecom jimfcenterlinecom jim frost writestcorkumbnrca trevor corkum writesi figure that mph collisions into brick walls arent common enoughfor me to spend that much extra money for protection but there arelots of lowspeed collisions that do worry meget into an mph accident and you may reconsider ive been in oneand it is really scarey my life is something i value morethan a cars looks or handeling consider it insurance it may nothappen often but when it does youll sure be glad you got a safe cargranted the tests arent perfect but id much rather be in a car thatdid well in the test than a car that did horribly you raise a valid point but again its a tradeoff how much moneydo you want to spend for that kind of protection you could buy avolvo saab or benz and get really good crash protection and otherluxuries but youll pay significantly more for it in my case itsout of the question because all of those cars are beyond my budgeteven in highspeed headon collisions the most beneficial item you canhave is a good old point seatbelt nowadays at least in the usyou get an airbag if you get a point belt so presumably you get anadded safety benefit there as well thats something i certainly lookfor and which can be had in inexpensive carsmy of coursejim frostjimfcenterlinecomfrom jimfcenterlinecom jim frostsubject re best radar detector valentinetroysequentcom troy wecker writesthere is no question that the valentine has good range butnot significant enough to be or times as expensive as some of theothersthe big win with the v is not its range but rather itsdirectionality and multipletransmitter tracking which you latercalled a gimmick a conclusion i disagree with since thedetector incorporates multiple receivers its not surprising that itssignificantly more expensive while the added capabilities may nothelp you there is added value for those of us who live in areas wherethere are a lot of falsealarmssummary valentine way too expensive and not a significantly betterperformeri certainly call it interesting but im another person who thinksthat the added value might be coming at too high a cost veryadequate radar detectors are available for less than half the cost andone of them has suited me rather well if i did more longdistancetravelling in areas im not familiar with id probably considergetting the v because its additional information would be useful indiscriminating false alarmsjim frostjimfcenterlinecomfrom wardcsuiucedu christ wardsubject re dumbest automotive concepts of all timervmcmscsuohioedu writesin article clzjusnewscsouiuceduckauxacsouiucedu oriolefanuiuc writes laszlocsdcsduwmedu tyson f nuss writesfrom article pqiafnewsysuedu by akyfnysuedu john r daker fake convertible roofs and vinyl roofs any gold trimthese i will agree are abominations right along with the fakecontinental sparetire kit its sad watching those little old ladiestry to load their groceries into the trunk with that huge tiremedallionin the waymost pitiful fake convertible top on a cadillac cimarron withall the chrome door trim still visible not fooling anyoneof course there was that hyundai excel i once sawi have seen a cutlass supreme coupe gm with a vinyl roof dittoa taurus shoot the owners now before its too late it gets better ive seen them on a door escort chevy sblazer and even a chevy astro minivan a minivan w a fakeconvertible top is not something you want to see just after eating and better yettheres a chevette in town with wire crome wheelsvinyl roof tacky paint job and a continental spare showing the wirecrome wheel within of courseim scared to look on the inside and haveonly seen it rolling down the roadand i too was glad i hadnt just ate bob martel lady luck must have been a wonderful girlbobcuacsuohioedu shes never been a friend of minervmcmscsuohioedu the alan parsons project the b lives chris t ward dod dont take life too seriously you can never come out of it alive from ckauxacsouiucedu oriolefanuiucsubject re v v v v vxeliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines eliotare degree v flatsix engines chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom ckauxacsouiucedu oriolefanuiucsubject re v v v v vxaaspocwruedu andrew a spencer writesin a previous article finnegannrlsscnavymil saysin article aprengrwashingtonedueliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines eliotwouldnt that make them an i or would they really be an henceforth referred to asunderscore i think that it is technicaly known as a degree vee configurationcould be wrongthis is how ive seen them referred todrewthen what is a flat engine chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom conradiefirgasunacza gerrit conradiesubject re dealer cheated me with wrong odometer reading need helpin article qvrnpinnnidshelleyuwashingtonedu yongjehardyuwashingtonedu yong je lim writessubject dealer cheated me with wrong odometer reading need helphere is a story i bought a car about two weeks ago i finally canget hold of the previous owner of the car and got all maintanencehistory of the car in between and the instrument pannel of the car has been replaced and the odometer also has been resetto zero therefore the true meter reading is the reading beforereplacement plus current mileage that shows mile differencecomparing to the mileage on the odometer disclosure from the dealer never told me anything about that important storyi hope that i can return the car with full refund do u think thisis possible does anyone have similar experiences any commentswill be appreciated thankssomething that happened in south africa about a year ago a dealer sold a mercedes with an odometer reading of k kilometers to a lady turned out that the actual reading should have been k court case followed becauselady said she wouldnt have bought a car with that much kms dealer found quilty fined and had to take back the cari think you have a case if you can get a sworn statement from the previousowner take the car back to the dealer and threaten him or something gerritfrom conradiefirgasunacza gerrit conradiesubject re is car saftey important in article aprbnrca tcorkumbnrca trevor corkum writessubject is car saftey important i was recently thumbing through the lemonaid newcar guide what i found was a car would be given a recommendedunder the picture while a few sentences later noting how adriver and passenger were virtually guaranteed to be killedin a front end collision the most highly recommended smallcar the civic has the worst crash rating of all of the smallcars listed there were many such cases of great vehicleswhere you wouldnt survive an accident is it only me or issafety not one of the most important factors when buying a cardefinitelysafety is an important criterium for me when buying a car i wont buy a small car like a civic or whatevergreat safety handling speed for meseems to me that you would be more dead in a small car than a large car after an accident gerritfrom chrissnetcomcom chris silvestersubject production hold on firebirdcamaro w speedafter a tip from gary crum crumfcomccutahedu i got on the phonewith pontiac systems or pontaic customer service or whatever andinquired about a rumoured production hold on the formula firebird andtrans am btw talking with the dealer i bought the car from got menowhere after being routed to a firebird specialist i was ableto confirm that this is in fact the caseat first there was some problem with the performance axle ratioshe wouldnt go into any details so i dont know if there were someshipped that had problems or if production was held up because theysimply didnt have the proper parts from the supplier as i say shewas pretty vague on that so if anyone else knows anything about thisfeel free to respond supposedly this problem is now solvedsecond there is a definate shortage of parts that is somehow relatedto the sixspeed manual transmission so as of this posting there isa production hold on these cars she claimed part of the delay wasnot wanting to use inferior quality parts for the car and thereforehaving to wait for the right high quality parts im not positivethat this applies to the camaro as well but im guessing it wouldcan anyone else shed some light on thischris s chris silvester any man capable of getting himself elected presidentchrisssamamgencom should by no means be allowed to do the jobchrissnetcomcom douglas adams the hitchhikers guide to the galaxyfrom kissaneblackberkeleyedu john g kissanesubject re manual shift bigotsas a matter of interest does anyone know why autos are so popular in the us while here in europe they are rare just wondering john kissane motorola ireland ltd oouucp uunetmotcidglaskissanej mahon industrial estate internet kissanejglasrtsgmotcom blackrock cork ireland ufrom issacwisunomahaedu issa elhazinsubject re lexus and infinitikchongmothrantsuciedu keith chong writesin article aprmsusmsusedu wtiggerstcloudmsusedu writesfirst off the correct spelling of nissans luxury automobile divisionis infiniti not infinity i would also like to clear up the questionof what kind of engines power lexus and infiniti automobiles since aperson had remarked in earlier posts that most lexus and infiniti modelshad v engines while at the same time saying that several of eachmanufacturer used v engineslexus ls v gs v es v sc v sc vthe gs and sc have an inline infiniti q v j v g inline i must admit that i cannot remeber for sure hereinline is correcti hope this helpsbsbkeiththis is off the subject but dont the numbers in the car names above refair to the engine size in liters ie ls litre engine sc liter sport coupe and q liter similar kinda to bmw and mb nameing deal issasubject buy backfrom libemcbyuvmbitnetwe were at a dealership today looking at buying a car andthe salesman was showing us something he was calling abuy back is that a car that was fleeted and thengiven back for the new model the next year if thatis so how many miles is a good number to have on itand are these types of cars generally a good buythanksellenfrom markmbigfootspsmotcom mark monningersubject re borgward questionin article rminnnbshelleyuwashingtonedu monetcarsonuwashingtonedu diana smith writes my exhusband i used to own borgwards even tho they were ugly they had names one was humphrey borgwardthats pretty gooda friend had an audi that he named murphymarkfrom jwgsedvacdacdcom jwgsubject re warningplease readin article rddsagateberkeleyedu bhanarrescsberkeleyedu brian harvey writes rfelixnetcomcom robbie felix writes how about the thousands of kind teenagers who volunteer at local agencies to help children seniors the homeless hear hear thanks robbie you also dont read that much about violence against teenagers such as george bush burying alive tens of thousands of unarmed iraqi yearolds who were trying to surrender with bulldozersi didnt know george bush could drive a bulldozerkeeripejim greyjwgacdacdcomfrom sorlinmagnusacsohiostateedu steven j orlinsubject re changing oil by selfin article newsdukeedu infanteacpubdukeedu andrew infante writesyoure actually worried about somebody stealingyour oilahhh yes andrew we meet againno not stealing the oil just draining it as to leave me strandedcmon you think a vandalll do thatlet me guess youre from hudson ohiothats absolutely ridiculousget out and see the worldif i were the vandal and i really hated someone maybe someone who knewsomething about cars of course i would look for any types of valves i couldundo especially special oil drain plugs and radiator petcocksas well as putting bad things in the gaswhile i would never vandalize someones car if i were to it would probablybe the time bomb approach and im sure im not the only one who thinksthat waystevefrom abbottprioryenetdeccom robert abbottsubject re water in trunk of probein article rcrngtransferstratuscom tszetosneezytsstratuscom tommy szeto writeswater gradually builds up in the trunk of my friends ford probe everyonce in a while we would have to remove the spare and scoop out the waterunder the plywoodcarpet cover on the trunk i would guess this usually happensafter a good thunder storm a few qs is this a common problem where are the drain holes located for the hatch i had the same problem in my mx luckily i had it fixedunder warranty i think they replaced a tail light gasketcheck with a dealer its a known problemrobert k abbottabbotttpsenetdeccom from joeadvtechuswestcom joe thielensubject re what is the deal with bluebook value of an autoin article cwordexnewscsouiucedu ckauxacsouiucedu oriolefanuiuc writesnewtonconvexcom vicki newton writesi am in the process of buying a new auto i havent decided yet whetheri should sell my current car myself or trade it in as part of the newauto purchasei know that the blue book value for the car is an acquaintencehas offered to give me blue book value for the car i am just wonderingif this is a standard measure for negotiating a resale price or if ican hope to get more money from someone else what exactly is blue bookvalue based on i know that for its year my car has low mileage it is in excellent working condition but does have a fewdings on the exterior nothing major do any of these facts alter thefair selling price of the car i am not looking to rip anyone off ijust naturally want to get the best price for the carthanks a millionveeki think the blue book is the nada handbook for used car prices nois the blue book value given the retail or wholesale value the blue book value isnt set in stone though low milage extra addonsand stuff like that there can increase the resale price of the car youmay want to head on over to the local library or borrow your friendsblue book and read up on that sort of stuff i paid under bbretail for my civic in and it was in perfect condition andhad only k miles on it the guy was desparate to sell new kid onthe way etc but it was a good price remeber both you and the buyer if he has any sort of brains at all are using the blue book soyou should pick a fair price chintan aminllamauiucedu chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areaa mileage chart should be available in the book it usually goes bythe class of car you own and year usually you will end up adding a fewhundred dollars to the retail price or subtracting it consumerreports also has a number you can call and get a quote for your areaa friend of mine used it and was quite happy with the service ibelieve it cost about joefrom joeadvtechuswestcom joe thielensubject re help with mitsubishi galant gs transmissionin article rjlinnacphaktuscedu rmakaremuscedu total stranger writeshii need your help with a problem i have with a mitsubishigalant gs transmission the car has a speed manual tranmissionsince the car was bought new while shifting from nd to rd unless i do it slowly and carefully it makes a popping or hitting soundthe dealer and mitsubishi customer service reached by an say this is normal for the car is itand about a year ago at kmiles the stick shift handle got stuckwhile attempting to put it in reverse the shifter would not budge the clutch had no effect the front tires would not budge even when the clutch is fully depressed if the clutch is released the engine would die assuming that some gear was engaged while the shifter was stuck i could not make the car move it acted as if it were in neutralexcept for dying when clutch is released i finally was able to release the shifter by having someone rock the car back and forth less than an inch while i depressed the clutch and jiggled the shifter the shifter acted normally after thatwhen this happened i took it to the dealer they checked the clutch it was ok they checked the transmission it was oki had the exact problem a couple of months ago and again lastweek the dealer says there is nothing they can do because mitsubishi the says they have never heard of theproblem and the dealer could not reproduce the problem whilethey had the car in all three occurances the car was parked head first in a garageand since the front wheels were stuck the car could not be towedto the dealer before releasing the shifter hence temporarilysolving the problem and the dealer and mitsubishi refused tosend someone to check the car while it was stuck i know there is smething wrong with the transmission shifting from nd to rd and getting stuck at random but i cant get the dealer to fix it i need your help with the mechanical problems and with how to handle mitsubishi all hints and suggestions are greatly appreciated and sorry tobore you with the long postthanksrabihtry another dealer sometimes the sophistication of equipment etc isbetter at one dealer than another you may also find another dealerwilling to help you with the problem joefrom callisonuokmaxecnuoknoredu james p callisonsubject re manual shift bigotsin article aprericssonse etxmststaericssonse writesbut why not turn the question around why are automatics so common inthe usbecause some people like them and some people actually need themmy guess is that when they tried to couple manuals to the torquerichvs in the sixties the clutches turned out as real killers you had to use both feet to depress and that this has just lived onyeah right real muscle cars had a manual transmission and theirclutches arent that heavy shelbyamerican used plenty ofhighpowered hightorque engines and carroll only put autos inhis cars because people wanted them blasphemers hereticsburn them burn them for defiling a shelby with an auto real cobras and they were the ultimate sports car at thetime had bigblock fords which turned out prodigious amountsof power and torque and none of them had automatics and also an automatic with a v engine can be real fun to driveyeah if you call a gear shift in the middle of a curve fun i personally would love to have a galaxie liter coupewith a firebreathing and fouronnafloor to go along sidemy galaxie pillarless hardtop with a firebreathing with threeonnatree i love the sound of dual exhaust in themorning theres no comparison between a real americanmuscle car and a car with a big engine and an automatic imho jamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom callisonuokmaxecnuoknoredu james p callisonsubject re warningplease readin article drutxattcom klfdruwaattcom franklinkl writesin article csribahconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writes i normally have an unloaded colt delta in my glove box with a loaded magazine handy which is perfectly legal in oklahoma for those times that im travelling interstate i keep an unloaded sw magnum revolver in the glove box with a speedloader in my pocket which is legal everywhere under federal law illinois state police be hangedcarrying a pistol loaded or unloaded in the glove compartment isconsidered carrying a concealed weapon in colorado and is illegal withouta concealed weapons permit unless the law has been changed recentlycarrying a weapon openly is legal in colorado but concealing it is illegali read a newspaper account last year where police stopped a car on atraffic infraction and observed a magnum revolver sitting on theseat the driver could not be cited for possessing or carrying the weaponbecause it was not concealed the article stated that if the gun hadbeen discovered in the glove box it would have been considered a crimecarrying in the glove box is not coveredim not sure what i was thinking there it is legal in oklahoma on interstate travel as long as it is legal for you to ownat your point of origination and destination the gun is carriedin a locked compartmentbox glove box specifically excluded separatefrom the ammo it is legal under title chapter section iforget and my copy of the regs is at home of the us code thisunfortunately has not prevented the theft by state troopers of acertain state which shall remain nameless to protect the hopelesslystupid under that states lawgee and i thought federal law overrode state lawjamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom wchuttalexmonsantocom bill c huttonsubject mr car cover for salefor salefitted car cover specifically for mrtop of the line evolution tm fabric used for less than monthsthe cover is in excellent conditionno rips cuts stains or otherblemishes it has grommets for a locking cable the color is silverprice fob will ship collectplease contact wchuttmonsantocomor phone at after pm cdtfrom gwmsplsplloralcom gary w mahansubject re lexus and infiniti dont the numbers in the car names above refair to the engine size in liters ie ls litre engine sc liter sport coupe and q liter similar kinda to bmw and mb nameing deal note bmw doesnt always follow this conventionfor example i had a liter engine the had a literfrom bowmanjcsnorg jerry bowmansubject re opel ownersin article csxijbnewscsouiucedu ckauxacsouiucedu oriolefanuiuc writesgibbonsafrasersfuca darren gibbons writesim looking for information on opel cars now you ask which modelwell the sad truth is im not entirely sure but its a twoseaterwith rollover headlights hard top and really sporty looking myfriend has one sitting in his yard in really nice conditionbodywise but he transmission has seized up on him so it hasnt runfor a while does anyone have any info on these cars the enginecompartment looks really tight to work on but it is in fine shape andi am quite interested in itthanksdarren gibbonsgibbonsasfucathis would be the manta would it not sold through buick dealers in the mid s as the price leaderchintan aminllamauiucedu if it looks like a miniature corvette it would be an opel gtthe headlights are flipped over by pulling a lever inside chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom aaspocwruedu andrew a spencersubject re mr noisy enginein a previous article eliotlanmolaengrwashingtonedu eliot saysin article rvofinnusenetpadeccom tomacjopcoenetdeccom thunderbirds are go writesare there any mr owners or motorhead gurus out there that know whymy mrs engine sounds noisy the mrs engine is noisy at the best of times but not even a nice nose its one of those very ugly noises assuming yours is a non turbo mr the gruffness is characteristic ofa large inline that doesnt have balance shafts i guess toyotadidnt care about little details like that when they can brag aboutthe mid engine configuration and the flashy stylingmyself i automatically cross out any car from consideration orrecommendation which has an inline larger than liters and nobalance shafts it is a good rule of thumb to keep in mind if youever want a halfway decent engine if the noise really bugs you there is nothing else that you can doexcept to sell it and get a veliotnice theory too bad the mrs never came with a four cylinder over liters more like or did they were the nonturbo mriis orsome suchi also understand that anyone using balancing shafts on four cylinders mustpay saab a royalty for using their patented designlike porsches ic yadrewfrom gtaprismgatechedu james b atkinssubject honda mailing listis there a honda mailing list and if so how do i subscribe to itfrom marshattfeserveccpurdueedu zauberersubject re its a rush was re too fastin article tcorabgatorpicaarmymil tcorapicaarmymil tom coradeschi writesuseless road design speed rate discussion deleted actually the roads were designated as safe at when they were built in the s taking into account the kinds of cars then available the number would be much higher today because the cars tires and just about everything else has imprivoved a lotexcept the driversthank you travis disclamer the ideas expressed above are in fact the same as my employer since i have none email flame at marshattfeserveccpurdueedu from erinienterpriseifpuiucedu erini dosssubject cellular antannas i need to get some info on cellular antennas whoare the biggest companies in this market now how muchdo their antenna cost what are the specs on the antennasgain directivity who is the contact personthankyou email at erinienterpriseifpuiucedufrom marshattfeserveccpurdueedu zauberersubject re locking lugnuts tire rebalancein article aprskclamonsantocom masskclamonsantocom writesif you put a locking lugnut on your tires do you need to have yourtires rebalancedjohn masemail address masskclamonsantocomi bought a set of ares a few months back and decided to add locksso that i could keep my new rims i havent had a balance problem yet so i assume that it might be just particular to your type ofstock nuts my rims were balanced with new bfg tas at a speed shop to the finest setting on their bal machine so that helps toozauberer aka travis tfrom erinienterpriseifpuiucedu erini dosssubject trucking industry which are them main trucking companeies andtheir locations do you have the name of aca contact personthanksemail at erinienterpriseifpuiucedufrom almanbsrhpcom bob almansubject re where can i get a new york taxiwharfie wratunisqluucp wrote in article crarbsrgenprpsrhpcom almanbsrhpcom bob alman writes hose hose dork dorkoh really heres what you posted earlier in another thread before you thrashothers for making simple mistakes or flaunt your wonderful vi skillthink about how you make them feel as well as how you look you spelledit right for years you have assaulted others with offensive language etc fromthe content of many of your posts you appear to have a lot of usefulinformation to share with people but it gets overshadowed when you comeacross as an abusive smartass wharfie wratunisqluucp wrote in article cloblddwmentorccpurdueedu marshattfeserveccpurdueedu zauberer writes remember roads in america are not designed for speeds above meaning they would be safe at roads like the autobahn are smootherstraiter wider and slightly banked well thats news before the speed limit on texashighways was the speed limit on the new jersey turnpike i was there were no speed limits in nevada or montana east becoming hidden by trees after about ft and continued tothe left strait north i wanted to turn north checked the south lanerolled straight straightfrom marshattfeserveccpurdueedu zauberersubject re choice of gaugesin article cyboeivcdhpcom dmunroevcdhpcom dave gauge writesif you had free reign to design your own instrument cluster whichgauges would you choose to have beyond the basic seti consider the basic set to be tach must have coolant temp or cylinder head temp for aircooled engines must oil pressure must amps ive seen amps and volts i would go for the volts speedo must you ask fuel i would like to know how much gas i have of course the gauge i have now dosent tell me st so i could see not having one in favor of a warning light at say miothers that are nice to have volts maybe this should be in the basic set vacuumboost oooooohhhhh how i would looove to have a vacuum gauge on my dash travis disclamer the ideas expressed above are in fact the same as my employer since i have none email flame at marshattfeserveccpurdueedu from tutcairoengsuncom bill bill tuthillsubject re comparing saabs bmwsedwardsworldstdcom jonathan edwards writes bmws suck in the snow i have aggressive snows plus a hundred pounds of sand in the back and i still try to avoid driving in the snow i happily took the saab through blizzard conditions without a worry i would say this is the single design flaw in the bmwfor a reasonable sum you can get a bmw with traction controla torquesensing limited slip rear differential since nofwd car including the saab has this kind of front differentialsince it would exacerbate torque steer a bmw with traction controlshould have the theoretical advantage on snow of course weightdistribution and skinny tires could affect thisfrom chaneerochesteredu chansubject bfgoodrich radial ta touring ta tireshii am looking for tires i would like to hear your experience on the bf goodrich radial ta tires andor the touring ta especially forsize prfor radial ta how do they do in snow and wet weather are they quiet tiresfor touring ta how many miles can they last i believe they are in every way equalbetter than radial ta am i rightchanfrom amilleralmadenibmcom alex millersubject re choice of gaugesif im going to drive on a public road then i need aspeedometer and an odometer helps for navigation my chevy has a bare minimum enginetemp andoilpress warning lights and a fuel gauge my vw has tach watertemp voltmeter and oiltemp gauges if i had a turbo car id want a vacuum manifoldboostgauge an oil pressure gauge is a nice reassuringgauge to look at if my car was air cooled then iwould substitute a cylheadtemp gauge for the watertempgauge a few years ago i looked at the audi quattro si coupethat bobby unser used to win the pikes peak hill climbthe gauge layout from left to right top to bottom was speedometer fuel trannypress temp differential watertemp temp big orange tachoilpresswarning light oiltemp boost oilpress alexamilleralmadenibmcomfrom eliotstalfosengrwashingtonedu eliotsubject re comparing saabs bmwsin article lthoninnrexodusengsuncom tutcairoengsuncom bill bill tuthill writesfor a reasonable sum you can get a bmw with traction controla torquesensing limited slip rear differential traction control as far as the optional feature that one buys withcars is not the same thing at all as a torque sensing differentiala torque sensing differential is a type of lsd but not all lsdsare torque sensing viscous coupled differentials as opposed toviscous couplings are rotational sensing not torque sensingfor that matter so are traction control systems that use abssensors and pulse brakingthen there are the older positracs and whatever which i am notfamiliar with the workingseliotfrom jjmckayuxcsouiucedu jim mckaysubject re water in trunk of probetszetosneezytsstratuscom tommy szeto writeswater gradually builds up in the trunk of my friends ford probe everyonce in a while we would have to remove the spare and scoop out the waterunder the plywoodcarpet cover on the trunk i would guess this usually happensafter a good thunder storm a few qs is this a common problemyes this is a common problem the leaks occur through the seal of the taillights unfortunately ford has this with most probes and doesnot have a recall for it very dissatisfying to say the least where are the drain holes located for the hatchthere is no drain holes that i know of i used a margine tub to drain itregretably i waited three months as i was short cash and they wouldnt fix itunder warrantee then i paid dearly as it messed up my electrical systemincluding a balancemotion sensor which is located near the fuel shutoff in the trunk this resulted in my passive restraints malfunctioningthey wouldnot retract so i ended up paying about to have the sensor replaced to have the tail lights resealed they firts replaced the hatch gasketwhich i insisted was not the problem so they did not charge me for thatwhen i proved to be right not to mention the water damage to the covers to the trunkspare com partment and algae in the taillightsvery annoying dont let the water problem goget it fixed or youll paymore later considering how common a problem it is i hope every onecomplains to fordthanks for any infotom tom szeto no not those peanuts the ones on thetszetosneezytsstratuscom bottomggnuuaahuuhh include disclaimerh homer simpsonfrom shantanuriscspsmotcom shantanu gangulysubject re are bmws worth the pricein article ceylongtecom hhdharveygtecom horace dediu writesin article pvjlninnckfdaffyspsmotcom shantanuriscspsmotcom shantanu ganguly writes some comments a good performance and mid and high speeds can be obtained by adjusting the top gear and final drive ratios contrary to popular misperception a number of japanese cars have quite good performance from in top gear no problem with that the question is do they perform consistently in allconditions roads winds and curves at that speed and do so for hours on end year after year without giving the driver white knuckles from my experience on the autobahnsautostrade a good touring car can be easily distinguished by its poise at mph the best stay on cruise control at for hours iveseen the typical boy racer in a fiat try to keep up sure they hit the centurymark but if the wind blows the wrong way they change lanes and if on anoverpass they may fly right into a guardrail the buffeting at can besevere enough to make the hood bend tires at can melt and a pothole cankill many german cars are designed for this environment even if they cantseem to get out of their own way from a stop light mercedes come to mind inparticular and another design point is fuel economy at those speeds thegermans gear the car for very good high speed efficiency a typical mb e turns at almost a stall good point i have no idea how either of my hondas will handle at mphnor do they reach however using high to be mpha they are quite amenable to long high speed drives ive done severalk mile trips in my civic with no problems whatsoever the last big tripi made was driving from new york to texas i remember driving miles a day at typically mph without any problems im sure i would have been more comfortable driving a benz but no white knucklesno problems with winds and curves then there was the trip back from new orleans after mardi gras wherewe were doing all the way to houston no problemsb both my cars have surprising good fuel economy at high speeds i seeno difference between sustained mph and sustained mph on the tripback from new orleans we got about mpg in my integra quite ok mindyou the engine revs to almost k at the civic is markedly betterthan the integra in fuel economy k miles down the road i stillget mpg at mph driving b i cant understand why these highscale european marquees are afraid to design engines that can be repeatedly revved to near redline in the low gears i have been doing that for that last k miles with my lowly civic with no detriment to either the engine or the clutch and getting excellent mpg to boot id call this an engineering hack to cover up design deficienciesat k miles youd still be breakingin a highscale european marquee they typically are designed to last miles per engine mi perchassis the record is now over miles on a benz diesel and iveread about transmissions lasting miles speaking ofnow now you cant compare a diesel with a gasoline engine i see enoughbmws and gasoline mercs for sale that have k miles on them and advertise rebuilt engines if honda was to build an accord for k id darn wellexpect the sucker to last k milesdiesels they have very good efficiency at the cost of acceleration and are verypopular in all european cars diesel is considered the green fuel from thesmallest econoboxes to the luxobarges again we see a difference in mentalitydiesels in the us are considered slightly worse than useless and extremelydirty to boot so you cant give them awayever got caught behind a early s sdl at a stop light its notpleasant the newer mbs are a lot better though the diesel volvosand vws are probably the smelliest offendersas for economy why should we care gas is cheap i personally wouldntbuy a diesel car for any reason what does it buy meshantanu gangulysomerset motorolaphone motorola inc mail drop oe fax william cannon drive w austin tx email shantanuibmotocomoakhillspsmotcomfrom andreinamaouucp andrei chichaksubject re bimmer vs beamermark monninger markmlatium wrote although not in direct response to the referenced article just to set the record straight beamers are bmw motorcycles bmw cars are bimmers please lets get our terms straight actually some purists would argue that the only true bimmer is a round tail light or markback when i was building round tail light s they were bimmers it wasonly when the red suspendered reganomics generated quiche eating yuppiesgot into the market that they became beamers and the hood ornaments starteddisapperingandreifrom caknscclehighedu chad andrew kauffmansubject car alarm info ungo box i want to get a car alarm and i am thinking about getting an ungo box does anyone out there have any knowledge or experience with any of these alarms how about price ranges for the different models are these good car alarms please email me any responces caknslehighedu chad chadfrom bmossgrinchsimescom brent spuzy mosssubject re water in trunk of probethe rubber drain plugs under my carpet in my mazda glc leakedlike the ones are doing under your spare in the probei tooke them out and put some silicone sealant on themand put them back infrom rhorwellcrabnetworka roland faragherhorwellsubject re what car is thisin article ericssonse etxmststaericssonse markus strobl writesin article rninnkpctronnewsctroncom smithctroncom lawrence c smith writesin article aprreededu rseymourreededu robert seymour writesin article aprwamumdedu lerxstwamumdedu wheres my thing writes it was called a bricklinbricklins were manufactured in the s with engines from fordwaitaminnit didnt the bricklin have an pugeot sixcylinder or am iconfusing it with the delorean i was sure the delorean had a vthe delorean had the yucky prv v engine a jointventure between peugout note spelling renault and volvo prv this engine is a mighty boring markus markus what is that we are noting about the spelling that you arent good at it that peugeot is out of n america what does this meanroland an intrigued peugeot admirer from firmanenvmsaeasasuedu b b ssubject re viperin article cjnhaibmurdochaccvirginiaedu rmtrfaradayclasvirginiaedu roy matthew thigpen writes last night i had a dream that my dad bought a viperi took it out for a test drive without his knowledgeand had to push it all the way home just to avoid a ticketwierd dream i wonder what it means you probably should told you dad to buy that car than your dream mightcome truefrom rjwaderainbowecnpurdueedu robert j wadesubject re saturns pricing policyin article qnmcsvelaacsoaklandedu mjepookiepasswayneedu writesi just ordered a saturn sl after considering a few imports frankly the saturnstuff deletedsaturn also has a good extended warranty program for yeark miles fully refunded if you dont use it that works out to an actual cost of orso based on the year treasury rates using savings account rates its morelike in the first three years it also buys you free rental during anywarranty work without counting against the refundmikein general extended warranties are a ripoff this yrk is really onlyyrk because you get the yrk one free with the car also is thereperhaps a deductible you pay each and every time you use the warrantyalso are certain items excluded from coverage on the extended warrantyand if you use it at year for some buck job and pay a deduct and thenyou have used it so no refund everagain extended warranties are ripoff high profit items for the dealerfrom daubendrnextworkrosehulmanedu darren r daubenspecksubject re plymouth sundancedodge shadow experiences they are pretty much junk stay away from them they will be replaced next year with all new models junk theyve made the cd lists for years due to their excellent handling and acceleration they have been around since about oh or so theyre not the newest on the lot and mileage is about five to eight mpg under the class leader you can get into a l v hp shadow for k the i turbo a bit more and a droptop for k from davidtrsvaxtandycomsubject re dirty diesels i wouldnt want anyone to make kindling out of my front living room wall and then drive their diesel powered m tank into it shooting superhot soot all over my curtains and that freshly made kindling in other words please dont flame me yup ill have to answer for this onefrom tvervaekcolhpcom tom vervaekesubject re toyota land cruiser worth itmy wife and i looked at and drove one last fall this was a modelit was wayyyyyyyyy underpowered i could not imagine driving it in themountains here in colorado at anything approaching highway speeds ihave read that the new models have a newer improved hp engine im quite serious that i laughed in the salesman face when he said onceits broken in it will feel more powerful i had been used to driving ajeep l hp engine i believe the s land cruisers land yachtswere l the sames as the runner which is also underpowered in myown personal opinion they are big cars very roomy but nothing spectacular tom vervaeke email tvervaekcsitchpcom hewlett packard co phone i love animals they taste delicious from davewcsumdedu david g wonnacottsubject questions about insurance companies esp geicoim considering switching to geico insurance but have heard thatthey do not assign a specific agent for each policy or claim i wasworried that this might be a real pain when you make a claim i havealso heard that they try to get rid of you if you have an accidentim interestend in determining whether or not these things are truehas anyone out there with geico made a claim id be interested inhearing whether or not you were satisfied with the service and whetheryou then had trouble renewing your policyim also interested in any good or bad stories about liberty mutual orstate farmfrom sergeiismorgancom sergei poliakoffsubject re warningplease readmchaffeedclnxt michael t chaffee writes be valued in terms of money because they are human beings i submit that they are not human beings such submissions have been made before eg regarding jews in article aprnusccnussg matmcinnnusccnussg matthew macintyre at the national university of senegal writes absolutely a scratch on my car bothers me more than the death of any number of scum all of you feel the same wayyou just wont admit it when are people going to realise that the mere fact that a piece of flesh moves and has the approximate shape of a human being does not in itself mean that it has rightsall you dirty harry types eager to pull a gun on some scum guilty of scratching your stupid painted metal boxes on wheels have you ever killed a human to speak so lightly about such matters sergei from marklukecraycom mark deansubject re ford and the auto hello my name is russell wong and i am doing a research project on henry ford and his automobile i need information on whether ford is partially responsible for all of the car accidents and the depletion of the ozone layer also any other additional information will be greatly appreciated thanks so would mr benz ehand mr chevy mr toyokogio and mr insert car name heredan reed blucellarorg eat your pets poke out your eyes kill your boss burn down your house move to elmer nj rip out your nose hairs with a lead holder use xacto knives for dental work hit your motherpeople get a life mdfrom mobasservuvlsieevilledu bijan mobasserisubject re renting from alamo cause a friend rented a car last year and it turned out he needed a lot moreinsurance than whats included in the base price but on the other hand he didnt rent it from alamoprobability that ill be needing more insuranceunless you have an accident you wont need more joelet me see unless you have an accident you wont need more hmmmmmmmbijanfrom yjwondecacsumnedu youjip wonsubject manual xmissionadvice neededi have manual transmission speed it difficult to engage gear does xmission oil change improve this situationwhat do you think about the most favorable xmission oil change periodyoujipfrom brothermrcnextcsouiucedu jesse mccabesubject re choice of gaugesdmunroevcdhpcom dave gauge writesbbi can think of a few others but what are your ideas and whydavewell in my bmw i like the little light that turns on when you are runningout of gas its a big help if you got a turbo that gauge is a mustif i could id just like all the gauges possible on my car but we canthave everything can wefrom jgossgaiatorolabibmcom jeff gosssubject re v v v v vxin article aprtelxonmistelxoncom joestelxonmistelxoncom joe staudt writes newsgroups recautos path eclipseyktnewswatsonibmcomnewsgatewatsonibmcomnewsansnethowlandrestonansnetnewsserverjvncnetlouieudelnewsinterconcompsinntptelxonmistelxoncomjoes from joestelxonmistelxoncom joe staudt organization telxon corporation references aprengrwashingtonedu aprcstulaneedu rufkfrusenetinscwruedu date fri apr gmt lines in article rufkfrusenetinscwruedu aaspocwruedu andrew a spencer writes in a previous article finnegannrlsscnavymil says in article aprengrwashingtonedu eliotstalfosengrwashingtonedu eliot writes the subarus all use degree vees in their engines eliot wouldnt that make them an i or would they really be an henceforth referred to as underscore i think that it is technicaly known as a degree vee configuration could be wrongthis is how ive seen them referred to drew ive always heard them referred to horizontally opposed joe kinda dull ive always liked boxer subarus can use this as doesporche and bmw twins thats a motorcycle for you with too many wheelsjeff gossfrom jdenunepandorasdsuedu john denunesubject re sport utility vehical comparisons any opinionskarl elvis macrae kmacciscocom wrote im looking at the following three suvs anyone whos driven all three have any strong opinions ford explorer toyota runner nissan pathfinderwell i was just in your position and i drove all three and likedall three it was a tossup i marginally went with the pathfinderbased on reliability and looksi dont think you can go wrong with any of themjohnjdenunepandorasdsuedufrom john foster hnbakcmuvmcsvcmichedusubject re changing oil by selffrom drewkinglearcscoloradoedu drew eckhardtin article podsourswozau podsourswozau paul odonnell wriin qgieinnhsskeenaucsubcca yiklamunixgubcca yik chong lam writeshello does anyone know how to take out the bolt under the enginecompartment should i turn clockwise or counter i tried any kindof lubricants wdetc but i still failed do you think i can use a electric drill change to a suitablebit to turn it out if i can succeed can i retighten it not tootight is it safe without oil leakyou shouldnt need any power tools to undo it an electric drillprobably wont give you much extra torque anyway wd will helpthings that are seized due to rust but this is unlikely for a drainplug you should be able to undo it with a spanner when itloosens it will probably become very loose and you will bash yourknuckles on the underside of the car this is the price you mustpay for doing you own workno thats the price you pay for not knowing how to use awrench you want to pull the wrench towards you away frompainful knuckle splitting hard things if you cant pull itbecause things are in the way push it with an open handi find this method much better myself too although i do reallyhate it when the bolt finally comes loose and the wrench and myhand both come crashing into my face after coming to which isabout minutes later i change my clothes because by this timeall the oil has drained on me and ice my entire face and suckdown about tylenol to ease the pain later in the day i thenproceed with refilling the engine oilits just crazy how i try and change the oil on my cars in oneweekendi go through about bottles of tylenol and bags of icejohnfrom dspalmemkeabcom diane palme xsubject re wife wants convertibleaaspocwruedu andrew a spencer writes nuetkeptsmotcom keith nuetzman x p writes help my wife has informed me that she wants a convertible for her next car jpvllyoakresuncom jeff perry writes fyi just last week the pbs show motor week gave the results of what they thought were the best cars for in the convertible category the snip snip does porsche have a patent on the targa name i mean convertible to me means top down which the del sol certainly does not do it has the center that lifts out this is what i would term a targaunless porsches was gonna sue me for doing that i know the rear window rolls down but i still can hardly consider this car to be a convertible drewhere we gono of course porsche doesnt have a patent on the targa name if that werethe case what would fiat do i suppose that technically my del sol is not aconvertible in the literal sense but it certainly classifies as an opentopped car in addition the rear section behind the removable top is whatmakes my car infinately safer than a convertibleflameretardant on dianedspalmemkeabcomsubject re information neededfrom mchaseonebalmanacbccayjwondecacsumnedu youjip won writes hi this is my first time to post on this news group now a days i have stu there is a engine warning signal on the dash board while driving this si i wanna know how the engine warning signal comes is anybody out there who low oil pressure usually could be your oil pump orchecked your oil latelymc mchaseonebalmanacbcca mark chase the old frogs almanac home of the almanac unix users group v public access usenet x vancouver island british columbia waffle xenix from kkingcsuahedu ken kingsubject re the kuebelwagen in article ckcofmentorccpurdueedu thwangmentorccpurdueedu tommy hwang writessorry for the misspelling but i forgot how to spell it after my series of exams and noon hand reference hereis it still possible to get those cute wwii vw jeepwannabesa replica would be great i think greetings you may be in luck i seem to recall seeing a blurb in one ofthe kit car magazines about a company in norway who pulled amould sp off a real kubel and has adapted it to the beetlefloorpan as for the suspension all i can remember about thevw thing i used to own is that it had about more suspensiontravel than a stock beetle but id heard that there were aftermarket parts for offroad use that were as good or better notethat the major difference looks wise between a kubel a thingare the hood and the fenders the kubel had an external sparemounted on the hood and the hood sloped down for visibilitysharply and had rounded fenders the thing has a lightly sloped hood with the spare mounted inside unless moved to make for moreluggage space and has halfhexagon shaped fenders imagine anut large enough to put a tire in and cut off the bottom halfof it unfortunately i dont have that info anymore try stoppingat a local bookstore and copying down the phone numbers for thetwo big mags and calling them they might be able to get thenumber for you dont forget to calculate the time difference tonorway before callinglaterkc a quick bones help me get include o this klingon off my ss stddisclaimerh damn it jim im a kkingcsuahedu doctor not a bidet from richnetcomcom richard soennichsensubject re service indicator of a bmwsave youself the cash take it from a bmw mechanic idiot lights are for just that buy yourself a ballpoint pen and write it down yourself change your oil every mi and you will be just finefollow the regular service intervals in you r book alsofrom qazicsdcsduwmedu aamir hafeez qazisubject re mercury villager minivan good buyfrom article ruckinncmfgapcaltechedu by wenkingcscaltechedu wenking su in article rcrinnvarsumaxseattleuedu smorrissumaxseattleuedu steven a morris writesthe villagerquest seem like the best of the cravanvoyager copies to come along since the mazda mpv the nissan maxima engine paired withthe maxima speed auto trans should be an excellent drive train and the rest of the vehicle seems well engineered only the price iscontroversial hmm the last time i checked villagerquest does not have a maxima engine and is very much under powered for its weightyes it does come with the maxima gxe engine mated to the maxima se transmission and it has decent power for a minivan also check againaamir qazi aamir qaziqazicsdcsduwmeduwhy should i care id rather watch drying paintfrom eliotstalfosengrwashingtonedu eliotsubject re ultimate awd vehiclesin article clzecbnewsjcbattcom rdbcbnewsjcbattcom ronaldjdeblockjr writesyes i saw a turbo quattro wagon on i in nj on monday i thoughtaudi stopped selling wagons in the us after the this is exactly thetype of vehicle i would like to own i bet its price is times mycar budgetthink again thanks to minutes tick tick tick used quattros are bargains s go for about k s go for perhaps or k more the valve s are quite a bit more because of anenormous hp and torque gain i think they go for about to k ifyou can find one i have seen quite a lot of quattros notthat many wagons though at the dealer lot they use very highquality paint and the entire car is zinc galvanized so it will neverrustin short typically a yr old looks no more older than a yearold and the bangers are bullet proof engines k out of one isnot rare even for a turbo which is watercooled for the s thenthere are aftermarket chips that you can buy to bump up turbo boostif you are into luxogizmos the cars are loaded with just abouteverything toothe price of parts is a different story thougheliotfrom callisonuokmaxecnuoknoredu james p callisonsubject re dealer cheated me with wrong odometer reading need helpin article qvrnpinnnidshelleyuwashingtonedu yongjehardyuwashingtonedu yong je lim writeshere is a story i bought a car about two weeks ago i finally canget hold of the previous owner of the car and got all maintanencehistory of the car in between and the instrument pannel of the car has been replaced and the odometer also has been resetto zero therefore the true meter reading is the reading beforereplacement plus current mileage that shows mile differencecomparing to the mileage on the odometer disclosure from the dealer never told me anything about that important storyi hope that i can return the car with full refund do u think thisis possible does anyone have similar experiences any commentswill be appreciated thanksthis is a tricky situation if the previous owner didnt informthe dealer of the odometer change then the previous owner committedfraud and he may be liable the dealer may also be liable if theprevious owner notified the dealer or if the previous owner had the dash replaced at a dealer or if the previous owner had the dash changed legally any records search on the car should turn up the fact thatthe odometer had been altered if a dealer changes the speedometer he hasto report it it goes into the cars service record with the manufacturerand on the title if i remember correctly the dealer told me thatthe old mileage etc were sent to ford when my tbirds speedo was replaced if the odometer can be set to the old mileage it must be if it cant eg electricallydriven odometers then the mileage of the old odometer must be written on a permanent sticker which is affixed to the door frame of the vehicle either way if the change had been done legally then a records searchwhich the dealer almost certainly did should have turned it upcall your states department of transportationpublic safetymotorvehiclesor your tag agentto find out for certain what yourrights are your states attorney general will know for certain jamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom mcostelloasysdtnavymil malcolm g costellosubject re dumbest automotive concepts of all timexx fake convertible roofs and vinyl roofsx any gold trimx x these i will agree are abominations right along with the fakexcontinental sparetire kit its sad watching those little old ladiesxtry to load their groceries into the trunk with that huge tiremedallionxin the wayx most pitiful fake convertible top on a cadillac cimarron withxall the chrome door trim still visible not fooling anyonexof course there was that hyundai excel i once sawxleast you think bad taste is something newback in the early s i saw a couple of cars with flocked paint jobsthats not a typo i think they sprayed on some kind of glue then blewon tiny pieces of nylon it comes out looking like felt can you picturea huge plymouth fury iii in dark blue felt i think i can even rememberone guy who did it in red to a early s corvette that was after he hadturned it into a station wagonmack costello mcostelloasysdtnavymil code formerly david taylor model basin carderock division hq nswc bethesda md phone from aaspocwruedu andrew a spencersubject re mr noisy enginein a previous article aaspocwruedu andrew a spencer saysin a previous article eliotlanmolaengrwashingtonedu eliot saysin article rvofinnusenetpadeccom tomacjopcoenetdeccom thunderbirds are go writesnice theory too bad the mrs never came with a four cylinder over liters more like or did they were the nonturbo mriis orsome suchlet me clarify i think they both are litresi also understand that anyone using balancing shafts on four cylinders mustpay saab a royalty for using their patented designlike porsches ii was already corrected on this and believe i may have been in errror thatit is actually mistubishi apologies for butting into the threadc yadrewfrom lofasotsdarlututexasedu bernie lofasosubject re fast idle on ford rangerljbartelnaomibbingrcom les bartel writesit did it again this morning my ford ranger was idling at rpmok so i exaggerated a little but it was idling very fast it has a liter carburated engine in it and no blipping of the throttle wouldcause the idle to drop back to normal i dont think the linkage is stuckwhat can i do to fix this problem this has been a problem from time totime but has straightened itself out until now i dont have a tachbut by gauging by the sound of the engine it is idling about twice as fastas it should be this is down from what it was idling at when i pulled upat a stop lightsometimes a bad choke pulloff diaphram will cause a car to fast idle thepulloff which is vacuum actuated provides a necessary pull in noncoldweather conditions to get the idle off the the fast idle cam locate thefast idle cam on your vehicle and see if you can rotate it to produce anormal idle if so locate the diaphram and test it if you cant applysuction via a good piece of rubber vacuum hose with your mouth that willcause the diaphram to retract then its bad and should be replacedbernie lofasoapplied research labsfrom vmbkubvmsbccbuffaloedu neil b gandlersubject opinions on pontiac bonneville i am in the market to buy a used car i am particularlyinterested in the pontiac bonneville my budget is between thousand would i be able to afford an or whatengines were available at this time i know they didntredesign until the model year how is the reliability ofpast models i would appreciate any advice or information neil gandlerfrom staffordlobbyticom ron staffordsubject re changing oil by selfin article hnbakcmuvmcsvcmichedu john foster hnbakcmuvmcsvcmichedu writesdate wednesday apr edtfrom john foster hnbakcmuvmcsvcmichedusubject re changing oil by selffrom drewkinglearcscoloradoedu drew eckhardtin article podsourswozau podsourswozau paul odonnell wriin qgieinnhsskeenaucsubcca yiklamunixgubcca yik chong lam writeshelloi find this method much better myself too although i do reallyhate it when the bolt finally comes loose and the wrench and myhand both come crashing into my face after coming to which isabout minutes later i change my clothes because by this timeall the oil has drained on me and ice my entire face and suckdown about tylenol to ease the pain later in the day i thenproceed with refilling the engine oilits just crazy how i try and change the oil on my cars in oneweekendi go through about bottles of tylenol and bags of icejohnnot everyone should be trusted with tools ron stafford texas instruments incorporated pobox ms staffordlobbyticom dallas texas from natarajartsgmotcom kumaravel natarajansubject re water in trunk of probejlongemcnexttamuedu james long writesin article rcrngtransferstratuscom tszetosneezytsstratuscom tommy szeto writes water gradually builds up in the trunk of my friends ford probe every once in a while we would have to remove the spare and scoop out the water under the plywoodcarpet cover on the trunk i would guess this usually happens after a good thunder storm a few qs is this a common problem where are the drain holes located for the hatchi noticed this is my probe also when recently cleaning out the back i think the water is coming up through some rubber stoppered holes beneath the spare mine looked slightly worn and there was no water or water damage above the level of the spare area this has taken a low priority since i just found out while rotating my tires that i have a torn cv boot ughive got an gt it has the smoked taillight assembly i think this is wherethe water is getting in when i first got it had it for a month one of the reartaillights fogged up with moisture i took it in to the dealer and they replacedthe entire assembly it happened to the other one about months later this timei happened to look in the spare tire well and noticed water standing in there thedealer was more reluctant this time to replace it but i convinced them tofix it they must have had to deal with a number of other probes with the sameproblem i havent noticed water in the taillamps or the trunk for the last years but just last month the taillamp just fogged up again im going to tryto take it back to get them to fix it again im real tempted to drill some ventand drain holes in the tops and bottoms of the assembly and forget about it this isgetting very annoying almost every other gt ive seen has had this problemvel vel natarajan natarajartsgmotcom motorola cellular arlington hts il from akyfnysuedu albion h bowerssubject re is car saftey importantsin a previous article jimfcenterlinecom jim frost saysjnielsenmagnusacsohiostateedu john f nielsen writesin article rjrmvarmorycenterlinecom jimfcenterlinecom jim frost writestcorkumbnrca trevor corkum writesi figure that mph collisions into brick walls arent common enoughfor me to spend that much extra money for protection but there arelots of lowspeed collisions that do worry meget into an mph accident and you may reconsider ive been in oneand it is really scarey my life is something i value morethan a cars looks or handeling consider it insurance it may nothappen often but when it does youll sure be glad you got a safe cargranted the tests arent perfect but id much rather be in a car thatdid well in the test than a car that did horribly you raise a valid point but again its a tradeoff how much moneydo you want to spend for that kind of protection you could buy avolvo saab or benz and get really good crash protection and otherluxuries but youll pay significantly more for it in my case itsout of the question because all of those cars are beyond my budgetive been in two major auto accidents both were multiple car the worstwas a headon three car collision t intersection and one person ran a stopsign in both cases i was stopped and had no place to go and i saw itcoming both times even in highspeed headon collisions the most beneficial item you canhave is a good old point seatbelt nowadays at least in the usyou get an airbag if you get a point belt so presumably you get anadded safety benefit there as well thats something i certainly lookfor and which can be had in inexpensive carsif you really want to add safety to any car simply add a cage to thecar they are available and cheap about in the usa add to thatfour or five or six point belts and you will walk away from collisions thatwere otherwise not survivable but instead of people spending a littleextra money we get legislation that says the govt must mandate a minimallevel of protection for everyone one other significant factor in improving ones own safety is to get sometraining this will improve your safety more than any other singleinvestment will driveride defensively and that does not mean you haveto be a doddering old stick in the mud people here tend to enthuse aboutautos more than the average probably in the top th percentile in drivingability but still we sometimes overlook the obvious ive been to twodriving schools and three riding schools for my motorcycle a veryworthwhile investment and besides it was a lot of fun too safety is what you make of it just because a carmaker doesnt provide youwith an adequate level of protection doesnt mean you have to leave it go atthat al bowers dod alfa ducati hobie kottke blad iaido nasawell goodness sakesdont you know that girls cant play guitar mary chapincarpentersubject re dirty dieselsfrom stubbshawkcsukansedu jerry stubbsyeah but i hate to follow them with the exhaust at ground level not alldiesels are well maintained either it seems they run for so long thatpeople keep them going long after the top end is worn outfrom dchanciscocom derek chansubject service indicator of a bmwdoes anyone know how to reset the service indicator of a bmw after changingthe oil yourselfalso i have about miles on my i and so far only one of the fiveyellow service indicators went out that means i dont need oil service untilit reach approximatly miles which doesnt make sense to me any ideaps of cause i did my first oil change at miles derekfrom markmbigfootspsmotcom mark monningersubject re bimmer vs beamerin article andreinamao andreinamaouucp andrei chichak writes back when i was building round tail light s they were bimmers it was only when the red suspendered reganomics generated quiche eating yuppies got into the market that they became beamers and the hood ornaments started disappering yep thats when i noticed it too i stopped replacing the hood badge after the second or third one at each drivers used to flash their headlight at each other in greeting try flashing your headlights at a i driver and see what kind of look you get they usually check their radar detectorthey think youre alerting them to a copmarkfrom tom wetzel twetzelucsindianaedusubject re old corvettes low insurancein article rjncsxmgjqhnetcomcom richard newton ii rjnnetcomcom writeson a related note does this seem a sane price for a convertiblecorvette in good condition how does one determine these things my crused car magazine doesnt list corvettes any net wisdom on what to look forwhat to avoid thanks in advancerichfirst of all you might want to join the vettenet vetteschillercompaqcom during your searchacquisition of the k sounds about right for a wrong engine condition car this means that the car maynot have significant investment value but could be an excellent driverand or hobby car you will also want to get a copy of the corvetteblack book immediately dont leave home to look at vettes without itsince you are contemplating spending k you might want to invest afew hours in reading the corvette buyers guide and purchase nolandadams tape how to buy a corvette the tape shows you how to checkfor damage etc there are many many factors that will affect thevalue road worthiness and repair expense of your proposed thelist is much too long to go into here join the vettenet wherethere are over current corvette owners many with s vintagevettes that are available to help you the pubs i mentioned aboveare available from midamerica designs and severalother corvette parts sources good lucktom hp cruiserfrom dwjzbnrca doug zolmersubject re manual shift bigotsin article aprrtsgmotcom kissaneblackberkeleyedu john g kissane writes as a matter of interest does anyone know why autos are so popular in the us while here in europe they are rare just wonderingin many of our cities there are traffic signals every feet unsynchronisedof course well here in ottawa anyway and the roads are so congested that shifting manually is a real pain in the left foot also most canadians aretoo stupid to learn how to shift manually gee i gotta coordinate my twofeet on the clutch brake and accelerator and i gotta steer shift andoperate the signals optional and radio with my two hands duh it cant be done also most north american made cars come with the automatic as standard equipment so why bother with a manual when the car can shift for you for no addition money john kissane motorola ireland ltd oo uucp uunetmotcidglaskissanej mahon industrial estate internet kissanejglasrtsgmotcom blackrock cork ireland u doug zolmer internet dwjzbnrca disclaimer my opinions only bellnorthern research ltd ottawa ontario canada dept n service control point routing services design rfrom goughcbnewsccbattcom brianwgoughsubject x onoffroad rally joliet il attention all four wheel off road enthusiasts onoff road rally sunday april th joliet illinois the event the joliet mud turtles a chicago land four wheel drive club is sponsoring an onoff road rally sunday april th for those who ask what is an onoff road rally well an onoff road rally consists of the following an ontheroad rally where participants are given a set of directions and clues guiding participates around the jolietplainfield area the object is to navigate a course based on a set of directions and clues participants will be given a set of questions pertaining to the course which they must answer along the way points are awarded for the number of correct answers given directions will ultimately lead to an offroad area where a fourwheel drive course is setup at various locations in the onroad course checkpoints will be setup where participants will be asked other questions or requested to perform some activity eg tire roll truck tow basketball freethrow etc for additional points an optional offroad four wheel drive course where participants will navigate offroad trails mud bogs andor hill climbs points are awarded for successfully navigating offroad obstacles without getting stuck if you should get stuck which is half the fun anyway there will be assistance to get your vehicle unstuck so you can try it again the offroad course will divided up based on tire size so stock xs as well as modified xs can run the course at the end of the rally trophies will be awarded to top scoring participants door prizes and dash plaques will also be given out food and drinks also available at the conclusion this is an organized activity sponsored by the joliet mud turtles so safety and fun is our foremost concern all xs must be street legal and have solid tow points for the offroad section of the course we dont want to have to separate someones bumper from their vehicle the particulars rally begins at instant replay plainfield road joliet il see map below registration is between and am first truck out at am rally date is sunday april th rain or shine there is an entry fee of per truck you must have a codriver passengers allowed a valid drivers license is required suggested equipment cb radio compass tow strap and clevis clip board and pencil no alcohol during rally for more information contact gary tom norm jr brian instant replay mi mi north rt exit rt canton larkin farm ave rd mi rt v exit b from hackerccocaltechedu jonathan bruce hackersubject re auto air conditioning without freonmarkmbigfootspsmotcom mark monninger writesin article aprresearchnjneccom behannasylnjneccom chris behanna writes several chemists already have come up with several substitutes for r you dont hear about them because the mobile air conditioning society macs that is the people who stand to rake in that to per retrofit per automobile have mounted an organized campaign to squash those r substitutes out of existence if not ban them altogether on very shaky technical grounds at best on outright lies at worst now im not saying youre wrong because i know that the r substitutes exist but this sounds a lot like the mpg carbs that the oil companies keep us all from gettingthese substitutes exist and at this time are available its the futureavailability that is in doubt ghgget it from peoples welding supply butanepropane you can mix this yourself so no one can ever regulate it awayjust make sure you use good quality dry gasesi dont know of any mpg carb distributors jon hacker get the os march beta cdrom caltech pasadena ca for call ibmos hackertumblerridgecaltechedu read about it in compososbetafrom nuetkeptsmotcom keith nuetzman x psubject wife wants convertiblehelpmy wife has informed me that she wants a convertible for her next carwe live in south fla so we are definitely in the right are for onemy wife has mentioned the miata but i think it is too smalli would like to wait for the new mustangs dec i thinkanyone have any opinions on anyall convertibles in a reasonable price range thanxfrom vinlaicbnewsbcbattcom vincentlaisubject third party car antennas since this posting ive received no replies or followups so im postinghere hoping for the feedback i didnt get in recaudiocararticle number newsgroups recaudiocarpath cbfsbcbnewsbcbattcomvinlaifrom vinlaicbnewsbcbattcom vincentlaisubject third party car antennas messageid aprcbfsbcbattcomsender newscbfsbcbattcomorganization attdistribution nadate tue apr gmti recently saw a particular third party antenna on a new camry not minebut it caught my interest and a new it seems to replace thefactory power antenna and is about a foot long made of plastic tubing ihave seen them on quite a few cars but i cant find anything more aboutthem in previous rac articles nor in ra articlesid like to know all i can so any feedback is greatly appreciatedmom were hungry bud bundy why tell me peg bundyvincent laivinlaicbnewsbattcom forwards mail tovlaiattmailcom which eventually winds up inwcmnjalaisomersetattcomfrom akyfnysuedu albion h bowerssubject re too fastin a previous article tedebearlelandstanfordedu theodore chen saysin article qhmblarmorycenterlinecom jimfcenterlinecom jim frost writescompare either to the porsche and you tell me which was designedto go fastyou have a point about the brakes especially seeing as how themustang doesnt even have disc brakes in the back but there are significant differences between the latest s andthe late s s not the least of which is handling im not i think you mean late s the biggest change that porsche undertook toalter the tailhappieness of their baby was way back in august for the model year when they stretched the wheelbase besides some peopleactually know how to take advantage of oversteer and enjoy itin europe the got low marks for high speed handling though tobe fair they might have been comparing it to the vettes handling what was that phil hill famous race car driver said about the you should have seen what phil hill world champion had to say aboutthe vettes hes driven turbo you cant make a thoroughbred out of a pig but you canhave an awful fast pig yeah that was what he said paul frere agreed they both prefered the porsche modified by ruf toeither of the vettes at that test al bowers dod alfa ducati hobie kottke blad iaido nasawell goodness sakesdont you know that girls cant play guitar mary chapincarpenterfrom chrissnetcomcom chris silvestersubject re sho and scin article aprmksoldsegticom amoedsegticom robert loper writesin article clreconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writesin article aprganglionannarbormius davidganglionannarbormius david hwang writesi would be willing to bet that if we removed the automatictransmissions from all performancetype cars like the lmustangs camaros and the like wed cut down on the number ofaccidents each year autos are fine for sedate little sedansbut they have no business in performance cars imhojamesi have to disagree with this i have a z with a and a speed autow overdrive and it is really better that way chevy autos are reknownedfor their long life and ability to handle copious amount of power i live in the dallas area and a manual would be much harder to drive in the traffic here now if i still lived out in the sticks like i used to a manual would bemore fun i dont know if its as much an issue of their ablility to handle thepower as it is the power they lose in the torque converter etcsafetywise an auto is less distractingi would hate to have to be shifting gears while i was trying to ease into traffic in the freeways hereperformancewise i can hold my own against any stock mustang or camaro w a five speed however if you encounter a formula with l speed manualyoull be sol im afraid btw i know of what i speak as a formerowner of a l auto iroc and current owner of theaforementioned car chris s chris silvester any man capable of getting himself elected presidentchrisssamamgencom should by no means be allowed to do the jobchrissnetcomcom douglas adams the hitchhikers guide to the galaxyfrom sorlinmagnusacsohiostateedu steven j orlinsubject re changing oil by selfin article clmtrmomentorccpurdueedu marshattfeserveccpurdueedu zauberer writesin article qgieinnhsskeenaucsubcca yiklamunixgubcca yik chonglam writes hello does anyone know how to take out the bolt under the engine compartment should i turn clockwise or counter i tried any kind of lubricants wdetc but i still failed do you think i can use a electric drill change to a suitable bit to turn it out if i can succeed can i retighten it not too tight is it safe without oil leak thank you very much in advance winsondont worry about leaks dont worry about which way to turn the damn thingtake a good claw hammer and pry it straight out now youll notice afterall the oil pours out that there are no theads where there used to bethats why heli coils were invented yes buy a few of these gems andrethread the hole a little larger each time you change the oilwhen the hole gets too big for any heli coil you can buy its time to trade inthe carfrom wratunisqluucp wharfiesubject re too fastin article qmcihdhsarmorycenterlinecom jimfcenterlinecom jim frost writesthey light the highways in texas funny everywhere else ive beenthey only light em at junctionsand armadillo crossingstexas is pretty much an edgecase you cant assume that everywherehas roads in such good condition such flat terrain and suchwideopen spaces it just aint sowell lets see in just my own personal experience theresnevada new mexico texas wyoming utah south dakota nebraska minnesota montana florida and parts of louisiannanobody said lets go into town and drive on main stand you couldnt go that fast on the graveled washboard that passesfor highway in some parts but that only really expensive cars shouldbe driven fast crap is well crapwrfrom marshattfeserveccpurdueedu zauberersubject re its a rush was re too fast remember roads in america are not designed for speeds above meaning theywould be safe at roads like the autobahn are smoother straiterwider and slightly banked example a few months back i was traveling late at night am or soand i was changing highways at a bent crosssing it curved off to the southeast becoming hidden by trees after about ft and continued to theleft strait north i wanted to turn north checked the south lane rolledinto the crossing and checked the north lane nevertheless there wasnt a car in sight so i took one last look and pulled into the left hand lanenow my car isnt a sec performer but i was in the corect lane and over in decent time even at i wasnt wasting time it was thenthat i checked my mirror and saw a mustang closing in my lane fast he had just turned the corner and was just noticing me luckly he saw me and changed lanes in time i estamate he was moving in excess of or soi was just a by stander i had no chance of runing from him or moving out of his way im glad he saw my brake lights in time i shudder to think of what would have happened had i wainted to pull out and not left the time he needed to dodge merule just because your car can do and your way is cleardont assume it will stay that way travis disclamer the ideas expressed above are in fact the same as my employer since i have none email flame at marshattfeserveccpurdueedu from thornwamumdedu thornwallsubject q dings in the paint on my hood hello i have a toyota x and in the last few weeks i have been getting quitea few dings in the paint on the hood from rocks and debris off of theroad i have never had any major problems with other cartrucks in the pastmaybe a ding once in a while i went to the dealer and he said that ithappens all of the time and he recomended putting a bug deflector on thehood he said that the trucks for some unknown reason seem to have thisproblem more than some cars it seems to me that either my luck is really bad or there might be a problemwith the paint painted on a monday morning perhaps how well do these bug deflectors work for small road debris on trucks if anyone has any experiencessuggestions please let me know thanks greg thornwamumdedufrom schludermannsscvxsscgovsubject rfiart of clutchless shiftingim wondering if anybody else out there is a clutchless shifter ive beendoing it my self over miles on my current toyota truck ive gotover k ive heard people talk about how doing this can damage atransmission my experiences suggest otherwise what techniques do you useon some old pieces of junk i drove the transmission was soworn that pumping the clutch was the only way to shift except clutchlessto date ive driven rabbits datsuns comets fords a chevy some whereharder than others to shift but generally the higher the milage the smootherquicker easier they where to shiftmy technique is to ease back off the throttle and at the same time gentlywrist back on the shift lever if for some reason i miss the shift windowi lightly press the accelerator try agian ive found that clutchlessshifting is eaiserquicker at high rpms i also skip gears sometimes using krispyfrom jitloketekigpentekcom jitloke limsubject re braindead drivers who dont look aheadin article aprcbnewsdcbattcom hhmcbnewsdcbattcom herschelhmayo writesanybody is going anywhere so i block the wouldbe passers not only for my owngood but theirs as well even though they are often too stupid to realize itah we are looking for good people just like you we are a very concernedgroup of citizens who are absolutely disgusted at the way that the majorityof drivers simply disobey traffic rules like going above the speed limitpassing on our right and riding our tails while all the while we respectfullyabide by the rules of this great country and maintain the mandated speedlimits with our calibrated certified cruise controls while keeping therespectful car length distance mph speed how many times have you beenticked off by some moron who jumps ahead in the car lengths that you have left between you and the vehicle ahead of you while driving mph finally you have an option we are a totally member supported groupthat perform functions for our own good for the good of this great country but most of all for those unfortunate ones that are too stupid to realize itbless their souls for a paltry you can join citizens for rationally advanced pilotingcrap a nonprofit members only society but butbutthere is a slight hitch the initiation rite to be a full fledged member ofthis exclusive club you must proof that you are able to be in the fast lane ofthe busiest interstate in your area keep the correct car lenth mph speedand i know this can be difficult with those morons around not let anybody passyou not in the next lane not in the slow lane not in the breakdown lanenot nowhere for a complete list of acceptable interstates and times send and by the way over of our members are highly regarded attorneys in theauto field and they are completely absolutely positively in the business onlyto serve your best interests as a testament to their virtues they will givemembers off the initial consultation fee feel free to drop me a line atyour earliest convenience and remember only speed killsjitfrom cheekeentartarusuwaeduau desmond chansubject any info on merc e cheekfrom bqueisermagnusacsohiostateedu brian j queisersubject re the mustangpetebreelofiitedu brenta peterson writesjmhhoppervirginiaedu jeffrey hoffmeister writesjmmhvirginiaedu the bald runner writesi just have got to remind all of you that this is it yesthats right somtime this fall ford the granddaddy of carswill be introducing an allnew megacoolwaytoofastforaccorddrivers mustang its supposed to be streamlined looking similar to the mach iii concept carford came out with around january i cant wait anyone outthere hear anything about it recentlyif everything ive read is correct ford is doing nothing but reskinning the existing mustang with minor suspension modificationsand the pictures ive seen indicate they didnt do a very good jobof itthe new mustang is nothing but a recycle of a year old cargee is it alreadyyes it will still be on the fox program chasis anything that will be different on the new car as far as mechanicals is unknown the suspension will mostlikely be changed as well as the drive drain from what has been printed onit there is no clear idea of what will be done as some say it will havethe modular v and others the current small block just have to wait and seealso is far as styling goes from what i seen is good a return to traditionc scoop on the sides and roof line much like a or fastbackyou know im a ford fan i must say so im looking forward to the nextmustang i have faith that it will be a fine product more desireablethan the camaro is now you know thats mho the differences these days between ford and gm are not so much the qualityjust the philosophy it used to be quality and philosophy gm isbarely catching up but they have more room for improvement thatcan only be made up in time stss still come off the assembly linewith screwed up paint stripes and poor trunkdoorhoodpanel alignmentsits those year old plants and the latest gm products still comewith the standard equipment rattledash tm but like i said theyregetting better and making the move in the right directionthey beat ford to the market with the camarofirebird but really onlyin words production of these vehicles will be limited until theend of the year keeping selling prices above msrp for the most partsince there are so many twitching camaro fans out there i wouldntpress ford to hurry the mustang since the final wait could be worth itbesides no bowtie fanatic is gonna buy the mustang anywayi do not put much stock in the mag rags inside information or evenford rep quotes the taurus was pretty much a surprise when it wasfinally disclosed in its entirety inside information had thetaurus with a v and rearwheel drive at one point i wouldnt lookfor a simple repaneled mustang folks you may be cheating yourselfif you do theres a lot of potential ford hasnt released a newcar without a wheel is in years the mustang project has beenbrewing for at least right a wheel is could happen thosemodular vs are out there too in the interest of cafe andcompetition dont rule those out either your ignorant if you doand there are so many spy shots and artist renderings out therewho really knows what itll look like the mach iii doubt ithighlythe next mustang will be fords highest profile car it attractsway more attention than the camarofirebird because its heritageis more embedded in the general public dont lie to yourself andbelieve ford will forfeit thati submit that the mustang will be a success enough to elicitdefensive remarks from some heavy camaro fans here you knowintelligent critical spews like the mustang bites man some ofyou are already beginning i predict that the mustang and camarowill be comparable performers as usual i predict that thedifferences will be in subjective areas like looks and feel as usualthe camaro is still a huge automobile the mustang will retain itscabrearward styling and short ponycar wheelbase the camaro stillreaches out to the fighter pilot while the mustang will appeal tothe driver the camaro will still sell to the muscle car set whilethe mustang will continue to sell to the collegedegreed muscle car setboth will be more refined i do think the camaro is there will beno clear winnerunless the ford gets the v hp romeo you dont seriously believethat it was designed for the mark viii only do youregardsbrianbqueisermagnusacsohiostateedui am the engineer i can choose kdepartment of engineering mechanicsohio state universitycolumbus ohfrom bqueisermagnusacsohiostateedu brian j queisersubject re v v v v vxckauxacsouiucedu oriolefanuiuc writesaaspocwruedu andrew a spencer writesi think that it is technicaly known as a degree vee configurationcould be wrongthis is how ive seen them referred to then what is a flat engineflat deg v horizonatlly opposedusually it also equals boxer however i think the term istraditionally reserved for s and s and firing order mattersthis was talked about here in ra many months back i cant rememberthe consensusexamplesferraris tr is a flat boxerporsches is a flat subarus impreza is a flat regardsbrianbqueisermagnusacsohiostateedui am the engineer i can choose kdepartment of engineering mechanicsohio state universitycolumbus ohfrom bqueisermagnusacsohiostateedu brian j queisersubject re changing oil by selfsorlinmagnusacsohiostateedu steven j orlin writesinfanteacpubdukeedu andrew infante writesyoure actually worried about somebody stealingyour oilahhh yes andrew we meet againno not stealing the oil just draining it as to leave me strandedcmon you think a vandalll do thatlet me guess youre from hudson ohiohey whats this hudson crapactually the only place my car has ever been broken into was in hudsonat my inlaws in their driveway took my vuarnets and some changedamn kidsregardsbrianbqueisermagnusacsohiostateedui am the engineer i can choose kdepartment of engineering mechanicsohio state universitycolumbus ohfrom arun g jayakumar ajandrewcmuedusubject re honda mailing listexcerpts from netnewsrecautos apr honda mailing list by jamesb atkinsprismga is there a honda mailing list and if so how do i subscribe to itif you look at their magazine ads they may have a phone number to calland you can ask for a catalog or to be on the list etcfrom dtoroknynexstcom davetoroksubject re looking for tips for driving cross countryr goldstein rdgworldstdcom sez as the subject says i am moving from mass to calif and will be driving mostly on interstate any advice from folks who have done it before plan your gas stops in majorcity areas to avoid the centpergallononly gas station for miles and youre an outoftowner surcharge prepare your car dont forget things like your fuel air filters ifyoure loading your car up consider putting your spare on top of your stuffjust in case of a flat in my xcountry trip a tire disintegrated in thecalifornia desert it took me minutes to unload all my stuff to get tothe tire if you have a hatchback cover all your stuff with a white bedsheet to helpkeep the stuff and your car cool as well as possibly avoiding theft mcdonalds have good clean bathrooms invest in a cb magnetic roof antenna it may help if youre strandedand you can always ask people for places to stop for food etc many times police like to hang out in the st miles after you enter anew state to catch all the speeders who have escaped the previous state same as above when you enter a mph city zone after hours and hours ofmph rural interstatedave davetorok toroknynexstcomfax jugglenynex science technology westchester ave white plains ny from mauritzcspcvxbspcedusubject weird problem with gm banger transmissionim having an interesting problem with my girlfriends car beforei delve into its innards i thought id check netwisdom on thesubject its a buick skyhawk i knowi knowl efi bangerautok mileswhen i drive tha car long enough to get it hot especially athighways speeds the transmission has this nasty habit ofgetting stuck in rd gear as a result when you stop fora light the motor stalls putting the car in park and waitingfor seconds before restarting sometimes allows the transmissionto reset and go back into st otherwise it just stalls whenput in drive my thoughts either it the rd gear band is binding and gettingstuck when it gets hot not so likely or perhaps the lockupconverter is not disengaging properly seems likely the leastlikely keeping fingers crossed is that some critical vacuumhose has brokencracked and this behaviour is due to lack ofvaccuum somewhere as used to happen with old modulator valvesmy background is that my father owns a service station andi worked there on and off from years of age pleasefeel free to be as technical as you want id appreciate hearing any tipssuggestionsoffers of freebeer grinskoalchrisfrom maniraunvishiis mani thorsteinssonsubject lois chevrolet i was whatching the history of the indy the other dayand early in the film around the s a name lois chevroletcame out of the blue i wanted to know if he is the chevrolet founderor mearly a driver whos name was called the same as the other guys konifrom sgsucsusledu sudhindranath sira gsubject help mercury capri queryhi folksi recently bought a mercury capri my first car everi have noticed a few problems with the car it gives very low gas mileage something like miles gallon i hear other car owners speak of gasmileage figures like milesgallon wow etc when i start the car it goes into high idling something like or is it rpm after driving or miles it comes down to or rpm i would like to know if there is any way by which i can fix theseproblems or is it natural for an old car like this it hasdone about miles someone suggested that i changerebuildrecondition the carburettor i am not prepared to do itunless i am sure it will fix the problem and yes i got thecar tunedup recently within the last miles or soplease let me know if you have any suggestions please respondby email since i dont scan this newsgroup regularlythanksregardssudhi sira gopinath sudhindranath email sudhiucsusleduis he one of us or is he one of them so ask smallminded menthose of noble mind think the entire world as their family hitopadeshafrom sehrlichlynxdacnortheasternedu scott r ehrlichsubject help find stolen cari offered to relay this information for a ham friend of mine withoutinternet accesshis name is robert bob wondolowski nkda and his car was a brown cutlas sierra sedan massachusetts plate adlhis ht yaesu ft and mobile antenna were also included in the carit was stolen from lynn mass about days ago being on april if anyone has any information about the cars whereabouts please emailmethank you for taking the time to read this message scott ehrlich internet wyzworldstdcom amateur radio wyz packet radio wyzkugmmausana scott ehrlich internet wyzworldstdcom amateur radio wyz packet radio wyzkugmmausana from plkgltduhuraccrochesteredu paul k glogersubject subaru shop manuals for saleo subaru service manuals this is not a complete set but includes sections which cover mechanical components suspension wheels axles steering brakes pedals control cables heater ventilator air conditioning body body exterior doors windows seats seat belts interior instrument panel and electrical engine electrical system body electrical system wiring diagram and troubleshooting these are the genuine subaru issue manuals they are for model year but have plenty of good information that applies to other years as welland as long as im posting end of car stuffo miscellaneous darkroom equipment solar enlarger several objective lenses with easel and timer negative carriers for mm and x misc printing masks developing tanks thermometer trays constanttemperature bath ground glass mirrors darkroom lamps glassware elcheapo tripods and as they say much moreo beautiful antique buffet solid cherry no veneer handmade with very interesting dovetail corners in the drawers built we think around not gaudy or covered with gewgaws a simple elegant piece of furniture but too big long tall deep for our little cape cod housewill deliver pricier items ie over anywhere in the rochester area and will consider delivering the others will deliver any of it on uofr campus between now and graduationcall or email paul or mary just south of rochester ny plkgltduhuraccrochesteredufrom alqiclabscnraincom alan petermansubject re auto air conditioning without freonin article aprconvexcom tobiasconvexcom allen tobias writesbetter still years ago they demonstrated a cold air system which only usedair it was called a rovax the unit worked very well the short comingwas the seal technology where is it todayactually the company and the product was rovac which stood forrotary air conditioningit used a rotary compressor with whatwas effectively an airair heat exchanger and worked pretty wellthe negatives were mostly that it was about less efficient thanusing freon and noise problems from the high velocitypressure airall of which were solved by the time the company went bankrupt itis still a legal entity in florida but i believe completely deadand theres a heck of an opurtunity to buy up its patents and restartthe operation alan l peterman hm work alqiclabscnraincomits odd how as i get older the days are longer but the years are shorterfrom sdextershlcom scott dextersubject isuzu amigo opinions wantedis there anyone out there in netland that hashas had one of thesecan someone give me a nonconsumer reports review or point me to a source thanksscottsdexterucrengrucreducomputer science undergraduateuniversity of california riversideinternet sdextertechnetshlcom facilities engineer shl systemhouse inc technology network internet you say its gonna happen now what exactly do you mean you see ive already waited too long and all my hope is gone the smithsfrom khalsaspartansandiegoncrcom gk khalsasubject re options that would be great to havein article apracsucalgaryca parracsucalgarycacharles parr writes a list of options that would be useful they can be existing options on a car or things youd like to have tripmeter great little gadget lets you keep rough track of mileage makes a good second guesser for your gas gauge full size spare built in mountings and power systems for radar detectors a fitting that allows you to generate household current with the engine running and plug ins in the trunk engine compartment and cabin feel free to add onok how about a fuel gauge that really told you how much fuel was left like can i make it to where the gas is or should i get gouged right here at accurate to the tenth of a gallon would be great on contract to gk khalsa ncr engineering and manufacturing w bernardo dr san diego ca gkkhalsasandiegoncrcomfrom dhepnercuphpcom dan hepnersubject re dirty dieselsfrom natarajartsgmotcom kumaravel natarajanbut they can put out a lot of particulate matter i heardsomething about legislation being discussed to clean updiesel emissions is there anything in the works toinstall scrubbers for diesels how about the feasibilityof installing them on trucks and cars would it be anydifferent than a catylitic converter id assume easiersince were removing particulate matter instead of convertinggasses lets hear peoples opinionsthe technology cummins is applying to diesels to comply withthe newer ca emissions laws involves three things i know of all compliant diesels are turbocharged all use an aftercooler which cools the air which was heated by compression by the turbocharger up to about psi a gismo on the injector pump which senses the pressurized air intake and limits full delivery of fuel while the pressure is lowno scrubbers catalytic converters etc are used the path fromthe turbocharger to the exhaust outlet is kept very freeinterestingly except for the lowpressure fuel limitation power output and mileage are enhanced by these measures one can buy aftermarketturbos and aftercoolers which generate more power lots more powerand these are approved by the carbdan hepnerfrom jgossgaiatorolabibmcom jeff gosssubject re honda clutch chatterin article hpinddacuphpcom jimbhpinddacuphpcom james bruder writes from jimbhpinddacuphpcom james bruder date fri apr gmt organization hp information networks cupertino ca path eclipseyktnewswatsonibmcomnewsgatewatsonibmcomnewsansnethowlandrestonansnetuscsddhpcomhpscitschpcomhplextrahpcsshpinddajimb newsgroups recautos references hpinddacuphpcom lines its nice to know that im not alone out there when it comes to clutch etc problems on late model hondas if i get a few more supportive responses i will take them to my local honda dealer or maybe send them to the regional rep in southern calif for their input on the problem maybe some group pressure from honda owners can be placed on honda to find a solution such as a retrofit of the clutch or maybe ill just sell the blasted vehicle and go back to driving my year old pickup which was now fixed having clutch problems and caused me to look for what i thought would be a troublefree solution ya sure not to put down honda or anything the accord has performed flawlessly in all other areas for its miles as it is said out of all this something will develop later folksnot alone at all my old accord now in the hands of a sibling has a muchbetter engagement of the clutch even the old civic we keep as a beater feels better in this aspect note that these are cars with kms and kms respectively my prelude blows both of them away in every respect except smooth clutch engagement of course the kawasaki is the bestof the bunch but i need more than wheels most of the timethe prelude has had a dud clutch from day and after three years and kms is no better best of luck and feel free to add this to your collectionjeff gossfrom jgossgaiatorolabibmcom jeff gosssubject re changing brake fluidis it necessaryin article aprgmuvaxgmuedu lcarrgmuvaxgmuedu writes hi ive been seeing all these articles about changing brake fluid and i am wondering if this is really necessary i have an toyota corolla sr with and i am in theonly if you want to stop seriously though every years you shouldhave this done brake fluid absorbs water over time the water becomessteam when the fluid gets hot and steam compresses youll also havebetter luck with the longevity of master cylinder calipers and brakelinesjeff gossfrom rajeev t chellapilla rcuandrewcmuedusubject mbenzbmw questionwhen do the new mbenz c class cars come outthe new nomenclature that mb has adopted will it only apply to the cclass cars or will it also apply to the current s class carsdoes any one know what will replace the current class since the cclass will be smaller and more in line with the current another question is bmw realising a new body style on the current series and series they seem to be a bit dated to mefrom eliotlanmolaengrwashingtonedu eliotsubject horizontally opposedboxer engines was v v v v vxin article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writesthere are two crank configurations forthe flat the most common one is probably the crank that is verysimilar to the i crankwhich flat engines have i style cranks comparing those two engines the i and theflat have no first order shaking forces or rocking moments thei has a second order shaking force while the flat has a secondorder rocking moment the significant thing about the flat ssecond order moment is that it can be easily balanced out by addingmass at the ends of the crank the i however requires a counterrotating shaft with mass to balance out the second order forcesi am sure that subaru and porsche use the boxer configurationand not the inline crank that you analyzed and compared would youcare to reevaluate the other case of a flat four i think that thisconfiguration is perfectly balanced as far as primary secondaryforces and couples are concerned i have an article in front of methat says sobottom line the biggest difference between the engines would probablybe their intended use the flat is easier to fit under low hoodsand in rear compartments for mid or rear mounting the i can bemounted transversely to reduce hood length read cab forwardother than that there isnt much fanfare to the differences betweenthem no matter what subaru ads say technology shared withporsche indeedthe flat four is also shorter than an inline so even if it is mountedlongitudinally it will not take up lots of length and a longitudinalplacement is easier for a wheel drive drivetraini think that subarus ads hold water in practice their flat foursare noticeably smoother than inline s and completely buzz freethough some may not like its peculiar note but as alfa has shown aboxer four can produce a spine tingling scream that only the likes ofrecent hondas can approacheliotfrom jgossgaiatorolabibmcom jeff gosssubject re manual shift bigotsin article pebizephyraemumnedu pebiaemumnedu peter a bidian writes there is another advantage with manuals you can start the car by pushing it and shifting into second gear this doesnt work with an automatic peter just for the record read your owners manual before attempting a push startmost manufacturers today do not recommend this i think the catalytic converteris the primary reason unburned gas goes down to it and may ignite whenthe converter gets into its operating rangethe best reason for a manual because you like to drive one i find that itsmuch easier to develop lazy habits in an auto trans car remember pay attention out there stupidity behind the wheel has still taken more peopleto the morgue than drunk driving the problem is that we dont revoke peopleslicense for stupidityjeff gossfrom jgossgaiatorolabibmcom jeff gosssubject re v v v v vxin article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writes flat deg v horizonatlly opposed usually it also equals boxer however i think the term is traditionally reserved for s and s and firing order matters this was talked about here in ra many months back i cant remember the consensus examples ferraris tr is a flat boxer porsches is a flat subarus impreza is a flat regards brian bmws boxer twin no two wheelers here been around since i think theother examples are johnny come latelies i may be wrong so no flames pleasejeff gossfrom eliotlanmolaengrwashingtonedu eliotsubject re v v v v vxin article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writesexamplesferraris tr is a flat boxerporsches is a flat subarus impreza is a flat i think you got it the other way round the ferrari flat is a degree v and not a true boxer while the subaru and porsche aretrue boxers dont know about the vw bug though but i suspect thatit is also a true boxereliotfrom glouieoasysdtnavymil george louiesubject pennsylvania insurance limited tort optionhey allim looking at buying a new car but im confused about the insurancecoverage this also applies to my existing car insurance policy doesanyone understand what the limited tort option means will it lowermy rates if i opt to have it or will it be more expensive if i optto have it what does it do for me in laymans terms please isit a good deal or should i ignore it im not the type to sue anyoneat a drop of the hat nor am i the type to report every little ding tothe insurance company as a vandalism claim please helpthanks in advancegeorgefrom newtonconvexcom vicki newtonsubject seeking recommendations for new car purchasefolksi am going to be purchasing a new vehicle in the next few months iam trying to hold out until the fall since i have heard that i canbe in a better negotiating position to purchase a right when thes are coming out i need something that can comfortably carry adults kids in car seats and pound dogs i can probablyafford something in the kk range i am interested in the suvsbut am not sure there are any that are decent which i can affordi think the ford explorer got good reviews from consumer reports butis above my range the isuzu rodeo is probably in my price rangebut i think consumer reports gave it a big thumbs down can anyoneoffer any suggestions i am hoping for something a little more hipthan the traditional wagon and the suvs look like fun we do a lot ofcamping tooveekfrom brandtcsuncedu andrew brandtsubject runner and pathfinder recent changesi am interested in finding out how the runner and pathfinder havebeen updated in the past few years like new engine suspension andthe like i noticed that the and runners are identicalfor example and was looking into buying a used oneany info would be appreciated esp modelsyears to check out oravoidthx andy brandtcsuncedufrom oprsfnxgsusgigsuedu stephen f nicholassubject re plymouth sundancedodge shadow experiencesdaubendrnextworkrosehulmanedu darren r daubenspeck writes they are pretty much junk stay away from them they will be replaced next year with all new models junk theyve made the cd lists for years due to their excellent handling and acceleration they have been around since about oh or so theyre not the newest on the lot and mileage is about five to eight mpg under the class leader you can get into a l v hp shadow for k the i turbo a bit more and a droptop for k as an exfleet mgr of cars they were amoung the most trouble free ofall models i bought one for my wifefrom rwfnscclehighedu robert william fusisubject re best radar detector in article aprlrcedu burnsidebrlrcedu writesin article apropenconcom giandopenconcom deepak s gianchandani writes mubashir cheema dont buy one that is the best way to avoid tickets i used to have one and whenever a cop would pull me over see the thing give me a ticket one time my sister was driving and had it in the glove compartment it was broken and she got a ticket in i had received tickets because of it one for my sister so a total of five that was five years ago now i dont have one and have not gotten a ticket my driving habits have not changed drastically only two days ago i was going mph on highway with mph limit cop saw me i break a little nothing happened i was driving a minivan with my family in it otherwise i have cutlass supreme which i do most of the times on the highway so basically my opnion is not to get one if you do get pulled over the cop will hear your excuse but if you have a radar detecter he will not again this has been my experiencjust get a remote model that is not visible to the cop but be sure to getfront and rear sensorsyou can also just put the detector off to the side on the dash so the copdoesnt see it right awayvalentine is the best detector by far as statedby car and driver and even tells you what direction the radar is coming from it also gives the amount of threats it is picking up so if you go through the same place everyday and it always goes off there you can glance at the number of threats the valentine is detecting to see if it is a genuine cop its about and you can only get it factory directone problem rob fusi rwflehighedu from asbestosnwuedu michael a atkinsonsubject for sale in evanston il one carfor sale oldsmobile omega four door gray power windows power steeringpower brakes remote trunk release starts reliably and runs wellbut needs some work obofor details email or michael a atkinson there is no try there is only dewasbestosnwuedu a libertarian and an nra memberfrom smithctroncom lawrence c smithsubject re mr noisy enginein article aprengrwashingtonedu eliotlanmolaengrwashingtonedu eliot writesif the noise really bugs you there is nothing else that you can doexcept to sell it and get a vperhaps a nice used pontiac fiero gt litersdoes anyone know if the motor mounts for the and the twindualcam liter match the is supposedly derived from the pushrod which wasa punched out liter should be a dropin replacement eh horses ina midengine the size of a fierolarry smith smithctroncom no i dont speak for cabletron need you askliberty is not the freedom to do whatever we wantit is the freedom to do whatever we are ablefrom troysequentcom troy weckersubject re questions about insurance companies esp geicoradar radio association defending airwave rights says that geicoinsurance not only buys radar for police but also actively lobbiesstates to promote making radar detectors illegal i think thebuying part is a misuse of money but the radar detector part showshow little they know about the issue no study i am aware of has everconcluded that detectors have a negative impact on safety or thatusers have a higher average speed incompetence by geico i thinksotroy weckertroysequentcomsequent computer systemsbeaverton orin article aprjulianuwoca wlsmithvalveheartrriuwoca wayne smith writesin article mimsyumdedu davewcsumdedu david g wonnacott writesim considering switching to geico insurance but have heard thatthey do not assign a specific agent for each policy or claim i wasworried that this might be a real pain when you make a claim i havealso heard that they try to get rid of you if you have an accidentive read in this group that geico has funded the purchasing of radarguns by police depts im not sure wherefrom rwfnscclehighedu robert william fusisubject re most bang for kin article uupcbcuttinghoutxus davidbondscuttinghoutxus david bonds writesin recautos cpkjpvmcclatechedu kevin parker writes id like to get some feedback on a car with most bang for the buck in the to price range im looking for a car with enough civility to be driven every day or even on long trips but when i hit the gas i want to feeltake a look at a taurus sho they can be found for k and are theultimate in door sports cars performance similar to a mustang butquite civil and comfortable try to get a late model for the bettershifterthe cutting edge bbs cuttinghoutxus a pcboard a systemhouston texas usa running uupcbwell you could always go with a mustang lx with a pleasant v but thediamond star cars taloneclipselaser put out hp in the turbo modelsand hp in the awd turbo models these cars also have handling to matchthe muscle and are civil in regular driving conditions rather than having aharsh stiff ridethe awd turbo is clearly the better choice of the twobecause of all that torque steer on the front drive model but you may haveto go with a leftover or slightly used model for that price rangetoughdecision rob fusi rwflehighedu from adnritvaxiscritedusubject re mr noisy enginein article aprengrwashingtonedu eliotlanmolaengrwashingtonedu eliot writesin article rvofinnusenetpadeccom tomacjopcoenetdeccom thunderbirds are go writesare there any mr owners or motorhead gurus out there that know whymy mrs engine sounds noisy the mrs engine is noisy at the best of times but not even a nice nose its one of those very ugly noises assuming yours is a non turbo mr the gruffness is characteristic ofa large inline that doesnt have balance shafts i guess toyotadidnt care about little details like that when they can brag aboutthe mid engine configuration and the flashy stylingmyself i automatically cross out any car from consideration orrecommendation which has an inline larger than liters and nobalance shafts it is a good rule of thumb to keep in mind if youever want a halfway decent engine if the noise really bugs you there is nothing else that you can doexcept to sell it and get a velioteliot is right about liter engine in the second and last generationmrs but the original guy did not indicate the year of his mr if its afirst generation car like my it has liter engine or perhapssame engine with a supercharger if its the sound he describes is common to any older toyota engine i ever heardi dont know the relevance of his observations about oil changes my simplymakes noise not all that annoying mind you but you hear it well when theengine is right behind your left ear mikesfrom jessehoustongeoquestslbcom john schultzsubject re opinions on pontiac bonnevillein article cullqdsacsubuffaloedu vmbkubvmsbccbuffaloedu neil b gandler writes i am in the market to buy a used car i am particularlyinterested in the pontiac bonneville my budget is between thousand would i be able to afford an or whatengines were available at this time i know they didntredesign until the model year how is the reliability ofpast models i would appreciate any advice or information neil gandlerin a word yes bonnevilles prices avg retailsedan d le sedan d se sedan d sse from tgardnerathenamitedu timothy j gardnersubject re the mustangin article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writeson the subject of the upcoming new mustangi do not put much stock in the mag rags inside information or evenford rep quotes the taurus was pretty much a surprise when it wasfinally disclosed in its entirety inside information had thetaurus with a v and rearwheel drive at one point i wouldnt lookfor a simple repaneled mustang folks you may be cheating yourselfif you do theres a lot of potential ford hasnt released a newcar without a wheel is in years the mustang project has beenbrewing for at least right a wheel is could happen thosemodular vs are out there too in the interest of cafe andcompetition dont rule those out either your ignorant if you doand there are so many spy shots and artist renderings out therewho really knows what itll look like the mach iii doubt ithighlythe next mustang will be fords highest profile car it attractsway more attention than the camarofirebird because its heritageis more embedded in the general public dont lie to yourself andbelieve ford will forfeit thatthe car magazines have printed a lot of information about the new mustangand the consensus about what to believe in my car circle is that the suspension pieces and tuning will be almost identical to the currentcobra but on a stiffer body structure which will improve its behaviorafter the mn thunderbird cost and weight debacle ford decided independent rear suspension with rear wheel drive wont be tried again in a volume car the current l v will soldier on for about two years a version ofthe valve modular v in the mark viii could be offered then fordis spending big money tooling up for l and l v engines which willpower most of their cars in the immediate future and therefore probablydo not consider volume production of hp v engines a priority undisguised the car looks ok but not nearly as exciting as the newcamarofirebird imo i suspect ford will produce their car with higher quality than gm will achieve with the camaro firebird the way gm loses money the temptationto just get them out the door for the sake of positive cash flow will be great once demand really takes off tim gardner from jpvllyoakresuncom jeff perrysubject re the mustangjmhhoppervirginiaedu jeffrey hoffmeister writes in article aprvirginiaedu jmmhvirginiaedu the blad i just have got to remind all of you that this is it yes thats right somtime this fall ford the granddaddy of cars will be introducing an allnew megacool waytoofastforaccorddrivers mustang its supposed to be streamlined looking similar to the mach iii concept car ford came out with around january i cant wait anyone out there hear anything about it recently if everything ive read is correct ford is doing nothing but re skinning the existing mustang with minor suspension modifications and the pictures ive seen indicate they didnt do a very good job of it the new mustang is nothing but a recycle of a year old car i just saw a picture of the mustang in popular mechanics what a disappointment after being bombarded with pictures of the mach iiijpfrom cmizzoumissouriedu jim strugliasubject michelin trx tiresinfo neededhi alli have available to me a set of metric wheels came off a mustang or tbirdwhich are wearing nearlybald michelin trx r tires the only placei have found these tires is the tire rack mailorder place for a popis there a cheaper source or another manufacturer of this size tire thanksfor any infoplease email responses and i will post a summary if there isany interest jas jim struglia cmizzoumissouriedu cmizzoubitnet from steveipecacwpdsgicom uncle wiggily in connecticutsubject re what car is thisin rninnkpctronnewsctroncom smithctroncom lawrence c smith writesin article aprreededu rseymourreededu robert seymour writesin article aprwamumdedu lerxstwamumdedu wheres my thing writes it was called a bricklinbricklins were manufactured in the s with engines from fordwaitaminnit didnt the bricklin have an pugeot sixcylinder or am iconfusing it with the delorean i was sure the delorean had a vthe delorean used the peugotrenaultvolvo v in a rear engine configurationthe bricklin use some merkin iron in a front enginerear drive configurationsteve valinstevesgicomive just had my brain washed and i cant do a thing with itfrom keysstarchildncslnistgov lawrence b keyssubject re questions about insurance companies esp geicoin article cuiuaomurdochaccvirginiaedu jmhhoppervirginiaedu jeffrey hoffmeister writesin article aprjulianuwoca wlsmithvalveheartrriuwoca wayne smith writesin article mimsyumdedu davewcsumdedu david g wonnacott writesim considering switching to geico insurance but have heard thatthey do not assign a specific agent for each policy or claim i wasworried that this might be a real pain when you make a claim i havealso heard that they try to get rid of you if you have an accidentive read in this group that geico has funded the purchasing of radarguns by police depts im not sure wheregeico has purchased radar guns in several states i know they have doneit here in cti have also heard horror stories about people that have been insured by geicofor years and then had accident and were immediately dropped and onceyouve been dropped by any insruance company you become labled a highrisk and end up forking out or times what you should be for insurancethis must vary from state to state because our old company kemper wantedto drop me keeping my wife or tripple our premium because i had ticketonly points for mph over speed limit well i called geico and theyinsured both my wife and i for less then we were previously payingkempergenerally i hate the whole insurance game i realize that it is necessarybut the way that a person can get dicked around doesnt make any senseone good thing about geico is that everything can be handled overthe phonemy suggestion stay where you are or shop around but stay away from geicojeff larry keyscsmesncslnistgov oo v fahrvergnugen forever the fact that i need to explain it to you indicates that you probably wouldnt understand anyway from amhnscclehighedu alois m himslsubject re dumbest automotive concepts of all timein article aprjpldevvaxjplnasagov nancyhayduke nancy feagans writesashtrays and cigarette lighters these should be an optionnancy j feagans jet propulsion lab nancyjpldevvaxjplnasagovnot a shred of evidence exists in favor of the idea that life is seriousyou forget that the cigarette lighter plug is essential for plugging in radardetectors and lights the ashtrays are also essential because they are greatplaces to keep change and tokensal hfrom ssaveolecdaccom the devil reincarnatesubject v v v v vx i am curious about knowing which commericial cars todayhave v enginesv i dont know of anyv legend mr mrv dont know of anyv jaguar xjs please add to the list thanks s ssaveolecdaccomfrom ahyfnysuedu jerry sysubject are ford shop manuals good i am planning on buying a repair manual for my ford taurus is the ford shop manual comprehensive enough covering repairsin all aspects of the car how about the haynes manual for tarus please email replies if possiblethanks in advancejerryfrom boylecactusorg craig boylesubject re is car saftey important in article conradiefirgasunacza conradiefirgasunacza gerrit conradie writesmuch discussion about economics of safety deletedsafety is an important criterium for me when buying a car i wont buy a small car like a civic or whatevergreat safety handling speed for meseems to me that you would be more dead in a small car than a large car after an accidentthis is a very simplistic view of safety assuming that you are in a collisionless likely with a more agile smaller car then the important factoris how well does the car sacrifice itself to save you this is why a thousandpound f car can hit a wall at and the driver walks out and whyeverybody dies when a suburban hits a wall at as i recall for the lastgeneration suburban hic numbers as an aside just what is the point of an airbag it seems to me thatseatbelts with pretensioners audi et al or a good tight point belt will prevent you every moving far enough to hit the airbag you might besaved from some flyign glass or is an airbag just a lowest common denominatorsafety device that is of some use in a head on collision when you arewearing no seat belt craig gerritfrom aefreenetcarletonca mike harkersubject re what car is thisyou guys are correct the bricklin was produced in canadathe national museum of science and technology here in ottawahas one and sometimes they put it on display most of the timeit stays in storage because the museum doesnt have much roomits a big deal for a car to be canadian and thats why they have it if anybodys a fan they also have a nice green riviera that looks like it just came out of the showroom mike harkerottawa ontario canadavoice paul tomblin formerly ptgeovisiongvccomsvens law theres exceptions to every law except this onefrom vmbkubvmsdccbuffaloedu neil b gandlersubject need info on bonneville i am a little confused on all of the models of the bonnevillesi have heard of the le se lse sse ssei could someone tell me thedifferences are far as features or performance i am also curious toknow what the book value is for prefereably the model and how muchless than book value can you usually get them for in other words howmuch are they in demand this time of year i have heard that the midspringearly summer is the best time to buyneil gandlerfrom ceruleanaccessdigexcom bill christensbarrysubject camrys eating clutch master cylsi have both an and an camry each with manual speed transmissionsthe has about miles on it and the about miles abouta year ago i found that the master cylinder on the clutch in the was leaking fluid around the piston seal leading to air in the system and fluidback into the passenger compartment of the car i pulled the plunger andgot a rebuild kit new plunger seal etc and thought i had the problemlicked much to my surprise the same problem developed several monthslater this time i looked carefully at the master cylinder to make surethere were no scratches burrs or other obvious causes of the problem ididnt find any ever since i have been periodically feeding the clutchhydraulins additional fluid and bleeding air from the system i knew iwould be selling the car and didnt want to go all the way to solving theproblemi should add that the clutch is original and that ive had to adjust thepedal to allow maximum extension of the piston into the master cylinder inorder to actuate the clutchmy hypothesis is that this means that when fully depressing the clutch pedalthe angle of the piston rod attached to the pedal is off the axix of thecylinder thus cocking the piston and seal and perhaps deforming itwhat do you think of that as an explanation can you suggest a possible fixshort of replacing the master cylinder and getting a new clutch put innow the same problem except that the above diagnosis doesnt explainwhy all of the fluid leaked out by way of the master cylinder into thepassenger compartment while i was on vacation for days during whichthe clutch pedal was not depressed or otherwise caused to distort whatcan you suggest heremany thanks lets hope i dont end up going to click and clack on thisbill christensbarryceruleanaccessdigexcomfrom gkirkaldiesanitytdkcswaterlooonca george kirkaldiesubject re birds are they physics majorsin cpnpldarksideosrheuoknoredu operator writescrazy question anyone ever wonder how birds can drop a load on a cargoing over mph i took a nonstop trip got shitted on four times every time hitting the windshield not even the open sunroof guess we have conscientious birds was going mphi used to have a galaxie convertible was sitting at a light waitingfor it to turn green it turned green but i hesitated a little sleeping iguess and a bird bombed me it landed directly in front of me at eyelevel i guess the bird miscalculated and thought i was going to take offright awayand im still trying to figure out the one i got under my rear bumper aswell was the bird flying up and doing fancy acrobatics at my car anddecided to drop one while executing a perfect loop tt mustang gt george kirkaldie pioneer audio control gkirkaldiesanitytdkcswaterlooonca phoenix gold kicker flowmaster motorsport cambridge ontario canadaa t a r i from heiseracsbuedu bill heisersubject auto waxhaving recently purchased a probe with clearcoat paint i would like to give it a good wax job what is the best type ofwax to use for this type of finish is paste or liquid betteri would be waxing it by hand and buffing it by hand i guessusing cheesecloth to buff it anything better you would suggestive heard comments here before about things like turtle waxand raindance not being very good so im wondering what isrecommended for a quality finishthanks in advancebill bill heiser heiseracsbuedu heiserworldstdcom boston university boston ma from mcrosbiebatmanbmdtrwcomsubject any syclone or typhoon owners out therei want to start of list for syclone and typhoon owners if you are interestedin participating please contact me via emailmerrillfrom eliotstalfosengrwashingtonedu eliotsubject re mr noisy enginein article aprultbiscritedu adnritvaxiscritedu writesthe sound he describes is common to any older toyota engine i ever heardi dont know the relevance of his observations about oil changes my simplymakes noise not all that annoying mind you but you hear it well when theengine is right behind your left ear i think those with mrs would describe the engine as sweet if alittle loud those with mrs i cant imagine any unbiased personpaying it any compliments sounded like my exdormmates rusty chevychevette with the i would want to redline it just for the musicwith the i would short shift so that it would shut up the newcamry features balance shafts i guess since the mr is gettingthe axe it is too late for them to do anything about thisit is no mystery that the turbo mr is only liters the engineershad enough integrity to prevent any further abuses also in europethe mr mk nonturbo was also only liters as usual theundiscriminating american market if it is japanese it must be goodgets the dogs to be fair we also got the turbo which the europeansdid noteliotfrom heiseracsbuedu bill heisersubject re ford probe opinions centered around the gtin article aprncsuedu chuckeosncsuedu chuck kesler writesjeremy g mereness zonkercmuedu sayscan anyone offer any opinions of the ford probe ala how they do inthe long run repair records reliability mileage etcsome other owners on the fordprobeworldstdcom mailing list have commented about this problem but i havent seen it happen on my month old probe gt i think this may be something that ford has corrected since the initial batch of cars also someone said that ford has issued a service bulletin to inform dealers about how to correct this problem so you may be able to get your dealer to fix iti have had my probe looked at twice by my local dealer where i purchasedthe car the first time they made this problem worse the second timeafter advising them of the service bulletin mentioned on my fordprobe mailinglist they said they didnt know of the bulletin they adjusted the window andmade it much better however it now makes a scritch scritch noise on roughroads and still squeals when i openclose the window in wet weather anyoneelsess do thisford only gives key with the car cmon ford spend an extra few penniesi got two keys with my car but only one remoteentry pushbutton thingiebut then i bought my with miles and i think it may have been arepossession so im not surprised something was missing horn buttons behind air bag in spokes and not in center personal preferencei am seriously considering following the advice in the owners manual whereit describes the procedure to follow if you discover something on your fordthat could cause serious injury threaten lives etc somethingabout notifying the national traffic safety group as well as ford those littleyouvegottopositionthefingersperfectlytomakeitbeep buttons areterriblethe latter is probably because of the air bag its pretty much takes upall the space where youd expect to find the hornspeaking of the horn i was surprised to find that the probe comes with oneof those nice merican sounding horns instead of the japanese sounding kindthe previous probes had japanese hornswell i guess thats good in a way but in a way its bad when someonehears that kind of horn they expect to see a big american car they maynot associate the sound with a small jap car style car like the probe istires fling dirtmud onto side of car yeah not very badly but enough to be annoying sometimesthe mudflaps help a lottransmission the speed is a musti have always been a speed guy almost every car ive ever owned has beena speed because i got a good deal on this car with the miles iknowingly overlooked the fact that it has an automatic but it is a prettyhightech automatic it is a fully electronicaly controlled speed withtorque converter lockup even with the automatic im getting mpg on thehighway driving but of course driving is illegal so i probably made that sentence up around town the mileage has beenaround not bad for an automatic of course it doesnt have thecontrol of a speed but since i do a lot of city driving it turns outto be very convenient its nice to be able to drink a cup of coffee anddrive at the same time although that too is illegal here in weliketocontrolyourlife massachusetts no shakerattle noises when going over bumpspotholes stillshakes and rattles has been my main gripe ive gotten them to fix theworst of them but i fear that with the rather harsh ride the car willbe a virtual potpouri of rattles when it gets oldertires vr goodyear eagles left hoping for k on my probe gl i got about k out of the original goodyearsand had driven the replacement tires bridgestone k miles wheni tradeed the car the vr firestones on my probelook like theyre designed for performance ie rather wide shallowtread etc so they probably wont last as long but the car handlesvery very very well it sticks to the road like glue even on a roughsurfaceinterior is very very nice too very pleasing to the eye and ergonomicallysounddefinitely fordmazda did a very very nice job on this one thecar has a much more expensive than it actually is look and feel to ityes this cars stiff suspension isnt for everyone i personally like itbut if you find it a little harsh but otherwise like the car id stronglysuggest looking into the mxhaving driven an probe for years i find the suspension interestingthe car actually drives much better than the it is a very firmride and you definitely know about each and every bump in the road yetthe car remains very civilized on even the bumpiest roads you hear andfeel the bumps yet the car retains its posture very wellif you have passengers by all means bring them along too theyll findthat they have no room in the back and youll find that the car ridesdifferently if thats better is up to you well i wouldnt encourage passengercarrying in the probe unless theperson in the front seat likes to sit with his knees to the dash asmentioned in the consumer reports writeups consider the back seatas a parcel shelf no biggie to me though if it had been id nothave bought the car but its definitely not a family caralso theres a lot of glassaround you which i wasnt expecting the temperature inside the car gets prettyhot in the summerac is a must on any probe from the in particular sends outa real blast of cool air when the ac is on max that lots of glass youmentioned is what gives the car the very good visibility reports yousee in all the writeups most sportssporty cars dont have thatgood visibilityive heard that the exhaust system has trouble but mine works finei havent heard about this one i know that some of the very early probes and maybe had problems with prematurely rusting mufflers whichthe complaints ive heard re exhaust system on s have been on the gt of course being a different engine that is a differeent exhaust systemi was one of those with an who qualified for the free replacementsince i had already replaced the muffler when i received the notice i wasam due a refund from ford i applied in february and am stillwaiting gave me a free rental car for the day and a half that i was without mycar i was quite happy with the way they handledespecially consideringthat i was expecting the worst from themyes i was pretty amazed when i had my car in for some touchupadjustments this past week and they had to keep it overnight too busyfor them to get to it and they offered to pay for a rental they did make me pay for taxes and insurance though from what ive heard it sounds like fordmazda had some qc problems with the probe and probably mx when they first went into production but i think these problems have mostly been corrected at this point thatsalmost always to be expected with a completely new car like this thoughi have to agree that they seem to have some qc problesm but i seriouslyfeel the car design is sound and expect it to do very well bill heiser heiseracsbuedu heiserworldstdcom boston university boston ma from heiseracsbuedu bill heisersubject re water in trunk of probein article aprnewsarcnasagov chungpioneerarcnasagov po sum chung acf writestommy szeto writes water gradually builds up in the trunk of my friends ford probe every once in a while we would have to remove the spare and scoop out the water under the plywoodcarpet cover on the trunk i would guess this usually i noticed this is my probe also when recently cleaning out the back i think the water is coming up through some rubber stoppered holes beneath the spare mine looked slightly worn and there was no water or water damage i have the same problem with my probe the water is definitely not commingup from the rubber stoppered hole beneath the spare i have to remove therubber stopper to drain the water seems like a common problem with probethere is a known problem with the seals on the taillights of probescomplain loudly to your dealer and get them to install new seals it isa known problem present on most if not all pre probes so you shouldnt have to pay them to fix it in my case they fixed it onmy extended warranty i just had to pay a deductable thework was valued at something like with labor and parts havingremoved the tail lamps myself on other occasions i think their estimatewas fair bill heiser heiseracsbuedu heiserworldstdcom boston university boston ma from oaddabstdvax dirk broersubject re its a rush was re too fastin article aprcactusorg boylecactusorg craig boyle writesin article cryfdmentorccpurdueedu marshattfeserveccpurdueedu zauberer writesin article unisqluucp wratunisqluucp wharfie writes remember roads in america are not designed for speeds above meaning they would be safe at roads like the autobahn are smoother straiterwider and slightly banked well thats news before the speed limit on texas highwayswas the speed limit on the new jersey turnpike i was therewere no speed limits in nevada or montanai guess i wasnt clear enough here i said the roads were designed for speeds of or so and still be safe the current will add a safteymargin actually the roads were designated as safe at when they were builtin the s taking into account the kinds of cars then available thenumber would be much higher today because the cars tires and just abouteverything else has imprivoved a lot i believe the interstates were origionally funded as part of a national defense plan etc the requirements were to move heavy army trucks at mphstill its amazing in germany you can have cars traveling mph and mph on the same to lane road around washington dc they cant keep traffic flowing at dirkfrom oaddabstdvax dirk broersubject re old corvettes low insurance and corvette pricesin article rjncsxmgjqhnetcomcom rjnnetcomcom richard newton ii writesin article aprnscclehighedu swrnscclehighedu scott warren rosander writesin article ccsuxfnnewscsouiucedu gdhguxacsouiucedu george heinz writesafter too many years of school im finally graduating and getting a realjob of course i am trying to make plans of how to spend all this extramoney right now i have an accord a good car but not real sporty i was thinking of selling it in about two years and dropping aroundk on a sports car of some kind after thinking about it i may have abetter idea ill keep the accord until it drops and buy the car ivealways wanted a corvette stingray my reasoning is that accord corvette is less than what i would spend anywaybasically im thinking of a late s early s for around kmy question is what are good years to consider for reliability lookshorsepower in that order believe it or not horsepower is not a mainconcern if i want to go fast i get on my motorcycle and what aregood prices to vettes had the same basic chassis add aluminum weaker rear axle housing all these years used same brakes similar springs etc late s was a bad year for gm reliability catastrophic converter was added in cheapest corvette to low end about k tops out about k except for those morooons that think there indy th aniversity vette is special these guys have been known to ask k i dont think they get itbest buy convertables i got my for k needs body work but im willing parts for all are readily avail at swap meets and mail order etcv reliability looks independant suspension wheel disk and all under k and they thought a miata was a good dealalso what would insurance look like im male single i mightwait until im to get the car lower insurance would the fact thati mainly drive the other car lower it is there some type of classiccar or rarely driven insurance class for driving it under k milesper year my dad has a vette and its on what you say classic insurance basically what that means is that it has restricted amount of driving time which basically means it cant be used as an every day car and would probably suit your needs for limited mileagemy origional inquires to my insurance agent i can drive my convertable for miles or less per year i must keep it in a locked garage and it will cost me of the stated value per year does this sound right ive also been looking at vettes recently and found a convertiblethat i like at a dealer i currently own an ford escort gt whichis insured through state farm i called em up and asked about the rates if i sell the escort the vette insurance is per months if i keep the escort the vette insurance is per months theescorts insurance goes down by to approx per months im male and have a good driver discount another variable wouldbe where you live best bet is to just call up some insurance brokersand get a quote state farm says they base the price on the fair market value of the carwhich is determined by an outside apprasier they look in the newspaperand call up dealers to find out what the going rate is and adjust it forthe condition of the car to get the values above they went on the selling price of the car thedealers asking price is i need to do research to find out ifthis is reasonable in any case i told state farm the value was kget an appraiser to look at the car he will check serial numbers and look for origional equipe depending on what mods have been done the car could be worth only k problems like wrong engine trans wrong paint type vetts used lacquer an modification would reduce tthe value but your looking for a car to drive rightthis sounds like a ball park price for a smallblock cu in manual no air car a would put it closer to kget it appraised for insurance purposes alsofrom oprsfnxgsusgigsuedu stephen f nicholassubject re geico im glad this forum came up ive been pricing insurance lately and had considered geico but no more any company with practices like theirs canesad ill stay with liberty mutualsteve nicholaswells computer center georgia state universityoprsfnxgsusgigsuedu a risk is not a risk until it is takenfrom ckauxacsouiucedu oriolefanuiucsubject re wife wants convertiblenuetkeptsmotcom keith nuetzman x p writeshelpmy wife has informed me that she wants a convertible for her next carwe live in south fla so we are definitely in the right are for onemy wife has mentioned the miata but i think it is too smalli would like to wait for the new mustangs dec i thinkanyone have any opinions on anyall convertibles in a reasonable price range thanxthe olds supreme convertible got high marks in cds recent test ifyou can get by the stupid body moldings and stuff the saab ragtop maybe out of your range but its a good choice is there a new fcar convertiblethe nissan sx convertible is a nice car also those immediately come to mind chintan amin the university of illinois urbanachampaign mail llamauiuceduneil peart cquick to judge quick to anger slow to understand ignorance and prejudiceandfearwalkhandinhandfrom mboenigdeweynmsuedu boenigsubject v probably the most famous v is the one cadillac made from about to they had to scale down then because the great depression really put the crimp on luxury cars it had cubic inches with over two hundred horse power they dont make them like they used to there were others though packard had one until about whe it down sized to their legendary twinsix their mainstay for the next twenty years lincoln and pierce arrow might have also had one but i am not two suremost luxury and semiluxury cars of this era at least experimented with v if they did not actually produce them there was actually a cylinder war among the big three to see who could produce the biggest enginebig mstandard disclaimer applies because i cant think of anything wittierfrom kimghmentorccpurdueedu gene kimsubject review ford taurus shoreview of ford taurus sho by gene kimbackground last week i bought a ford taurus sho moving up from drivinga toyota celica st and a oldsmobile cutlass i have beeninterested in buying a sho for about five months and have been combingthe classifieds in denver and chicago every week i bought aremarkably clean maroonred sho with k miles on it for as far as i can tell this is about under blue book and i stillhave another miles before the extended service plan runs out as one should with any pre shos i made sure that the car wasalready refit with the upgraded clutch and pressure plate as well ashaving been recalled for upgraded rotors and seatbelt attachmentshowever my sho does not have the newer rod shifter i understand ican get this for from any ford service center in addition thecar received the full tuneup at k miles receiving new platinumplugs and valve adjustment for a car with k miles on it the car was virtually immaculatethe clearcoat paint job was devoid of any large chips or dentsalthough the front airdammolding was covered with lots of smallscratches not surprising since most of the miles were spent on thehighway having driven a smaller twodoor coupe for so long i was a bitconcerned about whether i could get used to driving a larger car tomy surprise the size of the car doesnt bother me at all it seemsjust as nimble as my celica no comparisons with my oldsmobile visibility from the drivers seat is excellent helped mostly by ofthe small the quarterwindows aft of the backseat door windows andin front of the cpillar and rear window parallel parking is a bitmore difficult but other than that i love the size in fact im starting to appreciate the large trunk as i pack upfor a hour drive to washington dc for the summer more on theride later in this reviewengine as with anyone even slightly interested in shos i was veryinterested in the valve l yamaha shogun engine i was notdisappointed base performance of the engine under rpms isgood you can even do reasonable launches from second gear althoughi dont make a practice of this the engine revs smoothly and eagerly tooling around town does not require many shifts this is goodsince the shifter is definitely one of the weakest points of the carmore on this later while the performance of the engine under rpms may beunremarkable it undergoes a jekyllhyde transformation once you hithigher revs at rpms a butterfly valve opens and you canliterally hear and feel the geometry of the engine changing as twelvemore valves open up the engine soars to its rpm redline andyou are treated to in my opinion the sweetest sounding v aroundthe engine inexplicably sounds overjoyed to be at rpm ive noticed that when i drive around town i constantly watch thetach to see how far below rpm i am to go from rpm to you may have to punch the accelerator while torque is more thanadequate it doesnt come fully online until those other valvesare usedtransmission when car and driver first reviewed the car in theymarvelled at how ford had put such a wimpy clutch and balky shifterinto the car i remember driving a friends parents sho in andremember thinking about whether i had the leg strength to drive thecar in traffic the clutch was that stiff that was back then the entire clutch assembly on my sho has been replaced under aford recall in the clutch on the sho feels no stiffer than theone on my toyota celica in fact the friction point seems a bitlarger and more forgiving when playing with the shifter with the car parked the shifterfelt very reasonable the and gates were where youd expectit to be and the shifting action was smooth on the road itsmuch the same but you have to shift slowly make no mistake itsa clumsy shifter when hurrying shifts like when i was initially trying to impressfriends i consistently miss the shift often grope clumsily forthe shift and sometimes even muff the shift i find thispretty amazing in a car like this it also took me several days to realize that you get the smoothestshifts when you take your time seems obvious but compared to mytoyota and my friends honda this seems atrocious and clumsysomeone on recautos noted that crxs should blow shos offthelinebecause of the incredibly clumsy shifter i now shift much more sedately and the shifter seems morereasonable when you play within these bounds the shifter workssmoothly with no surprises i dont know whether the rod shifterupgrade would help at all along these same lines i initially had trouble shifting gearssmoothly again slowing down the shifts and taking more care tomatch revs when letting out the clutch helped immensely this tookseveral days for me to get the hang of i think some of my problemswere because ive never had a car with enough power to balk at badshifts in higher gears occasionally i have trouble shifting into reverse the shifterrefuses to enter the gate and i often grind the synchros trying to get it into gear ill be watching this carefully in the next coupleof months a quirk when i upshift and the engine drops back to rpm i hear a whirring and then a grinding noise coming from the theengine compartment not terribly loud but the passenger candefinitely hear it i asked about it when i was looking at the caras do all my passengers apparently this is a definitely a shosound and is the gearbox apparently called gear rolloverreplies to my queries on recautos are at the end of this reviewexterior as i mentioned before i am astounded by how well the body of thissho has stood up paint chipping on the front bumper and grille arevirtually nonexistent looking at how older tauri sometimesdont age so gracefully i wonder what the guys at ford diddifferently to the sho bodies the body in my opinion is extremely attractive with matchingcolor body moldings than the stock tauri for some odd reason thesho seems different enough from vanilla tauri to get stares atstoplights of course this could be my overactive imagination shos get fog lights a more open grille a completelymonochromatic exterior and a deeper ground skirt in the back withsho stenciled in relief ive seen a couple shos whose owners havecolored these in with florescent colors or in black yuck i dont think the car is flashy i like it that way i feelalmost anonymous with all those tauri out there but different anddistinctive enough to those of us who care interior the interior is what really makes me feel like i dont deserve thecar the seats are grey leather the steering wheel and shifter arecovered with black leather and the entire instrument panel is done ina blackgreymetallic scheme the instrumentation is stock taurus except for the mph speedoand rpm tach you get a center console with two cupholders alarge compartment under the radio great for a cd player an armrestthat contains yet another compartment three appropriately sized coinholders for tollways i think and a compartment for holdingcassette tapes theres mapholders in the doors and an oddly smallglove compartment i spilled a whole can of coke in the cupholder and was delightedto find that the entire rubber holder can be removed and washed in asink hey im really impressed with the ergonomics andthoughtfulness that went into its design and its a before theinterior was upgraded the backseat is bigger than any car ive had why do they need somuch space no smartass comments please the driver and passenger seat have lumbar and side bolsters fromwhat i hear its not uncommon for the side bolsters to show wearmine is no exception the left side bolster on the drivers hascracked and im not convinced the right bolster is inflating all theway a big surprise for me i forgot that shos dont have a normalhand parking brake instead they have the regular parking brake thatyou press with your left foot too bad again im getting used toit but it seems a bit anachronistic to meride the suspension is nice and stiff too stiff its stiffer thanany car ive had a friends new toyota celica st seems tauterand is still able to soak up bumps better the sho seems stiffer withless ability to soak up bumps driving over railroad tracks is anoisy and jarring affair on the other hand taking turns feelswonderful because the body is so rigid and doesnt flex at all ilistened for that before i bought the car on the highway the ride is great when i drove the car fromchicago back to purdue i had trouble keeping under mph let alonefrom trying to see what mph really feels like its a relativelyquiet ride but the sunroof rattles ive tried to find out whatexactly makes all the noise up there but it seems to be the windowthat rests on the rails no easy way to get rid of it i think over the past three days ive oscillated between thinking thesuspension is wonderful and perfect and thinking that the ride is waytoo rough not for me mind you but i wonder whether i wouldadvise my dad to buy one for himself but ive discovered as withthe shifter if you take your time with shifts youll have no reasonto complain let me explain the ride is worst when turning and applying lots of power to thewheels i feel the wheels scrabbling for traction and torque steermaking the car skitter left and right after i understood this iavoid the limits of traction and im a happy camper again its not body rigidity but the composure of the car as if matching the suspension the steering feel is quite heavymy first impression of driving my sho was how hard you had to turn thewheel at highway speeds it tracks straight as an arrow but whendriving around a parking lot the higheffort steering didnt seem souseful however its reasonable but it doesnt communicate the roadto the driver as well as a ford probe gt imho its much betterthan the steering on my celica st i wonder how bad this car is during wintermiscellaneous notes gripes the rattles from the sunroof is intermittent some days it rattles loudly other days i look up wondering where all the noise went activating the sunroof is sometimes very noisy loud squealing asit retracts on its rails i wonder if there is a quick fix for thisagain other days it completely disappears function of humidity once i made the connection between the sometimes awful feeling suspensionand torque steer ive never complained about ride i wish the seats had more support under the thighs also i wish theside bolsters would close more tightly i hear that tires for this car can get really expensive icurrently have goodyear gts that cost the previous owner for four i used to hate the ford stereo systems whose idea was itto use a volume paddle now to my amazement i dontreally mind and sometimes think its an okay ideapretty ridiculous though getting up to rpm sometimes seems to be a chore butthis is no big deal there is more than enough torquedown low i often goof up the shifting when driving with friends ittook me a couple of days before i could really shiftsmoothly from nd to rd gear hard to believe isnt it my car has almost miles on it my parents noted thatit is almost impossible to find a lowmileage sho astute observation imho i wonder how long i can makemy sho last i just bought a book titled drive it foreverfor tips in this department the goofy parking brake pedal still throws me for a loop i onceparked the car in gear and then accidentally let out the clutchafter i started it the car jolted forward and bounced offthe car in front of me no paint damage at all but starting the car is a whole new ritual for me with that fangled pedal also i began to wonder how strong that brake really is today i backed out of parking spot today and started to drive away before i noticed the glowing brake light oops the drivers power window creaks when closed all the way the same thing happens in my parents mercury sable oddly all theother windows work smoothly likes im liking the interior amenities more and more each day the cupholders are great i didnt expect to use the keyless entry buttons so much butit really is handy you can lock all the doors bypressing the and buttons together neat andyou can never lock yourself out of the car i really feel like i dont deserve this car i really cantbelieve that i could afford it i got this car ten years ahead of schedule i love this car so much that ive been telling my parents tolook into buying one i love this car so much that iwrote this k file i meant to write a couple of linesand ended up with this if there were a jd powers survey for used car owners i would havean opportunity to express my incredible satisfaction of owning this car i dont like thinking about getting another car but at thispoint in time im sure id buy another sho for under youcant beat it next time with an airbag and abs though insurancewise this car is also a big win i pay the same premiumsas on my toyota celica despite that it has nearly twicethe horsepower other odds and ends much to my amazement there is no sho mailing list anywheremaybe because the sho registry publication has filled this void ihavent joined yet but ive noticed that queries about shos stillappear on recautos about once a month owners of shos are alwaysquick to respond and are very vocal fans of the cars maybe someof the most vocal on recautos ive put together the responses to my questions about the cars aswell as other posts with useful information on these cars ill be posting this in the form of a faq soon if anyone is interested in starting a mailing list please speak upi dont know if i have the resources here at purdue to start one but maybe someone out there doesgene kimgenekmentorccpurdueedufrom jkjecwestminsteracuk shazad barlassubject re manual shift bigots wantedthe best autoshifters on the street and not the track are those from porsche they wont change if you floor the gas during a turn a few years back a was in a sx auto you guys call it a sx without turboand was going round a corner i floored it and next thing i know i was pointing backwards the other drivers seemed quite amused shazfrom jkjecwestminsteracuk shazad barlassubject re improvements in automatic transmissionsi just wanted to knowto wheelspin in an auto you keep the gear in n gas it then stick the gear in d ive never tried this but am sure it works but does this screw up the autobox were having a bit of a debate about it herefrom jkjecwestminsteracuk shazad barlassubject re dumbest automotive concepts of all timedumbest options well here in the uk bmw offer a nosmokers optionit just means they take the fag lighter out big dealbtw i just bought a honda crx f its neat did consider an mr targamx you guys call it miata but that crx just one my heart with that body kit and spokes ps is richard out there somewherefrom tedebearlelandstanfordedu theodore chensubject re v v v v vxin article aprtelxonmistelxoncom joestelxonmistelxoncom joe staudt writesv legend mr mrhonda prelude nope cylinderv dont know of anyyou didnt try very hardlexus infinty several of eachi wasnt aware that there was another infiniti with a v besides the qbmw one model seriesseveral the i i i i liter and liter vmercedes one or two modelsone or two theres at least one v for every platform exceptthe compact e sclass sel sel w e eand roadster slacura one model cant remember the name right nowacura doesnt have any v cars at the momentv jaguar xjsbmw il mercedes xxxslsl and sel the other sls sl and sl are v and inline sixfrom tonyzhpwrcemayfieldhpcom tony zugatessubject last of the v interceptorsdoes anyone know what kind of car mad max used in road warriorthey called it the last of the v interceptorsi couldnt tell what it was it was so chopped upthanksfrom chungpioneerarcnasagov po sum chung acfsubject re water in trunk of probein article rrbinnfjatamsuntamuedu jlongemcnexttamuedu james long writesin article rcrngtransferstratuscom tszetosneezytsstratuscom tommy szeto writes water gradually builds up in the trunk of my friends ford probe every once in a while we would have to remove the spare and scoop out the water under the plywoodcarpet cover on the trunk i would guess this usually happens after a good thunder storm a few qs is this a common problem where are the drain holes located for the hatchi noticed this is my probe also when recently cleaning out the back i think the water is coming up through some rubber stoppered holes beneath the spare mine looked slightly worn and there was no water or water damage above the level of the spare area i have the same problem with my probe the water is definitely not commingup from the rubber stoppered hole beneath the spare i have to remove therubber stopper to drain the water seems like a common problem with probepo sum chung email chungamesarcnasagovfrom crprestorscmpilstuedu charlie prestonsubject re is car saftey importantin article aprbnrca tcorkumbnrca trevor corkum writes i was recently thumbing through the lemonaid newcar guide what i found was a car would be given a recommendedunder the picture while a few sentences later noting how adriver and passenger were virtually guaranteed to be killedin a front end collision the most highly recommended smallcar the civic has the worst crash rating of all of the smallcars listed there were many such cases of great vehicleswhere you wouldnt survive an accident is it only me or issafety not one of the most important factors when buying a car imho thebest way to reduce risk when operating a vehicle is being able to avoidhazards and for that reason my preferred vehicle is a motorcycle when i douse a four wheeler my primary reasons are it will keep me dry it will keepme warm or it will carry more cargo if the four wheeler has as muchcollision protection as the average motorcycle then it has enough form mehow do you define safe one definition of safe is without risk is chas dod oh how can you be in two places at once when youre not anywhere at all firesign theatrefrom georgehowellgoucherwbffvamprorg george howell subject re the mustang the current l v will soldier on for about two years a version of the valve modular v in the mark viii could be offered thenhow unfortunate for anyone who loves the simplicity with which and fords and and chevys can be built up still it will providea needed punch for the ford to stay up with the new firebirdcamaros itwouldnt surprise me if ford called the engine a litre in themustang we all know that the current is really litres anyway undisguised the car looks ok but not nearly as exciting as the new camarofirebird imoi must agree i dont think ive seen anything as impressive looking asthe new firebird since my friend back home sold his formula firebird for a paltry without even telling me the bastardgeorge howellgeorgehowellgoucherwbffvamprorg from georgehowellgoucherwbffvamprorg george howell subject broncosdoes anybody have any information on the second generation broncos imnot talking about bronco iis im referring to the broncos that beganproduction in based on the f chassis i believei need to know what to look for can the tops be removed from allmodels how easily can that be done also what kind of price rangeshould i be looking at ie what is blue book im in college rightnow and would like a jeep unfortunately ive got a bit of a ride toschool and i need to carry a lot of junk to and from the dormitory inthe springfall i think that the bronco with the removable fiberglasswould be a better read bigger choice than a cj or cjeven better anybody in the marylandvirginia area interested in sellingonegeorge howellgeorgehowellgoucherwbffvamprorg from cmermagengumdedu christopher mermagensubject re mr noisy engineyeah it seems toyota has always had a problem with those sand sound i know the celicas with em were pretty noisey andthe mrs were no exception now about large displacement swith bad noise i have a grand am ho quad and itsounds really good almost like a larger now toyotais coming out with an allnew celica next year and the mrwell who knowslaterchrisfrom uznerkmclucsbedu andrew krenzsubject re impala ss going into productionin aprucsucoloradoedu dunnjjucsucoloradoedu dunn jonathan james writesuznerkmclucsbedu andrew krenz writesi personally like the looks of the impala ss the caprice was definately weird looking until this year when they made the rear wheel openings look more like a normal car but the impala impresses me gm cant exactly shovethe lt in everything they make you know only the bigger stuff id liketo see it next in a series pickup that would be a hot setup what about in a full size blazer as well would this engine have the gobsof torque necessary for offroading if so this would be even better thanthe syclonewell an lt blazer wouldnt come close to a gmc typhoon in speed i think itstoo heavy as it is right now the normal hp engine has plenty of power for a full size blazer of course im not saying gm shouldnt put thelt in it it seems like they have a real winner with that engine whyspend so much more money into getting a valve dohc v when you can take an lt it even seems to get pretty good gas mpg for a that istalking about impala sswill this be in the door caprice body im just curious if chevy istrying to resurrect their door muscle cars or to compete with the europeansuper sedansyeah its a flat black lowered door caprice riding on aluminum rims andeagle gsc tires the rest of the car is basically a caprice ltz read plush police package with horsepoweri heard that chevy is resurrecting the monte carlo but thats going to get their dohc v and not the ltjon dunnandrew krenz uznerkmclucsbedu krenzengrhubucsbedu from briangbariengsuncom brian gordonsubject re legal car buying problemsin article csydncvmegatestcom jaomegatestcom john oswalt writeshowever if you agree some terms and then when about to sign thedealer slips you a contract with different terms and leads you tobelieve that it embodies the terms you verbally agreed to thatis fraud there is no day limit on restitution for fraudyou may have to sue and win to get out of this you will almostcertainly have to threaten to sue on the other hand remember the old adage that a verbal agreement isnt worththe paper its printed on once you sign you are going to have one hell of atime proving fraud based on a comparison to what you thought you were going tosign being in the right is one thing proving it is another brian g gordonbriangsuncom briangnetcomcom bgordon on genie on compuservebgordon on aol from rhorwellcrabnetworka roland faragherhorwellcrabsubject re dumbest automotive concepts of all timin article eltargheeidahoamdahlcom rbssawtoothidahoamdahlcom bob smith writesin article aprcasorg sdmcasorg writes imho the dumbest thing we ever did in copying the japanese was moving the dimmer switch from the floor to the lever controlling the turn signalcruise controlbun warmer etcwell my porsche had the dimmer on the turn signal stalk guess thosedumb germans were copying the japanese too rest deleted not to mention my friends citroen traction avant with the light switch and dimmer integrated in a single stalk off the steering column those dumb frenchwere apparently copying the japanese before the germans rolandfrom rhorwellcrabatcboeingcom roland faragherhorwellcrabsubject re what is volvo in article sernewsraleighibmcom mperryvnetibmcom mark perry writeshardly a good reason most us cars do too and plenty of peoplebuy them in the us anyway i think the is quite a goodlooking car unlike the us influenced kevinhhaslerascomchi dont think its so easy to tell the from any other or series unlessyou look real close i really do think volvos are all dogs though beacuse theyare agricultural while previous volvos have been essentially very fast tractors the and seriesare far from agricultural in design or execution how many fwd tractors have you seenhave godlier than thou advertising you state this like it is a bad thing remember car companies usead agencies they dont do their own adsare part of renaultis this true i know that they had done joint ventures with renault but i haventheard about their subsumption into renault does this mean that the french governmentnow owns volvo anyway renault makes some very nice cars they just dont sellem in n americahowever one thing that i do think is in their favour is that they areimmediately recognisable as a volvo and that is not something you can sayabout most japanese manufacturers and ford saab also have a strong corparatelook which like it or not is what i thing all car makers could aim for tomake life a little more variedhere heremperryvnetibmcomrolandrhorwellatcboeingcomfrom pvalbnyvmsbitnetsubject vw jetta gli helpi am considering the purchse of a vw jetta gli with k miles on iti recently found out that there are two versions of the gli v and vi know of three differences between the two cars that both carry the samename the v version has more horsepower wheel discs and a standardsunroof oops thats the difference between the gli v and the regular gl so in addition to the engine what other differences exist between thetwo models of the jetta gli more importantly how can i tell which version this one is there areno badges that said v so i am inclined to think that is the v versionassuming this one the one i looked at is the v version is there a validreason to buy it instead of a comparably equipped gl which would cost less of course i would love to get the v version but money talksplease email any responses thank youpeter volpepvalbnyvmsbitnetfrom eliotlanmolaengrwashingtonedu eliotsubject re manual shift bigotsin article cliwcaxnewsrichbnrca peon wo email eric youngblood writesin article qnlocsvelaacsoaklandedu mjepookiepasswayneedu michael j edelman writesthe big disadvantage of automatics is the hp they consume that nevergets to the wheels in this respect they are at a disadvantage to a manualonly when the torque converter is not locked up there are autos out therewith converter lock up in nd rd and th gearsdont forget that now that new speed manual trannys are available the drivetrain is more optimally geared to get the most out of the enginerare so are speed autos but very realbottom line is both manuals and automatics have vastly improvedi think that automatics have advanced far more than manualsespecially in shift intelligence i say that a smart automatic isbetter than the majority of drivers in terms of being in the rightgear at the right time which to me is more important than torqueconverter lossesi prefer the stick for fun and the auto for trafficwho says you cant have your cake and eat it too a well designedshifter will easily facilitate manual clutchless shifts i amreferring to the much copied mercedes jagged gate the onlydepartment where you lose out is in the number of ratios availableand of course the converter lossesif ayrton senna can drive a racecar with fully automatic transmissionit cant be half bad eliotfrom matmcinnnusccnussg matthew macintyre at the national university of senegalsubject re warningplease readcallisonuokmaxecnuoknoredu james p callison writes im not going to argue the issue of carrying weapons but i would ask you if you would have thought seriously about shooting a kid for setting off your alarm i can think of worse things in the world glad you got out of there before they did anything to give you a reason to fire your gun i think people have a right to kill to defend their property why not behonest do you really care more about scum than about your carfrom tedebearlelandstanfordedu theodore chensubject re sho and scin article clreconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writeswhy anyone would order an sho with an automatic transmission isbeyond me if you cant handle a stick you should stick with aregular taurus and leave the sho to real drivers that is not tosay that there arent real drivers who cant use the stick egdisabled persons but they arent in any position to use ansho anyway actually disabled persons have been known to drive in sccaraces id be careful about making sweeping generalizations hereid prefer a manual transmission but the early sho had anawful transmission that felt like it came out of a truck or somethingit was almost enough to make me want an automaticteddyfrom boylecactusorg craig boylesubject re too fastin article qmcihdhsarmorycenterlinecom jimfcenterlinecom jim frost writesboylecactusorg craig boyle writesthe quality of autobahns is something of a myth the road surfaceisnt much different to a typical tx freeway they are betterin terms of lighting safety signs roadmarkings etcthey light the highways in texas funny everywhere else ive beenthey only light em at junctionssorry by they i meant autobahns not us freewaysi wont even get into how much road markings vary between states andlocalities except to say that there are some areas where markings areessentially nonexistantthan most of the roads here a dip in the asphalt that you test yourshocks on at will kill you at dont get me wrong i love toit would have to be quite severe i dont recall any us freewaywithout road damage warnings that i would regard as unsafeat in any decent well damped cari suspect you have very limited experience us freeways varydramatically particularly between states i can name a number ofinterstate highways in various parts of the country where would bevery optimistic in any carwell ive driven in every state but alaska and drive about k per yeari take long cross country trips any chance i get its fun for me and ican get reimbursmentmy job allows me to drive rather than fly not to labor the point butive driven just about every freewayin the us germany uk and france plussome in mexico which was surpisingly goodim not sure what you call quite severe in terms of road deviationsbut i suspect every single bridge junction on i through ct would beconsidered so theyre hard to take at mph thats not the onlyinterstate ive seen with such deviations but its one i drivefrequentlyyes but as a age of the total freeway in the us all you have to do in this case is mark the hazard advising people toslow to or so texas is pretty much an edgecase you cant assume that everywherehas roads in such good condition such flat terrain and suchtexas freeways are varied sometimes a good surface mostly flat buti in ca is comparable and hillywideopen spaces it just aint sogiven the absence of other traffic and car built for eg most us freeways are just fine the problem is other road users andcopsjim frostjimfcenterlinecomcraigfrom boylecactusorg craig boylesubject re plymouth sundancedodge shadow experiencesin article oprsfnxgsusgigsuedu oprsfnxgsusgigsuedu stephen f nicholas writesstuff about dodge shadow deleted as an exfleet mgr of cars they were amoung the most trouble free ofall models i bought one for my wifewhat do you mean by all models all models of cars all chrysler modelsall models that the fleet manager had bought because there is no way inhell that the shadow is the most reliable car of all models sold noteven chryslers dept of lies damned lies and statistics would claim thatcraigfrom bzclevelandfreenetedu derek j wojciechsubject question to nissan zx ownersgurus esp modelsi purchased a used nissan zx nonturbo last year i had a question on gearrpm ratios right now in th mph im at rpms mph im at about rpms is this about thenorm im an auto neophyte so im just wondering if these arethe proper ranges somehow the rpm figures seem high a friend of minejust told me he can hit mph in rd on his chevy beretta l valso anyone know the top speed attainable redline for this model znot that i would try it but it would be an interesting factoid thanxderek fire and love the two extremes wojciechosseknrlnavymil that we live between fire and love theres more to life than surfing or snowboarding the eye can see guardian ridin the wavefrom tquinnheartlandbradleyedu terry quinnsubject re the mustang they beat ford to the market with the camarofirebird but really only in words production of these vehicles will be limited until the end of the year keeping selling prices above msrp for the most part since there are so many twitching camaro fans out there drivel i received delivery of my trans am weeks after i ordered promised weeks and paid over dealer invoice which is a discount off of msrp i only have about miles on it but so far no problems and it seems very well put together by the way first year production will be about cars dealers would like you to think there is a shortage but considering they only sold about f bodies last year and the new model was introduced midyear that is not going to create a shortage gm planning on ramping to about f bodies next year according to a wsj article several people have mentioned seeing a photo of the mustang in popular mechanics i saw a photo of it in motor trend january issue p direct side on view although they described it as a seriously handsome car with broad shoulders i thought it looked pretty boring in that view roofline reminded me of a toyota celica yuch description of mechanicals same as has been reported from the pm article terry quinn germantown hills il tquinnheartlandbradleyedufrom compuserve internet tquinnheartlandbradleyedufrom aefreenetcarletonca mike harkersubject re what car is thisyou guys are correct the bricklin was produced in canadathe national museum of science and technology here in ottawahas one and sometimes they put it on display most of the timeit stays in storage because the museum doesnt have much roomits a big deal for a car to be canadian and thats why they have it if anybodys a fan they also have a nice green riviera that looks like it just came out of the showroom mike harkerottawa ontario canadavoice from ckauxacsouiucedu oriolefanuiucsubject re questions about insurance companies esp geicowlsmithvalveheartrriuwoca wayne smith writesin article mimsyumdedu davewcsumdedu david g wonnacott writesim considering switching to geico insurance but have heard thatthey do not assign a specific agent for each policy or claim i wasworried that this might be a real pain when you make a claim i havealso heard that they try to get rid of you if you have an accidentive read in this group that geico has funded the purchasing of radarguns by police depts im not sure wheremaryland and other statesto the original posterread the last issues of car and driver about this its interesting and should be illegal chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom ckauxacsouiucedu oriolefanuiucsubject re geicogoldbergoasysdtnavymil mark goldberg writesin recautos jmhhoppervirginiaedu jeffrey hoffmeister writesmy suggestion stay where you are or shop around but stay away from geicoi strongly agree with jeff heres my horror story many years backi switched to geico from state farm to save some i have a relativelynew sports car for which we covered with liability collision andcomprehensive with this make of car new models came out in januarynot september like other makes the car was purchased in august ofthat yearwe also had a much older clunker for which we only wanted liability low and behold a vandal slashed the roof of the sports car and we put in a claim this was in october still the current model year forthe car a new top with installation was we had deductibleso we should have gotten you had to go to geicos local officeto have an adjuster see the car unlike state farm that sent the adjustersto the shop or your place he said since the car is now one yearold well depreciate the top by so youll get on the claimthis will also count as an accident against you so your rate may increasethe hassle continued then we got a letter from geico saying claimdenied your policy on this car doesnt cover this i then learnedthat their records had the full coverage collision etc on our oldclunker and only had liability for this new car they mixed upour cars in their records i fixed the top myself with some carpetthread and dropped my claim they still charged me with an accidenti cancelled my policy and switched to another companythe coup de gras came when they sent me a bill for an additional balancedue for the difference in collisioncomprehensive cost between my sportscar and my clunker i returned the bill unpaid with a nastygramplus explicity directions to perform rectocranial insertionhavent heard from them since everyones entitled to my opinion goldbergoasysdtnavymilimagination is more important than knowledge albert einsteingood for you i am convinced that someone should start a boycott against geico any takers chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom tedebearlelandstanfordedu theodore chensubject re ultimate awd vehiclesin article aprengrwashingtonedu eliotstalfosengrwashingtonedu eliot writesthe price of parts is a different story thoughyou can say that againhow does for a new thermostat soundteddyfrom schraderpieaiiastateedu dave schradersubject big blockas the subject says it has k and my brotherinlaw wants please dontreply to me as i am posting this for him heres his numbers pmpm daytime dave schrader schradereaiiastateedufrom westesnetcomcom will estessubject looking for low lease rate on toyota previawhats the best lease quote that anyone has seen on a toyota previa dx or dxalltrac for a twoyear lease if you know where i can get a betterrate than month please contact me with the name and phone ofthe dealership will estesinternet westesnetcomcomfrom buttcamisstanfordedu ayub buttsubject toyota coralla fxfor sale toyota corolla fx amfm radio nothing elselow mileage i ride my bike to workdark blue good condition only i am leaving the country for a year and must sell thisgreat city carcall renee fecteau leave messagedo not email to this accountfrom gaiacarsonuwashingtonedu iwe are gaiasubject re plymouth sundancedodge shadow experiencesin article oprsfnxgsusgigsuedu oprsfnxgsusgigsuedu stephen f nicholas writesdaubendrnextworkrosehulmanedu darren r daubenspeck writes they are pretty much junk stay away from them they will be replaced next year with all new models junk theyve made the cd lists for years due to their excellent handling and acceleration they have been around since about oh or so theyre not the newest on the lot and mileage is about five to eight mpg under the class leader you can get into a l v hp shadow for k the i turbo a bit more and a droptop for k as an exfleet mgr of cars they were amoung the most trouble free ofall models i bought one for my wifennnnnnnng thank you for playing i cannot agree with this i believedthis and to put it nicely it was a piece of junki loved this car i babied it i pampered it and after years it justcouldnt stay together i would say that not everyone will have theproblems that i had but know this its not just the car it is theability to get the car fixed which will not happen at anychryslerdodgetake your pick dealer i dont care if there are going toreform their dealersservice with the intro of the lh cars i will believeit when i see it case and point the local dodge dealer you drive upjust looking you dont even get out of your door when about yes salesman all eye you like their next meal and literally pounce on youand try to get you to make a deal on everything your eye wanders towardsservice is about times worse than that i had an alignment problem butthey tried to tell me that the k frame was bent and about dollars ofworkparts to fix it let me tell you the problems i had and i took careof this car i put alot of miles on it in the first couple years but tookit to every checkup it needed and many that shouldnt have been dodge shadow esthese were replaced within the years that i owned the carengine alternatorsrear suspension torsion bar water pumps thermostatshall effect sensormain computer batteriesthese were rebuiltrepairedradiatorautomatic transmissionpower steeringthose are just the things i can remember off the top of my head forabout a year before i sold the car i said to myself its a good car ijust cant find anybody competent enough the fix it in the end before itraded it in for a saturn the power steering started acting up again ijust stopped putting money into it i must have put at least worth of repairs over its lifetime i am sorry but lee iacocca can biteme bullshit whoever backs em best is just afraid the stupid things aregoing to fall apart and no one will buy them without assurance why thehell do you think that lh has been nicknamed last hopeyou can do better and i know people will disagree with me here butjapanese like honda or toyota or the only american car company that ifeel is a quality product saturn i will not touch another chryslerproduct again no way i dont care how good the lh cars look good and iwill admit they look promising but not with the support that you get gmisnt much better thank god they dont control saturn like they dotheir divisions or it would be just another marketing ploy dont get me wrong i will be watching my car which i do like like ahawk for the next years i am much more hesitant to say it or any caris really good until it has proved itself to mebut since someone else pointed out cd as a source i will note becausei used to read these magazines that car and driver has never had a goodthing to say about most chrysler products shadow for one always werethey moaning about the reguritated kcar and engine whereas motor trendalways thought they were great cars no car magazine is really objectiveand although there are alot of people who dont like consumers reports iwill use them to reinforce my argument i already know about the big stinkwith the saturn crash tests time will tell how good a car they are theshadowsundance rate much worse than average in fact none of thechryslers rate a better than average i think the best one is justaverage excluding the diamond starmitsubishi stuff and the lhs youcan find bad stuff about the shadow try as i might when i researchedthe saturn i could not find anything bad about it there is a great dealof information about this company just because it is a new americancompany and it has created quite a stir in the automotive community forgood reason much more than the introduction of any new model lines ofany established company i read an article which had a subcolumn an ithink this imprinted on me more than anything else some big wig intoyota said and i quote we are watching them very closely come oneverybody grow up the foreign cars especially the japanese have beenkicking our butts for good reason the american car companies could not makea good product or support the customer the way they want these days toset in their ways which is one of the reasons saturn was created theyare still struggling because they havent learned yet they have theability the workers are not inferior the technology is not out of datebut their attitude is and they are just finding this out its calledcompetition gentlemanwomen if you dont satisfy the demand of theconsumer well your out asbestos suit ongaiafrom adnritvaxiscritedusubject bmw ii looked at that bimmer yesterday its an has about kmi accordingto owner odometer stopped working at kmi drivess well sounds goodbody is ok he wants i liked the car despite its auto tranny but my wife will be a primarydriver on this one and she wants autothe radio does not work untill the car warms up and you honk the horn the ac seems to have a leak the sunroof is sticky but operationalodometer does not work as mentioned beforeidle is a bit bouncy going from rpm to rpmwipers are slowthats teh gripes the owner says that he changed radiator alternator rotors and calipers exhaustthe biggest problem is that the owner is a shifty sob telling strangestories i hate that i would never buy from a persom like that except howoften you see a descent i for that amount of money he also said thatalthough i could bring a mechanicin he wouldnt let me check the car by taking it to a garage suspicious and who knows what milage is on itso let me know what to check for given theres practically no rusti know there was an article on i in rd a few years back anybody rememberswhat issuemikesfrom awhitesscsasupennedu andrew whitesubject compilation of problems chevy capricemy caprice classic with k miles has finally reachedthe threshold of total number of mechanical problems thati am forced to post anyone out there who might beable to give me some pointers on one or more of the belowplease email or post when making turns especially when accelerating there is usually a loud thunk from the rear of of the car sounds like it could be the differential what could cause this is the differential going bad i recently had the differential fluid changed and it did have tiny metal bits in it and no the sound is not something rolling around in the trunk on starting the car i get blue oil smoke from the exhaust for seconds exhaust valves going bad worn rings anyone know whether the valves on the tbi engine can be lapped brakes more pedal travel than i feel comfortable with but master cylinder is full and fluid is relatively clear pedal does not slowly sink to the floor when held down pedal does not feel spongey but i suppose that bleeding the brakes might help could anything else cause this tranny tranny problems seem to be slowly getting worse takes almost seconds to downshift from rd to nd on heavy throttle application and more recently it is reluctant to shift from nd to rd fluid checked with car running with tranny put through all the gears and then back to park as per haynes manual is red and clear and is on full mark my springs all around are just about shot i have new shocks on but car still skips out on bumps in turns at moderate to high speed how hard are they to change can they be reconditionedid be interested in hearing from any gm fullsize rwd ownersout there with stories to tell andor advice here in phillythese cars are apparently stolen quite often and convertedinto taxis apparently the cab conversion shops will get ajunk title for the car or switch vins with a car about to bejunked about of philly cabs are caprices with most ofthe rest being crown vics with a few old new yorkers andimpalas broughams andrew whiteawhitemcneilsasupennedufrom lovallbohrphysicspurdueedu daniel l lovallsubject buick heater controlsi have a buick skylark with k on it i bought it in california and ifitll let me id like to keep it for another year the only problem is theseindiana wintersmy heater controls dont workthe car has vacuum operated control switches for the vents right now it isstuck in the vent mode it will blow warm air but i cant switch the airflow to either the floor i can live without this or the defrost i cant live without this i probably could just jam the air deflector to the defrost position but this blows a lot of air in my face and is wellkind of like putting a vacuum cleaner in reversei have taken parts of the dash off and looked at the vacuum system and i thinkthe problem or part of it is with the two diaphragms which control updownand outsideinside air flow the diaphragm which controls outsideventinsideno vent air is cracked most of the way around and the other one isprobably damaged too considering the advanced age of the cartwo questions is there anything i should be aware of about this other thanthe fact that i should move from indiana in the event that replacement diaphragms arent available is therea way to fix thisthanks for any adviceinfoselahdanlovallphysicspurdueedufrom underdoglelandstanfordedu dwight joesubject market accessin article apreecsnwuedu andreweecsnwueduandrew sung hyun kim writeswhat about the rice import issue of course it is not closed uplike a shell but how open is it compared to to us japan is much more open than koreayes a pontiac grand am suffers a factor of increase in pricewhen it is exported to japanhowever a dodge vehicle the one that congressman gephardt mentionedsuffers a factor of increase in price when it is exported to koreaa ford taurus suffers the same problem a honda accord costsi amnot making this up in koreajust how many people would want to buy a honda accord for solution all ships carrying koreanmade vehicles should be returned to seoul pronto until as such time as korea decides that it wants to abide by the rules of free and fair trade with the usa and japan sayoonara o o ooouooojinsei no imi wa nan desu ka imi ga nai yo umarete kurou shite yatto shinde shimau semete shinde kara itsu made mo anshin dekiru kamisama ima irasshaimasen ka from georgehowellgoucherwbffvamprorg george howell subject re impala ss going into does that mean that theyre gonna bring back the biscayne and bel airor how about the georgehowellgoucherwbffvamprorggeorge from ckauxacsouiucedu oriolefanuiucsubject re v v v v vxssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars todayhave v enginesv i dont know of anyv legend mr mrv dont know of anyv jaguar xjs please add to the list thanks s ssaveolecdaccomthe viper isnt an inline or flat is it im pretty sure itsa v also the cizeta is a v but it may not yet be more than a dream chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom bepcbnewsgcbattcom bentzepuryearsubject re sport utility vehical comparisons any opinionsfrom article riminnncronkiteciscocom by kmacciscocom karl elvis macrae i just read articals on this in road and track and car and driver is that one mag or two b and i was wondering if people out there have any opinions that differed from what these mags have to say im looking at the following three suvs anyone whos driven all three have any strong opinions ford explorer toyota runner nissan pathfinder currently im leaning toward the toyota cause ive had big success with toyota trucks in the past and cause i think its the best looking of the three but i thought id see if anyone has any strong opinions thanks karl i agree that the toyota is the best looking i just didnt fit plus it is thehighest cost of all the ones you mentioned i have good friends who have allthree of the trucks you talked about the ones with kids all went to theford because of the room required to carry a couple of kids and all the junkyou need the single ones went for the toyota and the nissan every one hasbeen happy with what they bought although no one is into serious four wheeloff road driving karl elvis macraesoftware release supportcisco systems kmacciscocom or batmanciscocom dod fj shovels and rakes and implements of destruction arlo guthrie bentz puryear ncscbep att tsc e maplewood aveenglewood colorado powder skiing the path to salvationfrom robohenocfberkeleyedu henry robertsonsubject re market accessin article aprlelandstanfordedu underdoglelandstanfordedu dwight joe writesin article apreecsnwuedu andreweecsnwueduandrew sung hyun kim writeswhat about the rice import issue of course it is not closed uplike a shell but how open is it compared to to us japan is much more open than koreayes a pontiac grand am suffers a factor of increase in pricewhen it is exported to japanhowever a dodge vehicle the one that congressman gephardt mentionedsuffers a factor of increase in price when it is exported to koreaa ford taurus suffers the same problem a honda accord costsi amnot making this up in koreajust how many people would want to buy a honda accord for solution all ships carrying koreanmade vehicles should be returned to seoul pronto until as such time as korea decides that it wants to abide by the rules of free and fair trade with the usa and japannow now before we get too carried away herekeep in mind that owning any car in korea is a luxury that only the rulingclass can afford every government agency worth its salt finds some reasonto levy a tax on car ownership last i heard there were seven differentfees to pay to own a car i believe this is the sort of petty bureaucraticinefficiency that new president kim young sam wants to eradicate basicallyi think the rules came into place as bureaucrats from plebian backgroundswanted to wreak revenge on the ruling class in exchange zaibatsus likehyundai screwed over smaller companies perpetuating a vicious cyclei have faith that korean people can potentially build cars as well as anyoneelse but for now hyundai cars seem to reflect the tensions within societyof screwy components that wont work together stubborn like a mule thecar either wont go forward or wont stop at allfrom jgbuhuraccrochesteredu outatimesubject emergency brake on nissan maximajust a quick simple question reallyhow many wheels are affected by the emergency brake on an nissanmaxima ive heard that all four are affected but this would seem unusualto me i thought the emergency brake on most cars only affected the rearwheels also how powerful is the emergency brake usually enough to lockwheels at mph hmmmm i just have to wonder about some of the things ihearoutatime from jgbuhuraccrochesteredu outatimesubject thoughts on the vw corrado vri was curious as to what people thought of the vw corrado vrthats about itoutatime from jfealchemytncornelledu brian chungsubject re market accessin article racfnhagateberkeleyedu robohenocfberkeleyedu henry robertson writesnow now before we get too carried away herekeep in mind that owning any car in korea is a luxury that only the rulingclass can afford every government agency worth its salt finds some reasonto levy a tax on car ownership last i heard there were seven differentfees to pay to own a car i believe this is the sort of petty bureaucraticinefficiency that new president kim young sam wants to eradicate basicallyi think the rules came into place as bureaucrats from plebian backgroundswanted to wreak revenge on the ruling class in exchange zaibatsus likehyundai screwed over smaller companies perpetuating a vicious cyclei have faith that korean people can potentially build cars as well as anyoneelse but for now hyundai cars seem to reflect the tensions within societyof screwy components that wont work together stubborn like a mule thecar either wont go forward or wont stop at allhahahahahaha gasp pant hm im not sure whether the abovewas just a silly remark or a serious remark but in case there aresome misconceptions i think henry robertson hasnt updated his datafile on korea sincemid s owning a car in korea is no longera luxury most middle class people in korea can afford a car and dohave at least one car the problem in korea especially in seoul isthat there are just so many privatelyowned cars as well as taxis andbuses the rushhour has become a hour phenomenon and that there isno place to park last time i heard back in january the kim administrationwanted to legislate a law requireing a potential car owner to providehis or her own parking area just like they do in japanalso henry would be glad to know that hyundai isnt the onlycar manufacturer in korea daewoo has always manufactured cars andi believe kia is back in business as well imported cars such asmercury sable are becoming quite popular as well though they are stillquite expensivefinally please ignore henrys posting about korean politicsand bureaucracy hes quite uninformed t h brian chung happiness is this sig was broughtjfealchemytncornelledu tea earl grey hot to you by frungy thejfecornellabitnet lake st apt a sport of kingscesrthc ithaca ny from jimbhpinddacuphpcom james brudersubject honda clutch chatteranyone else experiencing a similar problemthis concerns the clutch on a honda accord speed when the clutchis first used in the morning about the first miles of shifting thereis a significant amount of clutch chatter until things warm up then theclutch shifts smoothly this chatter started when i moved to the san francisco bay area from a lowhumidity environment the dealer statedthat this is known to happen since honda changed from an asbestos tononasbestos clutch material no remedy seems that moisture on clutchsurface causes slipping until the moisture evaporatesany comments out therefrom bellplainsnodakedu robert bellsubject honda civicsaturn sl info neededto anyone with experience about honda civic ex or dx or saturn sli would be interested in knowing how reliable these cars are how expensivethey are to own and operate parts maintenance gas insurance if thedealers are good and if they actually live up to their economy imageanother question what would i expect to pay for a civic ex coupe withautomatic air and an amfm radiomail to the address below or post to this groupthanks robbellplainsnodakedufrom colellocheshireoxyedu robert colellosubject houston auto insurancehello i am moving to houston to go to rice university for graduate schooli will be living on the corner of s mian and university blvd i waswondering what kind of liability rates to expect here is the releventinfo sex male age status single commute none walking car ford crown victoria doorif anyone can check the above info or is in a similar situation pleaseemail me the rates they find out or pay thanks for your help in advancecolellodelphicomcolellocheshireoxyedufrom pvalbnyvmsbitnetsubject buying a used car i have a few questions about the tax on a used car purchasei live in new york state and i am going to buy a used cari know that i will have to pay tax when i go to register the carbut i would like to know of tax is payed on the book value of the car oron the purchase price also what tax rate is used the owner lives inalbany tax and i will be living in saratoga with tax do i pay albany tax or saratoga tax the difference is a whole one more thing how much does it cost for the usual year registration did i leave anything out what else might i have to know to purchase andregister a used car ive never done this beforethank youpeter volpefrom jmillernetworkcom jeff j millersubject re need info on porsche sin article midwayuchicagoedu buzyquadsuchicagoedu len buzyna writeshi thereive recently been toying with the idea of purchasing an old the goingrate seems to be about for cars with anywhere from k mimy question is this what should i expect at this price should i expect tohave extensive body work done what about engine transmission should ilikewise expect to have both virtually replaced along those linesdoes anyone have the names addresses of any mailorder partssuppliers for everything from engine to body parts im completely newto the area of restoring cars and as i dont actually do any work withcars most of the work would have to be professionally done what souldi expect the cost of upgrading a to a rustfree mechanicallysound automobilethanks in advanceandre true enthusiasts will be able to give you a better answer then thisbut ill dump my impressions ive wanted to own a for about yearsnow came close once but i ended up buying a fiero instead biggest mistakeof my lifeanyway for you should be able to get a nice car but your also setin the price range to get taken by a nice looker that is a pile of shitthe most common total failure for the car would be frame rust between theengine and passenger compartment also look for chassis welded togetherhere oh yeah the price range you are talking about must be the bangera if you could find one would be mucho more bucksparts for the engine are pretty easy to come by for an old car and youcan even locate crude in the jc whitney catalog if you have toothe machine itself is pretty simple they use the spare tire for windshildwasher instead of a pump fer chris sake so getting it fixed by a goodbugporsche mechanic would be easy since it is midengine you may spendmore on labor for any mechanical workjeff miller network systems corporationinternetwork group boone avenue northjmillernetworkcom minneapolis mn from adnritvaxiscritedusubject re mr noisy enginein article aprengrwashingtonedu eliotstalfosengrwashingtonedu eliot writesin article aprultbiscritedu adnritvaxiscritedu writesthe sound he describes is common to any older toyota engine i ever heardi dont know the relevance of his observations about oil changes my simplymakes noise not all that annoying mind you but you hear it well when theengine is right behind your left ear i think those with mrs would describe the engine as sweet if alittle loud those with mrs i cant imagine any unbiased personpaying it any compliments sounded like my exdormmates rusty chevychevette with the i would want to redline it just for the musicwith the i would short shift so that it would shut up the newcamry features balance shafts i guess since the mr is gettingthe axe it is too late for them to do anything about thisit is no mystery that the turbo mr is only liters the engineershad enough integrity to prevent any further abuses also in europethe mr mk nonturbo was also only liters as usual theundiscriminating american market if it is japanese it must be goodgets the dogs to be fair we also got the turbo which the europeanswell the is music to my ears i often turn my stereo off and just runit towards red line on nice twisty roads but toyota engines at idle havea strange bells and whisstles at the bottom of a matal can sound i cantdescribe it any betterjust like all the older benzes have a very characteristic clattering soundat idle do you know what im referring tomikesfrom kevinhhslrswihaslerascomch kevinhsubject re opel ownersin article ctbfusenetucsindianaedu mliggettsilverucsindianaedu matthew liggett writes mantas are also ve hot and fun cars toohahahahahahahahahahaha thanks for that i havent laughed so much in ageskevinhhaslerascomchfrom oaddabstdvax dirk broersubject re questions about insurance companies esp geicoin article mimsyumdedu davewcsumdedu david g wonnacott writesim considering switching to geico insurance but have heard thatthey do not assign a specific agent for each policy or claim i wasworried that this might be a real pain when you make a claim i havealso heard that they try to get rid of you if you have an accident im interestend in determining whether or not these things are truehas anyone out there with geico made a claim id be interested inhearing whether or not you were satisfied with the service and whetheryou then had trouble renewing your policy im also interested in any good or bad stories about liberty mutual orstate farm geico supports reads gives to police laser radars they have been known to be very picky no sports cars no radar detectors although maryland insurance board over rules this consistantly no turbosbasically it seems if you need to use your insurance ever they dont want you they once told me they wouldnt insure me perfect record because of my corvette even though it would be insured by another specialty insurance we must insure all the cars i think this rep didnt know what she was talking aboutgeico is cheap but if you ever file a claim be prepared to be dropped i think in most areas two tickets will do itgeico will never see a dime from me if i can help itstate farm slighty higher than most but very good response not as picky as geico from singerllmitedu matthew r singersubject opelgtare the any opel gts out there im wondering if there are enough tostarting a mail listmatthew r singer mit lincoln laboratory wood streetsingerllmitedu lexington ma from georgehowellgoucherwbffvamprorg george howell subject keyless entry now howbruce james writes without the key though the steering column lock would have to be sacrificednot necessarily maybe some sort of servo lock or something along thoselines could be used to acheive the same effect maybe a solenoid type ofthing toogeorge howell m m ooo ppp aaa rrr mm mm o o p p a a r r m m m o o ppp aaaaa rrr m m o o p a a r r m m ooo p a a r r ford better living through american horsepower george howell georgehowellgoucherwbffvamprorg from georgehowellgoucherwbffvamprorg george howell subject re impala ss going intogm has always screwed the rest of the divisions in favor of thecorvette the current platform is no exception the detuned camaro andfirebird is a load of crap to keep people from realizing that they canbuy one of these instead of a corvette and save about i like the idea of an impala ss but if they really wanted to impressme they would throw in a big phat imagine the cops in their tauruspolice package and litres as they stare at your taillightsgeorge howell m m ooo ppp aaa rrr mm mm o o p p a a r r m m m o o ppp aaaaa rrr m m o o p a a r r m m ooo p a a r r ford better living through american horsepower george howell georgehowellgoucherwbffvamprorg from icjpsasuacadbitnetsubject re mercury villager minivan good buyin article cydwpgncubecom bobncubecom bob kehoe sayseither choice is good but beware thati did not experience reasonable mileagewith the v average city driving wasmpg with about avg on the highwaymy nissan quest has been doing mpg city though its first few tankswere more like mpg the v and at are remarkably smoothjohnny p stephens sig file upgrade on backorder will bedistance learning technology here any day nowarizona state university opinions expressed are minefrom battansequentcom jim battansubject re zx or scin article aprnscclehighedu ipnscclehighedu danny phornprapha writesim getting a car in the near future ive narrow it down to zx and scwhich might be a better choicehaving driven both and having owned an sc for months now all i cansay is it depends theyre both great cars in fact my wife and iare saving our pennies so we can get her the zx convertible in a yearthe zx handles like a dream while the sc rides like a dreamfit and finish on both are excellent but the lexus gets the nod incustomer satisfaction theyre both very attractive and hideouslyexpensive the resale value of the sc is better than the zx thezx isnt available with traction control which makes it a handfulon slippery surfaces jim battan sequent computer systems beaverton orbattansequentcom or uunetsequentbattan subject re geeko waz geico annoyancefrom alungmegatestcom aaron lungin article cwgfmonooseecnpurdueedu rjwaderainbowecnpurdueedu robert j wade writesif you want to annoy geico call them upgive fake namebut real car specsget a quote and then tell them they are more expensive than your current state farmallstate insurance they will still send you quote etcthen you can tear up their quote and stuff it in the prepaid return envelope and mail it back to them actually they were more than my currentstate farm ratesactually ive had a bad habit of stuffing a whole bunch of other garbagejunk mail in along with whatever else into anybodys prepaid envelopesuntil they almost burst i believe they pay postage by weightheh heh hehanyways dont tear up the quotes just yeti sometimes use theirquotes or other insurance quotations as leverage to haggle for alower rate elsewhere usually it works to your advantage if they are loweraaronfrom etxmststaericssonse markus strobl subject re what car is thisin article rninnkpctronnewsctroncom smithctroncom lawrence c smith writesin article aprreededu rseymourreededu robert seymour writesin article aprwamumdedu lerxstwamumdedu wheres my thing writes it was called a bricklinbricklins were manufactured in the s with engines from fordwaitaminnit didnt the bricklin have an pugeot sixcylinder or am iconfusing it with the delorean i was sure the delorean had a vthe delorean had the yucky prv v engine a jointventure between peugout note spelling renault and volvo prv this engine is a mighty boring piece ofjunk with approx hp doesnt like revs at allif you look at the delorean in the movie back to the future you will notethat they changed the engine sound to a big v a real delorean doesnt soundshalf as good you will also note that every time they have to spin the tiresin the movie the ground is all wet this is because a delorean cant makea burnout on a dry road the weak engine thats mounted over the rear axlemakes it almost impossiblemarkuslarry smith smithctroncom no i dont speak for cabletron need you askliberty is not the freedom to do whatever we wantit is the freedom to do whatever we are ablefrom erichlimyobsccsicom erich lim subject re militechjchenwindbellcorecom jason chen writes i saw an interesting product in ny auto show and would like to hear your comments militechtm is yet another oil additive but the demonstration of this product really impressive if it didnt cheat well i heard that militech stuff works pretty good too one of myfriends who races in scca sanctioned events and all that stuff got themilitech stuff early as a trial thing and he put it in his crx hesays it worked great but i didnt ask him for any detailsericherichlimyobsccsicom ye olde bailey bbs vbis vbis houstontexas yobsccsicom home of altcosuard from jahonencclutfi jarmo ahonensubject re manual shift bigotskissaneblackberkeleyedu john g kissane writesas a matter of interest does anyone know why autos are so popular in the us while here in europe they are rare just wondering many cars sold here in finland are small and cheap cars at least whencompared to other cars note that we have over car taxand you couldnt expect a good auto mated to a l enginemost of the bigger cars are however sold with autosfrom truesdaldavidwheatonedu phil truesdalesubject mgb questionsmy son is considering the purchase of a mgb which has been substantiallyrestored the odometer has rolled over but we cant be sure of the actualmileage the engine and drive train apparently werent touched in therestoration except for a new carb and a few hoses he plans to do vacuum andcompression checks to see what they might tell us about the engine the bodyand undercarriage have no visible rust the interior is new as are tiresfront brakes not sure about the back battery bumpers and other misc partsthe paint is checked in a few places and scuffed here and there allegedly bya windblown car cover it seemed to handle ok except for soft front shocksquestionsare there problem areas common to mgbs we should check outthe brakes seem soft and rather ineffective what should we expect in the wayof braking actionit seemed to be doggy when accelerating from a stop what should we expectit to do given the cylinder enginethe top is in place but will not reach a number of the snaps the weatherwas cold should the vinyl stretch and fit when it warms up or is it forevershrunkis it normal for the wire wheels to be painted or are they usually chromedgiven this rather limited description what would be a reasonable pricegee this turned out to be a little longsorry while my brother once ownedan xk jag what a car were obviously not into sports cars any help withthese questions or suggestions on other things to investigate would surely beappreciatedphil truesdaletruesdaldavidwheatonedufrom westesnetcomcom will estessubject states that charges sales tax after tradeinwhich western states have laws that charge sales tax on the difference betweena new cars price and the tradeins value i know california charges you on the full value of the new vehicle regardless of tradeinif you are a california resident is it legal to buy a car in a state other thancalifornia without also paying california sales tax how does california enforce any law that requires you to also pay california sales tax on top of the outofstate tax will estesinternet westesnetcomcomfrom kevinhhslrswihaslerascomch kevinhsubject re warningplease readin article aprvoodoocaboeingcom tommhankcaboeingcom tom mackey writes you do have the power steve you can do it why dont you why dont you go shoot some kids who are tossing rocks onto cars make sure you do a good job though dont miss cause like they have big rocks and take it from me those kids are mean that is absolutely correct they have a streak of meanness that runs much deeper and stronger than anything i ever experienced even during the height of the s racial struggles i am absolutely convinced that there are kids out there today that have no concept of right and wrong but have the human intelligence which is turning them into the greatest predators that have ever walked the earth they will prevail unless the rest of humanity decides that it is in their best interest to stand up against these feral humans and for individuals to start taking some responsibility for their own protection in a state in which the individuals turn to the authorities and police for protection the police and government is soon composed of the very feral humans that they originally sought protection fromand i thought the nutters were the ones throwing the bricks from thebridge gee i guess you touched my hot button id better go cool off somewherean institution tom mackey tommvoodoocaboeingcom boeing computer services uunetbcstecvoodootomm ms k po box seattle wa kevinhhaslerascochfrom jdroutscottskidmoreedu jtd is lostsubject honda new car infofrom kay hondas helpful hints about your honda infromation sheetgiven to new owners of honda vehiclesa burning smell may be evident from your new car shortly after takingdeliveryi now own a fire extinguisheron prelude s mels at temperatures above degrees push theaccelerator pedal to the floor one time release slowly and with yourfoot off the accelerator crank the engine until it starts moe than seconds my note of cranking may be required intemperatures below degrees the accelerator will have to bedepressed timesdoor panels and interior trim can be damaged if they are not buckledby getting caught when closing doorswhen shifting accord automatic transmissions from park neutral orreverse into drive the transmission shifts into rd gearin case of towing start the engine shift into drive from park then from drive to neutral turn off enginewhat if you are getting towed bc engine wont runif engine does not run do not use this procedurephew i was worriedinsert smilies where appropriate though this is realjonathanjdroutscottskidmoreeduskidmore college saratoga ny civic si aftermarket fogs if you own one you understandfrom ctvrkocrsvdelcoelectcom thomas redmondsubject re for hail damage a recordin article aprcactusorg boylecactusorg craig boyle writes in article aprpencomcom steczpencomcom writes in article aprcactusorg boylecactusorg craig boyle writes my integra was hit hard in the hailstorm in austin tx the insurance company cut me a check for deductible last week is this a record anybody else had settlements from the same hailstorm yet craig rumor has it that a guy at dell computer had his miata totalled so that would be about k i guess it either had the top down or the hail ripped through the top as you could not do k worth of hail damage to a miata body craig john steczkowski steczpencomcom the constitution grants you the right to life liberty and the pursuit of happiness it does not attempt to guarantee that everyone will be happy there was a volvo owner that had dollars worth of improvements to the looks of the car by hail from cstkocrsvdelcoelectcom spiros triantafyllopoulossubject re ad said nissan altima best sellerin article cuflhpsrgenprpsrhpcom markgsrhpcom mark goldsworthy writesi just bought an altima and like it very much and yes there is alittle stanza logo ever so discretely placed on the trunk the altima isemblazoned in big silver letters but the itsybitsy stanza is shuntedto the far left of the trunk lid you can only see it if you get upclose to the car and know where to look it is very inconspicuousin fact my first clue that this was a stanza was that the owners manualcalled the car a nissan stanza altimaanybody know why nissan did it this wayto avoid paperwork associated with recertification as a brand new caretc so for ad purposes its a brand new nameplate for paperwork itsstill a stanzaspiros spiros triantafyllopoulos cstkocrsvdelcoelectcomsoftware technology delco electronics gm hughes electronics kokomo in i post therefore i armmfrom michalcscmuedu michal prussaksubject re pennsylvania insurance limited tort optionin article oasysdtnavymil glouieoasysdtnavymil george louie writescoverage this also applies to my existing car insurance policy doesanyone understand what the limited tort option means will it lowermy rates if i opt to have it or will it be more expensive if i optto have it what does it do for me in laymans terms please isit a good deal or should i ignore it im not the type to sue anyoneat a drop of the hat nor am i the type to report every little ding tolimited tort option will lower your rates if you choose it you cantsue others for pain suffering but you still can sue for economic lossso you can sue for your wrecked car and for medical bills but you cantsue for for pain and sufferingat least thats how i understand itmichalfrom etxmststaericssonse markus strobl subject re manual shift bigotsin article dxplutfi jahonencclutfi jarmo ahonen writeskissaneblackberkeleyedu john g kissane writesas a matter of interest does anyone know why autos are so popular in the us while here in europe they are rare just wondering many cars sold here in finland are small and cheap cars at least whencompared to other cars note that we have over car taxand you couldnt expect a good auto mated to a l enginemost of the bigger cars are however sold with autosi would guess the high price of gas in europe compared to the us hasalways favoured cylinder manualssmall engines with autos are a real borebut why not turn the question around why are automatics so common inthe usmy guess is that when they tried to couple manuals to the torquerichvs in the sixties the clutches turned out as real killers you had to use both feet to depress and that this has just lived onand also an automatic with a v engine can be real fun to drivemarkus chevy camaro th peugout speeddont ask what your car can do for youask what you can do for your car from gallantoasysdtnavymil robert gallantsubject re questions about insurance companies esp geicoi would gladly spend twice the money for insurance rather than usinggeico not only do they supply radar guns to the police they also wantto make radar detectors illegal they also ask if you have a detectorprobably to put you in a high risk group or just refuse to insure youi know a few people who were droped by geico due to an accident thatwas not their faultrobgallantoasysdtnavymilfrom donaldwendelyobsccsicom donald wendel subject compilation of problemsawmy caprice classic with k miles has finally reached the threshold of total number of mechanical problems that i am forced to post anyone out there who might be able to give me some pointers on one or more of the below please email or postaw when making turns especially when accelerating there is usually a loud thunk from the rear of of the car sounds like it could be the differentialwheel bearing ujointaw on starting the car i get blue oil smoke from the exhaust for seconds exhaust valvesbad valve stem sealsaw brakes more pedal travel than i feel comfortable with but master cylinder is full and fluid isworn pads rear brakes not adjusted up tight or worn out drums of low pedal complaints usually are from a rear brake problemaw tranny tranny problems seem to be slowly getting worse takes almost seconds to downshift from rd to nd on heavy throttle application and more recently it is reluctant to shift from nd to rd fluid checked with car running with tranny put through all the gears and then back to park as per haynes manual is red and clear and is on full markpossible modulator valve if equipped with one also could be thekickdoen cableaw my springs all around are just about shot i have new shocks on but car still skips out on bumps in turns at moderate to high speed how hard are they to change can they be reconditioneddifficult on front easy on rear they are not expensive about for front and less than for the rearits also kind of dangerous to work on the front springs without theproper equipment don slmr a i put spot remover on my dogspots gone ye olde bailey bbs vbis vbis houstontexas yobsccsicom home of altcosuard from etxmststaericssonse markus strobl subject extensionsi was wondering what the country extension aresometimes i just dont have a clue from wheresome people are writingthese are the extensions i know ofch switzerlandse swedenfi finlanduk ukcom usedu us are both com and edu us fr franceplease feel free to add to this list markus chevy camaro th peugout speeddont ask what your car can do for youask what you can do for your car from eliotengrwashingtonedu eliotsubject review audi s quattroits been a while since ive reviewed a car but today i paid a visitto an old friend whose love for audis has been so overwhelming that hemakes a not too sucessful living selling themwithout further delay i will get to the audi s servotronic steeringfor those who are not familiar with what servotronic is it is thename for the speed variable power steering manufactured by zf andused in audis and bmwsi have been outspoken in my damming of servotronic over the pastcouple of months and this was based on magazine reviews and drives ofthe audi cs quattro and the audi cs fwd i am quite happy toreport now that on the s the servotronic is inoffensive isuppose that due to the fat gumball tires the servotronic has beenloaded up more and this so far has been the best implementation thati have tried it is far from perfect mind you and id be muchhappier if it was an option that i could refuse but on the s i nolonger consider this to be bad enough where i feel the entire car isruinedthe steering is still a tad too light but it is accurate and isuppose the stiffly sprung chassis sends back so much information thatsome makes it through to the drivers hands so there is feel andthere is accuracy in the ss steering but there is also room forimprovement i consider the ss steering to be better than thejapanese competition primarily because the japanese do not believe infeel and engineer it out completely enginewheee what a pressure cooker with just miles on the clock i didnot expect the s to be producing anywhere close to what it will beputting out miles later but still the car packs a terrificpunch for a turbocharged machine it is very unusual in that itencourages lazy driving ie low revs high gear it is sosupremely flexible that one could hardly believe that theres only liters of displacement to move this pound car around in such afashion with maximum torque available at rpm and a rpmredline the car can pretty much be left in third all day whichtranslates to a speed range of something like mph achracteristic that one normally associates with large capacity vsthe technical achievement is breadthtakingthrottle response is right up there with a good atmospheric engine infact it would even put peaky multivalve engines to shame downshiftsare almost unnecessary it is more fun to use the overboost featurethan to rev the engine for those not familiar the s engine featuresup to seconds of additional turbo boost for passing sort of likelighting up the after burners in a jet fighter one could with theright foot only in third gear blast the car from to in just afew moments simply by flooring the gas as far as the numbers gomaximum torque available in overboost mode shoots up to about lbft incredible for a liter it takes a few moments for it todevelop overboost but it is well worth waiting for since this is quitea heavy car ones body parts are not flung around like say the corradovr the acceleration is smooth and strong somewhat similar to ridingin a jetliner as it accelerates down the runway on takeoff also oneis treated to a very distinctive and entertaining whistle from theturbo the only entertaining sound to come out of a veryrefined but bland sounding bangeryes audi has refined the to the point where at rpm it sounds asserene as it does at the smoothness is outstanding but not quiteup to the standards of a very good eg a valve bmw id say thatin terms of refinement ie willingness to rev smoothness lack ofharshness under full acceleration it is better than many vs howeverlost in the refinement process is the characteristic cylinder barkthat made the older engines so characterful if not terribly refinedthe valve turbo sounds pretty bland except for the whistle underfull boost subjectively id rate the vw vr engine as being far moremusical than the turbo also audis own v is also far more musicalwith a rorty race car growl when pressed though none of these canmatch its gruntthe only hint of the engines true capacity occurs when one is takingoff from rest after the turbo has come to a near stop with the extrainertia from the permanently engaged wd system one has to be somewhatdelicate in feeding in the clutch to prevent an embarassing stall alternately one could use more revs in both cases a very small priceto pay for such a fantastic engine i think that audi of america shouldoffer an automatic option for this car just as they offer though inextremely small numbers a speed for the much peakier v thecharacteristics of the engine are perfect for an automatic ironicallyin europe a slush is available but none is offered for the land of theslush marketing twits rearing their ugly heads again chassisive noticed that audis tend to have very wide wheels and relativelymodest tire widths the car comes with firestones of size zrwhich is not uncommon at all however the very attractive spokewheels are no less than inches wide so there is no sidewall bulgewhatsoever combined with the flared wheel arches the s has a mouthwatering macho yet subdued look on rough concrete it becomes immediately clear that the new bodystyle has made significant advances in structural rigidity as well asroad noise suppression i suppose the two are interrelated but idigress to use a cliche the ss body feels like it has been carvedout of stone flex is totally undetectable even when going over roughroads with a super rigid body like this stiff springs and stiff dampersdo not cause excessive harshness and while the ss ride quality willnever worry a lexus it will also not draw comparisons to trucks orpony carsthe servotronic steering has already been mentioned i consider it tobe inoffensive because it did not inhibit spirited cornering i wasable to test the cars cornering powers without too much trepidation ithink a new concept is at work in this car with its fat gumball tirestalking about understeer or oversteer is practically meaningless on abanked highway on ramp i went in slow and started applying power as iwent around i could feel the g forces build to the point where theskin on my face was being tugged sideways yet the car was totally andcompletely obedient to throttle and steering inputs it felt that thelimits were not even close to being approached the g forces werethrilling but the entire affair of going around a curve is strangelyuninvolving you tell the car what you want and it does it end ofstory i think that i am starting to relate more and more to thosereviewers who were highly impressed by the honda nsxs clinicalefficiency but were unable to fall in love with the carthe brakes have a very good firmness to them and stop the car prettywell too though ive read that they are prone to fade i am not toosurprised since the s does not have uprated brakes over the base audi fwd harder pads would help but that in turn would lead to a morewooden response when cold i am starting to see a trend among theluxurysports sedan makers where extra weight is not being offset byadditional braking capacity the lss fade performance is nothing tobrag about neither is the qs or the legends brake fade these daysseem to be a forgotten virtue when everybodys attention is focused onantilock capability comfortfor a car with such sporty abilities its comfort levels are alsoexcellent the cabin is beautifully appointed with carbonfiber panelinserts in place of the wood trim of the s all the expectedgizmos are there heated seats power seats seat memory power thisand that the glaring ommision was the trip computer which was removedbecause audi hasnt gotten it to work reliably yet that means that thecar has no boost gauge a real disappointment taking into account howmuch the turbo dominates its performance unusual for the germans the s comes with a honda style moonroof aswell as the very intelligent dialasunroofposition rotary switchnoise levels including engine and tire noise is so low that i wouldntconsider the lexus advantage in this area to be significant enoughto sway a potential buyer conclusioneven though few will be able to afford an audi s at its sticker priceof k the car is a bargain if one takes into account what it has tooffer over the competition the valve turbo is a real gem even ifit doesnt produce ferrari sounds no other luxurysports sedan makeroffers the utter security of quattro all wheel drive which to some isworth the extra money all by itself the safety features are also top notch side impact standard compliant the very elegant automatic seat belt tensioners and the dual airbags the seriesaudis have been outstanding in government crash tests it gets mythumbs up for being so overwhelmingly capable rather than beingall out exciting and intoxicatingeliotfrom jmhhoppervirginiaedu jeffrey hoffmeistersubject re houston auto insurancein article aprcheshireoxyedu colellocheshireoxyedu robert colello writeshello i am moving to houston to go to rice university for graduate schooli will be living on the corner of s mian and university blvd i waswondering what kind of liability rates to expect here is the releventinfo sex male age status single commute none walking car ford crown victoria doorif anyone can check the above info or is in a similar situation pleaseemail me the rates they find out or pay thanks for your help in advancecolellodelphicomcolellocheshireoxyedumy suggestion look at your current insurance card there will be a name accross the top telling you which insurance company you are insured bycall information in houston and get the number of a branch office in the houston area call the insurance companyyour rates will vary depending on the amount of coverage you wantdo you want to carry comp and collision probably not on an what your driving record is you mentioned none of these things in yourposting so how can anyone give you accurate informationlike i said pick up the phone and make a few calls it wont kill youjefffrom jkjecwestminsteracuk shazad barlassubject re service indicator of a bmwderekthere is a tool available to reset the service indicator on bmws but the lightswill come back on after weeks the tool is in fact illegal in europe atleast it is often the case that the unsuspecting punter trots off to buy a used bmw and a few weeks later all the lights come on other than that i know of no other tool anyone else about changing oil every miles thats ok on newer audis they only require it after every miles i am talking about an oil changejust a query do you drive your car very very carefully like no sudden acceleration etc if yeah then the m oil change seems quite reasonablebut if you drive kinda fast id get a bit up tight abot that thingya point to note just because the first light came on at k doesnt meanall the others will come on every k tooshazfrom jkjecwestminsteracuk shazad barlassubject re mr noisy enginejust a quick note on the nwe shape mrs in the uk when they first came out here there were models the base model had an auto box and engine from the camry well i recentyl found out that this model is no longer profitable for toyota and have since scraped it ive alsonoticed that auto mrs have depreciated a lot more than the next model upsurprise surprise huh oh you lucky americans have the turbo mr no such luck over here shazfrom sjcostanmagnusacsohiostateedu scott j costanzosubject re rfi art of clutchless shifting i used to drive a truck a few years back i once rode with an old codgerthat had been driving for about yrs the only time he would use the clutchwas to get the truck moving he could shift that speed lightning quick upor down without the slightest rake of a gear he was as smooth as silk it wasthe most amazing shifting demonstration ive ever seen having said all that i still dont know why anyone would want to shift a synchronized tranny without aclutch why do itfrom rickposmsaustxus rick kirchhofsubject re ac service ripoffin article aprchpcutexasedu ivabchpcutexasedu albert wu writesi went to a place called american car care centers to check my car for acleak after checking i was told that there is a leak in the compressorseal at the end in addition to the labor for the check i was charged dollars for a pound of freon although they evacuated my ac afterwardsbecause of the leak first is it fair for him to charge me for a pound offreon plus tax second what can i do about this if this is unfair albert wufor the information of those not lucky enough to live in the city ofaustin tx if an auto ac system is checked and found to have leaksit must be repaired at that time or evacuated this is an ordinanceunique i think to the city of austinfreon is subject to increasing taxes but is about x cost hererecovered freon is not required to be purchased from the car it iswithdrawn from as a matter of practice some shops here are charging a recycling fee that is less than the cost of the freon removed if it is reintroduced to the systemjust another quality service from an enviornmentally conscious city rick kirchhof austin texas experience is what youdomain rickposmsaustxus get when you dontbang path cfiorgposmsrick get what you want from bswutrcutccom bruce s winterssubject re warped brake discs on taurus lin article apradvtechuswestcom joeadvtechuswestcom joe thielen writesxref sunx recautos miscconsumersnewsgroups recautosmiscconsumerspathsunxactcnewspsinntppsinntpuunetwupostzaphodmpsohiostateedumagnusacsohiostateeducsncherokeejoefrom joeadvtechuswestcom joe thielensubject re warped brake discs on taurus lmessageid apradvtechuswestcomsender newsadvtechuswestcom radio free bouldernntppostinghost absorakaadvtechuswestcomorganization u s west advanced technologiesreferences aprbcrkabnrcadmerrill aprrynmrodeccomdate wed apr gmtlines in article aprrynmrodeccom balsamostarglenetdeccomantonio l balsamo save the wails writesfrom dmerrillbnrca dana merrillsubject re warped brake discs on taurus l anyone else had the same problem well i have an taurus gl apparently they still havent fixed the problem with the rotors ive got k miles on the clock and im getting the rotors and pads replaces tonightat my expense of course tonyi owned a ford mustang that had endless brake problems the badthing was that it had all other kinds of problems too spent monthsin the shop in the first years i owned it bought new so i gotrid of it and will more than likely not buy a ford product in thefuture the thing that really ticked me off was how ford treated methey were such jerks it was unbelievable joein the past few years i have owned mustang gts and now own a tbird sc they all have had this problem there was a recall on the tbird for the brake problem the ford dealer replaced the rotors and pads but the rotors warp after about k miles between this problem and the fit and finish problems on the tbird ill never buy a ford again bruce s wintersbswutrcutccomunited technologies research center e hartford ct usa from scottpsyuwaozau scott fishersubject re manual shift bigotsjahonencclutfi jarmo ahonen writeskissaneblackberkeleyedu john g kissane writesas a matter of interest does anyone know why autos are so popular in the us while here in europe they are rare just wondering many cars sold here in finland are small and cheap cars at least whencompared to other cars note that we have over car taxand you couldnt expect a good auto mated to a l enginemost of the bigger cars are however sold with autoshere in australia most cars are manual privately owned anyway whynot sure i think it has something to do with the fact that our car industryin the past was more closely aligned with europe than the us in the pastnow its aligned with asiascottscott fisher scottpsyuwaozau ph aus perth local ndepartment of psychology w euniversity of western australia perth s e snedlands perth wa v joy is a jaguar xj with a flat battery a blown oil seal and an unsympathetic wife km outside of a small remote town am on a cold wet winters morningfrom jgossgaiatorolabibmcom jeff gosssubject re honda clutch chatterin article hpinddacuphpcom jimbhpinddacuphpcom james bruder writes from jimbhpinddacuphpcom james bruder date wed apr gmt organization hp information networks cupertino ca path eclipseyktnewswatsonibmcomhawnewswatsonibmcomnewsgatewatsonibmcomnewsansnethowlandrestonansnetuscsddhpcomhpscitschpcomhplextrahpcsshpinddajimb newsgroups recautos lines anyone else experiencing a similar problem this concerns the clutch on a honda accord speed when the clutch is first used in the morning about the first miles of shifting there is a significant amount of clutch chatter until things warm up then the clutch shifts smoothly this chatter started when i moved to the san francisco bay area from a lowhumidity environment the dealer stated that this is known to happen since honda changed from an asbestos to nonasbestos clutch material no remedy seems that moisture on clutch surface causes slipping until the moisture evaporates any comments out therei have been having problems with a slightly different clutch problem onmy prelude see recautostech for more detail my problem is a falseengagement point below the actual one it also seems affected by weather it is most noticeable and annoying on damp or cold days my dealer sayshe cant reproduce the problem i think ill just sell the carjeff gossfrom glouieoasysdtnavymil george louiesubject re nissan nomenclature was re manual shift bigots wantedin recautos grahamtphantomgatechedu graham e thomas writeswhat we currently know as the sx is known elsewhere as a sxgraham e thomas blah blah blah blah blahthis is kind of interesting i always assumed that the sx was namedbecause of the liter engine which it uses likewise for the sxwhich uses a liter engine isnt this truegeorgefrom steven ritter sroandrewcmuedusubject re pennsylvania insurance limited tort optionin my opinion the limited tort option is the best thing casey has everdone basically limited tort means that you give up your right to suefor pain and suffering unless one of the following conditions is met your medical bills resulting from the accident exceed x where x issome number like im not sure of the exact number the accident was caused by a drunk driver i mean the other driverwas drunk you get a good lawyer and have a good case basically you can appealto regain your right to sue but theres almost no chance of this everhappeningyou are only giving up your right to sue for pain and suffering you canstill sue for medical costs actual damages etc by agreeing to limitedtort you are essentially giving up your right to be an asshole whotreats every accident as an entry into the litigation lottery inexchange you get a substantial reduction in your rates i saveyearunfortunately the insurance companies have managed to scare and confusepeople so much that only about of pennsylvanians go for limited torti guess thats ok if more people opted for it the insurancecompanies would be pushing harder for repealfrom daniel u holbrook dhqandrewcmuedusubject re what car is thisthe bricklin was a car manufactured by a company started by malcolmbricklin who i believe was canadian he was the first one to importsubarus and later was responsible for importing yugos i believe anyway he had this idea that what would really sell would be a sportscar but one incorporating a bunch of innovative safety features thebricklin was built to be that queerest of beasts the safety sports car if any of you remember the early s movement among car makers todesign experimental safety cars you will recognize the generalappearance of the bricklin big ol bumpers etc anyone recall othersafety features the engine was an american v ford i think is rightpersonally i kinda like the way they look and if i remember from theold magazine articles the performance was only halfbad the choice ofcolors though tended towards the s lime green yech but highlyvisible i suppose the delorean on the other hand was a dog nice looking imo but nomotor at all dandhqandrewcmueducarnegie mellon universityapplied history i have standards if you dont like them i have others grouchofrom dwjzbnrca doug zolmersubject re honda clutch chatterin article hpinddacuphpcom jimbhpinddacuphpcom james bruder writes anyone else experiencing a similar problem this concerns the clutch on a honda accord speed when the clutch is first used in the morning about the first miles of shifting there is a significant amount of clutch chatter until things warm up then the clutch shifts smoothly this chatter started when i moved to the san francisco bay area from a lowhumidity environment the dealer stated that this is known to happen since honda changed from an asbestos to nonasbestos clutch material no remedy seems that moisture on clutch surface causes slipping until the moisture evaporates any comments out therethe clutch on my honda civic exv ex in the us does this tooits annoying now that i think about it is worse when the humidity ishigh the dealer also claims theres nothing they can do since the clutch is a selfadjusting hydraulic design yeah right doug zolmer internet dwjzbnrca disclaimer my opinions onlybellnorthern research ltd ottawa ontario canada dept n service control point routing services design conform moooofrom klfdruwaattcom franklinklsubject re warningplease readin article csribahconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writes in article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writes anything if he hadnt emptied his gun into the asshole texasits whole other country that reminds me of one of texass adsyou hear a guy speaking in french like its a letter home then the french moves to the background and a frenchaccented voice come to the foreground talking about how he went walking on the beach and it felt so much like home that he decided to take his shoes offand the rest of his clothes it ended with please send bail on an recautos note does anyone carry a gun on them or keep one in their car which is bad idea isnt it if you work in a bad part of town or regularly go through one is this a loaded question i normally have an unloaded colt delta in my glove box with a loaded magazine handy which is perfectly legal in oklahoma for those times that im travelling interstate i keep an unloaded sw magnum revolver in the glove box with a speedloader in my pocket which is legal everywhere under federal law illinois state police be hanged as ive said before this is stricly for defense my insurance will pay to replace my car but i only have one life james carrying a pistol loaded or unloaded in the glove compartment isconsidered carrying a concealed weapon in colorado and is illegal withouta concealed weapons permit unless the law has been changed recentlycarrying a weapon openly is legal in colorado but concealing it is illegali read a newspaper account last year where police stopped a car on atraffic infraction and observed a magnum revolver sitting on theseat the driver could not be cited for possessing or carrying the weaponbecause it was not concealed the article stated that if the gun hadbeen discovered in the glove box it would have been considered a crimeken franklin they say theres a heaven for people who waitama and some say its better but i say it aintgwrra id rather laugh with the sinners than cry with the saintsdod the sinners are lots more fun yknow only the good die youngfrom ckauxacsouiucedu oriolefanuiucsubject re what is the deal with bluebook value of an autonewtonconvexcom vicki newton writesi am in the process of buying a new auto i havent decided yet whetheri should sell my current car myself or trade it in as part of the newauto purchasei know that the blue book value for the car is an acquaintencehas offered to give me blue book value for the car i am just wonderingif this is a standard measure for negotiating a resale price or if ican hope to get more money from someone else what exactly is blue bookvalue based on i know that for its year my car has low mileage it is in excellent working condition but does have a fewdings on the exterior nothing major do any of these facts alter thefair selling price of the car i am not looking to rip anyone off ijust naturally want to get the best price for the carthanks a millionveeki think the blue book is the nada handbook for used car prices nois the blue book value given the retail or wholesale value the blue book value isnt set in stone though low milage extra addonsand stuff like that there can increase the resale price of the car youmay want to head on over to the local library or borrow your friendsblue book and read up on that sort of stuff i paid under bbretail for my civic in and it was in perfect condition andhad only k miles on it the guy was desparate to sell new kid onthe way etc but it was a good price remeber both you and the buyer if he has any sort of brains at all are using the blue book soyou should pick a fair price chintan aminllamauiucedu chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom fowleresmlsungatechedu c b fowlersubject re what is the deal with bluebook value of an autoin article aprnewsengconvexcom newtonconvexcom vicki newton writesi am in the process of buying a new auto i havent decided yet whetheri should sell my current car myself or trade it in as part of the newauto purchasei know that the blue book value for the car is an acquaintencehas offered to give me blue book value for the car i am just wonderingif this is a standard measure for negotiating a resale price or if ican hope to get more money from someone else what exactly is blue bookvalue based on i know that for its year my car has low mileage it is in excellent working condition but does have a fewdings on the exterior nothing major do any of these facts alter thefair selling price of the car i am not looking to rip anyone off ijust naturally want to get the best price for the carthanks a millionveeka dealer will make money off you in three ways if you let him new car markup over his cost remember his holdback arranging financing through the dealership and screwing you on the tradekeep the deal with the dealer simple by eliminating buying a car at dealers cost is meaningless if he makes on the trade andor gets a kickback from the bankblue book you need to know if youre talking average wholesale or average retail is a good guide to value for a car if you are selling it yourself try to get average retail and chances are youll have done okbe careful selling to acquaintances if you ever want them to become friendsc b fowler gtriesmlchrisfowlergtrigatechedufrom orscholzcipinformatikunierlangende oliver scholzsubject pontiac option codes wanteddoes anyone have a listing of pontiacs threeletter option codes andwhat they meanthanksoliveroliver scholz dgnemgraduate student of computer sciences at the university of erlangen germanyyoure killing me peg oh shut up al like i care from rjwaderainbowecnpurdueedu robert j wadesubject re thoughts on the vw corrado vrin article aprgalileoccrochesteredu jgbuhuraccrochesteredu outatime writesi was curious as to what people thought of the vw corrado vrthats about itoutatime it hauls butt handles nice but is junk i drove a brand new one for a dayas a loaner the key was already rustingseems they stamp their keys outof potmetal all the controls seemed really junkclutch was heavydoor locks power buttons sunroof controls etc seemed really cheapno way i would pay k for this baby no airbag either i also drove a svxfor a daystickered at k but going out the door for ka much betterbuy imo although it is more of a sports touring couperoomy etcthe corrado is more of a small sports car the ergonomics and leather in thesvx was twice as nice as the corrados both had smooth strong enginesfrom scheerfawuniulmde tmsubject marten problemshi everybody well i dont know if this is a known problemto you in the big state but over here in europeit is in some places it just happened to me and i payed a lot to get my new honda civic repaireda marten choose my car to stay one night in and thisdamn little animal damaged almost everything whichwas plasticrubber i never thought that these little could do thatmuch damageso to all you car owners out there is there a good known method of gettin rid of this animal except for waiting all night long beneath my car with a gun help in any form would be appreciated very very much email scheerfawuniulmdethanxxxx yall from rjwaderainbowecnpurdueedu robert j wadesubject geico annoyanceif you want to annoy geico call them upgive fake namebut real car specsget a quote and then tell them they are more expensive than your current state farmallstate insurance they will still send you quote etcthen you can tear up their quote and stuff it in the prepaid return envelope and mail it back to them actually they were more than my currentstate farm ratesfrom blfapollohpcom barry frishbergsubject re best radar detector valentinefrom article aprsequentcom by troysequentcom troy wecker earlier i commented on the valentine and jimfcenterlinecom replied about the value of the units bogey counter i didnt really go into why i called this feature a gimmick so here is more explanation thanks jim for the good comments and opinion from what i understand the valentine can only tell if these microwaves are coming from the front rear or both there are only two antennas if they are coming from both this in interpreted as a side bogey bogey counts are determined as sources by their relative strength to one another even if they are reflections of the same source it sounds like your analysis is based on hypothesis and notactually using the valentine id like to give some feedback based onreal life experince i keep the valentine in advanced logic modeand it rarely lights up as a christmas tree the only time it doesis when i am in the middle of a major shopping area and then it makessense that is does since there are sources coming from many differentdirections i have found the valentine to be consistent in itsreporting of bogeys regardless of any moving cars in the areai have found the directional indication to be very useful in one casethere was two radar traps set up within one mile of each other as ipassed the first radar trap the direction indication changed thenthe detector was set off again pointing in the forward direction withother radar detectors i would have assumed that this was due to a reflectionbut with the valentine i knew there was a high probability that therewas another trap and there wason other occasions the directional helped discern a false alarm froma true alarm for example as i pass a source the direction indicatorchanges the directional also allows me to focus my attention as to wherethe signal might be coming from instead of having to look all over the place when a car is approaching me from the rear with a detectorthat leaks i can tell that the signal is coming from the rear and as thecar passes me i can verify the source with other detectors i wouldhave been unable to do this and would have had to assume that there was a radartrap when there was noneive had the valentine for several months now and find its added featuresto be useful and not gimmicks barry barry frishberg blfapollochhpcomchelmsforduk expert center tn chelmsford ma from jason m roth jrqandrewcmuedusubject re its a rush was re too faststill its amazing in germany you can have cars traveling mph and mph on the same to lane road around washington dc they cantkeep traffic flowing at germans are just more organised you cant blitz all of europe in amatter of what months unless youre pretty organised if we triedthat thered just be a whole bunch of tanks backed up at the borderwaiting for some jerk in the right lane trying to get over to make aleft turnthis of course caused germany to invade belgium one of the importantlessons of history is that anything including late afternoonthundershowers will cause germany to invade belgiumdave barryhappy motoringjmr sl bluegreenhes the most inventive asshole ive ever met he really puts a lot ofenergy into itfrom rmakaremuscedu total strangersubject help with mitsubishi galant gs transmissionhii need your help with a problem i have with a mitsubishigalant gs transmission the car has a speed manual tranmissionsince the car was bought new while shifting from nd to rd unless i do it slowly and carefully it makes a popping or hitting soundthe dealer and mitsubishi customer service reached by an say this is normal for the car is itand about a year ago at kmiles the stick shift handle got stuckwhile attempting to put it in reverse the shifter would not budge the clutch had no effect the front tires would not budge even when the clutch is fully depressed if the clutch is released the engine would die assuming that some gear was engaged while the shifter was stuck i could not make the car move it acted as if it were in neutralexcept for dying when clutch is released i finally was able to release the shifter by having someone rock the car back and forth less than an inch while i depressed the clutch and jiggled the shifter the shifter acted normally after thatwhen this happened i took it to the dealer they checked the clutch it was ok they checked the transmission it was oki had the exact problem a couple of months ago and again lastweek the dealer says there is nothing they can do because mitsubishi the says they have never heard of theproblem and the dealer could not reproduce the problem whilethey had the car in all three occurances the car was parked head first in a garageand since the front wheels were stuck the car could not be towedto the dealer before releasing the shifter hence temporarilysolving the problem and the dealer and mitsubishi refused tosend someone to check the car while it was stuck i know there is smething wrong with the transmission shifting from nd to rd and getting stuck at random but i cant get the dealer to fix it i need your help with the mechanical problems and with how to handle mitsubishi all hints and suggestions are greatly appreciated and sorry tobore you with the long postthanksrabihfrom jafomirandaaccumcom sean reifschneidersubject re choice of gaugesin article cyboeivcdhpcom dmunroevcdhpcom dave gauge writesif you had free reign to design your own instrument cluster whichgauges would you choose to have beyond the basic setturbo boost is necessary if a turboed carfuel reserve warningcoolant level warningit would also be nice to have a gauge that would cycle across the differentsensors in the fi system such as o sensor altitude air flowid love to get tranny and diffbrake temp would be greatand a big ass tach sean from the labs of balderrama mitchell reifschneider and wahlstedt incsean reifschneider ruler of the realmjafoaccumcomfrom gwmsplsplloralcom gary w mahansubject drag coefficientscould someone explain how to make sense of drag coefficients ie cd mentioned in magazines i understand that lower numbers signify better aerodynamics butwhat does this mean in the real world is there a way to calculate new top speedsassuming the car is not rev limited at top speed or mileage benefits if a identical car had the cd reduced from to thanxfrom jkjecwestminsteracuk shazad barlassubject re alarm systems are they worthwhiletalking about car alarms there are certain cars in this country that are only insurable if they are fitted with a vecta alarm were talking coswothsand porsches and stuff just before they the insurance companies decided to make this move they insisted that the car be fitted with a scorpion alarm now theyve changed to the vecta so everyone whos spent on fitting the scorpion alarm have founbd themselves having to upgrade to the vecta systemsad huh shazfrom jkjecwestminsteracuk shazad barlassubject re comparing saabs bmwsi dont know about saabs but whenever there is a long temr tset in a magazinethey always say that tehyre are little annoying niggles which keep on occuringevery so often i wouldnt expect that from such a quality car why doesnt anything like this ever happen on bmws maybe coz theyre qualitycars shrugs repentently shazfrom jkjecwestminsteracuk shazad barlassubject re lexus and infiniti yeah and bmw e has litres btw can someone out there please tell me how to put someone elses file on and then reply to that so the other persons file and my own reply goto the newgroups together ps just mail me personally thanx in advance from chucklampmangstrfgatechedu chuck lampmansubject re warningplease readenough already lets take this discussion to some other newsgroupthats more appropriate most of us are tired of it and would like to get back to old cars imhochuck lampman chucklampmangstrfgatechedufrom mccullocspsldsloralcom thad mccullochsubject re autos dealerin article aprporthosccbellcorecom tvlprefectccbellcorecom lamthanh writesi got a price quote of for a camry v wabs from a toyota dealer in eatontown i came back to that dealer in two weeks to sign a purchase agreementthen i was told that the salesperson made an error in pricing i walked out of that dealer i wonder if this kind of practice is common with toyota dealers is the price quote written on the salespersons business card bindingi would appricate any commentsi had a similar experience we had a written quote which had been mailedto us from the salesman at one of these nohaggle toyota dealers fora camry xle wabs leather etc the price seemed fair but when wewent in to take them up on their offer they discovered that certainextra cost items hadnt been included in their original written quoteit would have totaled an extra and in spite of the fact that wehad a written quote they said there was nothing they could dobottom line quotes from salemen are worthless and it appears to me thatthe toyota dealers think theyve got such a superior auto that theydont have to deal we walked went out and bought a new lh careagle vision tsi and i dont regret it one bitthad mccullochmccullocmailldsloralcomfrom guoacusoncom xiaocong guosubject re toyota land cruiser worth ittvervaekcolhpcom tom vervaeke writesmy wife and i looked at and drove one last fall this was a modelit was wayyyyyyyyy underpowered i could not imagine driving it in themountains here in colorado at anything approaching highway speeds ihave read that the new models have a newer improved hp engine im quite serious that i laughed in the salesman face when he said onceits broken in it will feel more powerful i had been used to driving ajeep l hp engine i believe the s land cruisers land yachtswere l the sames as the runner which is also underpowered in myown personal opinion they are big cars very roomy but nothing spectacular tom vervaeke email tvervaekcsitchpcom hewlett packard co phone i love animals they taste delicious the land cruiser has a l engine which has hp and torgue when i drove it here in california power is more than enough the high price is the only reason i did not buy itfrom natarajartsgmotcom kumaravel natarajansubject re dirty dieselshhdharveygtecom horace dediu writesin article natarajaopal natarajartsgmotcom kumaravel natarajan writes i heard the diesels are considered cleanerburning than gas engines because the emit less of carbon monoxide hydrocarbons and oxides of nitrogen co hc nox but they can put out a lot of particulate matter i heard something about legislation being discussed to clean up diesel emissions is there anything in the works to install scrubbers for diesels how about the feasibility of installing them on trucks and cars would it be any different than a catylitic converter id assume easier since were removing particulate matter instead of converting gasses lets hear peoples opinionsthis really bugs me the emissions of diesels are the cleanest of any vechiclebut they are considered so polluting that they are banned in passenger carsin california what a bunch of crap diesel is the fuel of choice for enviromental benefit in europe while here its illegal for the same reasonthe particulates are nothing but carbon they are just an annoyance at worstnothing beats the diesel cycle for efficiency and emissions torque or enginedurability its also cheaperjust to clear things up as to why i posted the question that wayi was debating with a coworker about diesels i claimed they werecleanerburning than gas engines he said the extra junk put out by themwas offset by the savings in greenhouse gasses i made all the same claimsyou did but one question of his was what about the carbon i said itwas harmless but he wanted to know how to get rid of it i suggestedscrubbers i figured it would be no harder or more expensive to installthan cats does there exist any designs for a scrubber id liketo know just to answer his final question i convinced him that dieselsare cleaner otherwisebtw i named my subject dirty diesels because i knew it would get a reactionout of people who knew they were cleaner than gas engines and that theydread it vel natarajan natarajartsgmotcom motorola cellular arlington hts il from smorrissumaxseattleuedu steven a morrissubject re v v v v vxremove legend from the v list its a steve morris ma internet smorrissumaxseattleueduaddiction studies pgm uucp uwbeaveruunetgtenmcdataiosumaxsmorrisseattle university phone dept or directseattle wa from johnkopelsecondsourcecom john kennedysubject diatribe on ussold opels was re opel ownersgibbonsafrasersfuca darren gibbons writesim looking for information on opel cars now you ask which modelwell the sad truth is im not entirely sure but its a twoseaterwith rollover headlights hard top and really sporty looking myfriend has one sitting in his yard in really nice conditionbodywise but he transmission has seized up on him so it hasnt runfor a while does anyone have any info on these cars the enginecompartment looks really tight to work on but it is in fine shape andi am quite interested in itthat would be the opel gt sold in this country from to it originallyhad a cc engine which was later replaced by the cc it was basedon the old kadett drive train and suspension with leaf springs in the rearand a single transverse leaf spring in the front it looked good but waslimited as a performerthere has also been some discussion in this thread about the manta and othermodels in opel introduced a new line of models the series thatwere also known as model numbers etc these cars had the newercc engine and were available as two and fourdoor coupes a station wagonand a sport coupe known in europe as the manta at the same time therewere two series cars which sold very few numbers that also had the engine but the kadett suspension the sport coupe model was alsoavailable as the rallye r with a blacked out hood tach and fog lightsbut was mechanically the same except for a numerically higher rear end ratioin the sport coupe was also named the manta in the us was the lastyear for the gt in any country both because of the us bumper height regulationsand the fact that fiat exercised an option on the factory that opel was leasingto build the gtsthe series continued in with minor body differences in themanta sedan also called the ascona and the wagon were available withbosch electronic fuel injection these cars also had larger brakes andwider wheels these cars were starting to compete with the buick centurylow price leader of the time and were the last opels imported into the usfrom to cars that sported buickopel badges were still sold bythe buick dealers but were rebadged isuzu imarks the idea was to call themopels instead of changing the dealers neon signsvarious models of the series cars dominated the showroom stock racing of thes in their class and were known as serious competitionparts are still available from a number of sourcesi still have a manta and two sedans and all the trick parts i couldcollect in years john kennedy uunetopeljohnksecond source inc johnksecondsourcecom annapolis mdfrom dandyndatauucp dan everhartsubject honda headrest stuck advice pleasean aquaintence has a accord the drivers side headrest wasaccidentally put in backwards and has jammed according to thedealer the only way to get it out is to spend several hoursdisassembling the seat this is the second time i have heard of thishappening and i wonder whether theres an easier way to get theheadrest back out has anyone else ever dealt with this problemyour advice would be appreciatedplease email and i will summarize if there is interest dandyndatacom dan everhart uunetcamcoflukedyndatadan fax th st sw dynamic data electronics edmonds wa usa rhe rone rike rhe rone rike rhorane astro sings cocainefrom chmilarapplecom michael chmilarsubject re mbenz series vw passatjcorryerasureslccemoryedu jeremy corry writesnew series mercedes benz wagonparticularly i would like to hear about power manual t onlyany comparisons between the saab line and the mercedes would be helpfulif a manual transmission is a must have then the mb te is not inthe running you cannot get a manual transmission in that car in northamerica it seems that buyers here or maybe more accurately thedistributors are not interested in manual tranniesthe line comes with a hp engine all earlier years are hpi have an e with a mere hp and auto tranny and i find thatit has sufficient power for any normal driving situation more is alwaysnice but i cant complaini test drove a saab cse last fall here are my impressions awesome power especially over rpm when the turbo really comes on if you get on the power really hard in a tight corner the frontwheel drive causes it to understeer heavily and then viciously hook into the corner not a desirable handling trait but common in powerful front drive cars the cse is hp mercedes is reardrive so it does not have this problem huge interior and cargo space the most rubbery shifter i have ever encountered i drove a spd it was absolutely numb you might be able to get used to it i dont know i also didnt like its location which was too far down and too far right from the shifters position i got the impression that saab really designed the car for an automatic it was rather noisy engine buzz rattles and creaks mercedes does not exhibit these characteristicsyou should also check out the new bmw touring this is a wagon versionof the i it fits into the class with the te and saabsmichael chmilarchmilarapplecomfrom alanelroyjplnasagov alan s mazersubject re what is the deal with bluebook value of an automail bounced soin article aprnewsengconvexcom you writei am in the process of buying a new auto i havent decided yet whetheri should sell my current car myself or trade it in as part of the newauto purchasetraditional wisdom says you are almost certainly better off selling it yourself if you dont mind that extra hassle having a tradein on a purchasejust makes getting the best price from a dealership more confusingi know that the blue book value for the car is i assume this is retail bluebook there are two bluebook prices one forretail and one for wholesale you really want the retail price if you can get it the blue books also have adjustments you can make for low mileageand extras on your particular car you should look all this stuff up yourselfalso keep in mind that the blue book prices are averages over the countrythat may not apply in your area for example blue book prices are low forcalifornia a better way of finding out how much your car might be worth isto call around and see what its selling for if any used lots have one orlooking in local papers for similar cars and checking out the prices it might be more time efficient to take a small loss rather than hold out for months for the best pricean acquaintencehas offered to give me blue book value for the cari dont know what you mean by an acquaintance but i would make darn surethat i was paid that is cashiers check in full before delivery theresa real temptation when selling to a pseudofriend to be more accomodatingthan you should make sure you get the money and if they hedge about payingin full at the start with a cashiers check or cash then i would goelsewhere rememeber that you can probably sell your car to a used car lotor wholesaler and get wholesale bluebook thats probably a safer approachthan selling to a private party alan mountain dew and doughnuts ameselroyalan because breakfast is the most important meal alanelroyjplnasagov of the dayfrom hhtraushobhouchevroncom tmhaddocksubject re questions about insurance companies esp geicoin article mimsyumdedu davewcsumdedu david g wonnacott writes im considering switching to geico insurance but have heard that they do not assign a specific agent for each policy or claim i was worried that this might be a real pain when you make a claim i have also heard that they try to get rid of you if you have an accident im interestend in determining whether or not these things are true has anyone out there with geico made a claim id be interested in hearing whether or not you were satisfied with the service and whether you then had trouble renewing your policy im also interested in any good or bad stories about liberty mutual or state farm stay away from geico a recent car driver issue has an article about geico giving free laser guns to police departments to increase theyre speed limit enforcement the article also said that if you get a speeding ticket your premium will increase dramatically based on how much over the limit you were if i remember correctly at more than over youll get something like a increase if you have a radar detector you will be denied coverage or dropped immediately one accident claim and you will be dropped after many years with geico my father who had tickets and had made claims had an accident and filed an claim he was dropped immediately since then he has been with state farm for years with no complaints i have been with state farm for about years no complaints travisfrom yavosdosrvgvlunisyscom steve yavorskisubject re mercury villager minivan good buyin article cydwpgncubecom bobncubecom bob kehoe writescuriously and consider these are testvehicles i found the mercury higherin build quality than the nissanthis is very curious being that they are both built by mercury in thevery same factorystevestephen yavorskiinternet yavoivyparamaxcomnexrad integrationphone paramax systems corporationivyland pennsylvaniafrom petebreelofiitedu brent a petersonsubject re drag coefficientsin article aprwdlloralcom gwmsplsplloralcom gary w mahan writescould someone explain how to make sense of drag coefficients ie cd mentioned in magazines i understand that lower numbers signify better aerodynamics butwhat does this mean in the real world is there a way to calculate new top speedsassuming the car is not rev limited at top speed or mileage benefits if a identical car had the cd reduced from to i dont remember the formulas off hand as it has been awhile sincei took aerodynamics and havent used the stuff since the cd is related to the drag force which is what effects top speed andfuel consumption when the drag force on the car or aircraft is greaterthan what the vehicles engine can overcome it has reached its top speedautos of course also have to overcome rolling resistancesince drag opposes the vehicles motion the engine must make up for thatby burning more fuel anyway since the geometery of an auto is rathercomplex the dragpressure coeffiecentetc is either found experimentaly orusing a numerical methodanyway for flow around a cylinder the drag coeff is cd dqr where d is the drag force q the flow velocity and r is the radiusof the clyinder to get a rough very rough estimate you can set r at the carswidth q at the cars speed and knowing the cd find the drag force thatthe car would need to overcome bpfrom chellisnyxcsduedu charles ellissubject re what is the deal with bluebook value of an autoits a toll for insurance companies and auto dealers to rip youoff in case of accident or tradeincharlie ellischellisnyxcsdueducharlie ellischellisnyxcsduedusubject review ford taurus shofrom davidbondscuttinghoutxus david bonds gkoccasionally i have trouble shifting into reverse the shiftergkrefuses to enter the gate and i often grind the synchros trying togkget it into gear ill be watching this carefully in the next couplegkof monthsenter st wait seconds and then go into reverse they use the samesynchros and youll never at least i havent groundemtofit when usingthis technique the cutting edge bbs cuttinghoutxus a pcboard a systemhouston texas usa running uupcbsubject review ford taurus shofrom davidbondscuttinghoutxus david bonds gki hear that tires for this car can get really expensive igkcurrently have goodyear gts that cost the previous owner gkfor fourtry eagle gas wear better cost less lose little handling and arequieter im going to switch to s in my next set with new rimsfitti twists if i can afford em by the time my gas wear outgkis a whole new ritual for me with that fangled pedal also i begangkto wonder how strong that brake really is today i backed out ofgkparking spot today and started to drive away before i noticedgkthe glowing brake light oopsmine is strong enough to not let the car move when its in even if youregiving it enough gas to normally move it in st you might need a brakeadjustmentgkthe drivers power window creaks when closed all the way the samegkthing happens in my parents mercury sable oddly all thegkother windows work smoothlywatch it closely the glass actually flexes from the torque in the motor itseems stronger in the drivers window then the othersgkim liking the interior amenities more and more each day thegkcupholders are greative found the location under the armrest in between the seats to be apain but like having them they moved it into the dash pop out in the model year much bettergki really feel like i dont deserve this car i really cantgkbelieve that i could afford it i got this car ten yearsgkahead of schedule i did the same thing got a black with k miles on it for kin july gkive put together the responses to my questions about the cars asgkwell as other posts with useful information on these cars ill begkposting this in the form of a faq soongrabbed it and archived it thanksgkif anyone is interested in starting a mailing list please speak upgki dont know if i have the resources here at purdue to start one butgkmaybe someone out there doesill be starting one this summer one way or the other current softwarei use dosent support mailing lists but is on the rsn list if not imgoing to upgrade to another package that does have it that is if nobodyelse beats me to it will make an announcement here when it goes up the cutting edge bbs cuttinghoutxus a pcboard a systemhouston texas usa running uupcbfrom rzaaemailspsmotcom jim chottsubject re re toyota land cruiser worth itin article iftccucaboeingcom hovnaniaiftccucaboeingcompaul hovnanian wrote based on my experience with a fj the hardtop jeepstyle model i would definitely give a new model consideration if i were in the market the older models are very well built unless toyota lost its mind i would assume until proven otherwise that the newer models have inherited some if not all of the qualities of their ancestors two major differences in the running gear that im aware of need study my has a solid front axle housing whereas the newer models have independant front suspension the solid axle is theoretically stronger andthe new cruisers do not have independent suspension in the front theystillrun a straight axle but with coils the runner is the one withindependentfront the cruisers have incredible wheel travel with this system more reliable than the newer model but only experience will tell the independant front suspension is no doubt a compromise made to satisfy the typical user who will never need a real utility vehicle the second difference is the type of transfer case used on the newer models im not sure but i think tioyota went to a fulltime wd or allwheel drive system the older landcruisers have a lockup type both have their advantages and disadvantages the up cruiser does have full time wd but the center diff locks inlow range my brother has a and is an incredibly sturdy vehicle whichhas done all the trails in moab without a tow the and later is evenbetter with the bigger engine and locking diffsjim chott toyota wd pickuprzaaemailspsmotcom lemans sport convertibletempe arizonafrom rzaaemailspsmotcom jim chottsubject re toyota land cruiser worth itin article rsbbinnehpcolcolhpcom tvervaekcolhpcom tomvervaeke wrote my wife and i looked at and drove one last fall this was a model it was wayyyyyyyyy underpowered i could not imagine driving it in the mountains here in colorado at anything approaching highway speeds i have read that the new models have a newer improved hp engine im quite serious that i laughed in the salesman face when he said once its broken in it will feel more powerful i had been used to driving a jeep l hp engine i believe the s land cruisers land yachts were l the sames as the runner which is also underpowered in mythe and cruisers run the l straight which only has about hp and lbft of torque plenty offhighway marginal on the highwaythe has a much improved l straight with hp and ftlb torque they are big cars very roomy but nothing spectacularif you take them on rough trails youll see the difference the cruiseris an order of magnitude better in offhighway abilityjim chott toyota wd pickuprzaaemailspsmotcom lemans sport convertibletempe arizonafrom kintergirtabuscedu fireballsubject any opinions on early s toronadohaving had my car die on meengine fire insurance agent saidit was probably totaled i am in the market for a another vehiclei saw a toronado that was within my expected price range and waswondering if anybody could relate their experiences with menamely does it have accceptable powerit has a in it does its being front wheel drive make maintenance difficult one power window and the power seat do not work are theseexpensive items to replace if i do the work myself how long do the engines usually last m now any other experiences good or bad and opinionsthanksryan kinterkinterscfuscedufrom rogerhautodeskcom roger hupfauersubject re too fastdcdsehoustongeoquestslbcom dan day writes in article qhmblarmorycenterlinecom jimfcenterlinecom jim frost writes if the mustang andor sho platform were designed for mph it would come with better seatbelts more supportive seats a stronger passenger compartment cage better brakes a stiffer suspension different tires and a body design that takes advantage of aero effects to keep the car on the ground in other words itd be a rxyeah and then wed pay go with a lx mustang most bang for your buckfrom rogerhautodeskcom roger hupfauersubject grand nationaldoes anyone have one of these that would care to sharesome information on i concerned about the turbo how reliable is it hows the gas milageplease responde to me not herethank yourogerfrom dholtquipeecsumichedu dennis j holtsubject re honda clutch chatterin article aprbnrca dwjzbnrca doug zolmer writesin article hpinddacuphpcom jimbhpinddacuphpcom james bruder writes anyone else experiencing a similar problem this concerns the clutch on a honda accord speed when the clutch is first used in the morning about the first miles of shifting there is a significant amount of clutch chatter until things warm up then the clutch shifts smoothly this chatter started when i moved to the san francisco bay area from a lowhumidity environment the dealer stated that this is known to happen since honda changed from an asbestos to nonasbestos clutch material no remedy seems that moisture on clutch surface causes slipping until the moisture evaporates any comments out therethe clutch on my honda civic exv ex in the us does this tooits annoying now that i think about it is worse when the humidity ishigh the dealer also claims theres nothing they can do since the clutch is a selfadjusting hydraulic design yeah rightone of the reasons i sold my civic vx was the chatterygrabby clutchalthough i dint notice it being any worse in humid weather perhaps becauseits always humid around here i was told by honda that it has to do withchanging from asbestos to nonasbestos linings which began around someone could make some good money selling the oldfashion variety if itslegal to manufacture them these days my feeling is that since many othercar makers do not have this problem that its a poor design or engineeringproblem on the part of honda three things to look out for on all hondaproducts clutch chatter bad brake rotors and rusty exhaust systemsfrom staffordlobbyticom ron staffordsubject re warningplease readin article aprismorgancom sergeiismorgancom sergei poliakoff writesfrom sergeiismorgancom sergei poliakoffsubject re warningplease readkeywords brick truck dangerdate thu apr gmtin article aprvoodoocaboeingcom tommhankcaboeingcom tom mackey writes in article cjoitebcsteccaboeingcom neilbcsteccaboeingcom neil williams writes a reformatory for juviniles a few blocks away they caught the year old that did it they put a cover over the overpass what else could they do execute the juvi on the grounds of the reformatory required attendendence by the rest of the inmates as soon as possible after the incident and a quick sure trial i am quite serious cause and effect nothing else will ever make a dentthis will not work hitleryouth newark teenager car stealing epidemics student riots and other similar cases show that death is not a behaviourshaping or even intimidating factor for teenagers teens defy deathi is a strong deterent to the teens that are executed they wont do thatagain this policy cuts way down on repeat offendersplease do not flame me i dont agree with capital punishment for teensas far as rock throwing is concerned well it is very sad and tragicmost of these incidents stem from the fact that these kids are dumbeven smarter ones completely lack deductive thinking and cant foresee the consequences of their actions beyond immediate onesunfortunately dumbness and cars whizzing at mph make an explosivemixthey are also unsupervised with proper supervision they would not bethrowing rocks if parents cannot provide the minimal supervision neededto stop this activity they should not be allowed to have children notice the smiley however i hardly believe there was intent to kill in most of these casesrather desire to see the shattering glass i admit i was mercilessly attacking moscow busses with a slingshot in my tender years akin toa child breaking toys i witnessed several even more endeavouringprojects like stacking up bricks on a railroad track technicaldetails of such a venture completely dominate the possibility ofa human tradegy heck when you are you have a vague concept ofhuman tradegy in a mind of a youngster im quite sure that technicalchallenge of matching and predicting speed of a thrown stone so that itgets the car smack in the windshield completely occupies the teennot leaving much room for other considerationssergeiron stafford texas instruments incorporated pobox ms staffordlobbyticom dallas texas from akyfnysuedu albion h bowerssubject re v v v v vxsin a previous article smithctroncom lawrence c smith saysin article cvmdkypusenetucsindianaedu mliggettsilverucsindianaedu matthew liggett writesv must be one somewherebelieve bugattis cominghas out one something like turbosand mucho macho hp one cool price too as i heard at any ratethe point is im pretty sure there is indeed one in productiontho rather limitedthis is no bugatti its labeled a bugatti but has nothing to do with the bugattis of yore from what i understand just some ppl wanting tobuild a silly supercar and use that name to sell itdrew may be thinking of the cizeta morodor vt but that hasnt reachedproduction at least not yet as for the bugatti well i have to agreewith matt it aint the top dog it aint sexy and sveltlooking and itaint a real bugatti in fact it looks like its in tight competitionwith the consulier for the most buttugly car of the decade awardit isnt that bad at least the bugatti eb has compound curves comparedto the slab sides on the consulier and the bugatti has a quad turbo vthing of it as three cylinder turbo engines tied together also ettorebugattis nephew is on the board of directors and had a hand in thedevelopment so thats about as much bugatti as you are likely to get intodays world much like enzo ferraris illegitamate son being allowed totake over part of ferrari as well i dont know of any cars with v but there are a number of motorcycleswith them but i couldnt tell you which ones all motorcycles look aliketo me dthats funny i have motorcylclist friends who say the same about cages most gp cc motorcycles are vs and the vf line of hondas were all vsfrom the vff through the vff including the rc race bike andthe present vfrf it should be noted that lancia built a v inrecent history in the fulvia hf a very pretty italian coupe al bowers dod alfa ducati hobie kottke blad iaido nasawell goodness sakesdont you know that girls cant play guitar mary chapincarpenterfrom ejvjvirginiaedu erik velapoldisubject re dirty dieselsnatarajartsgmotcom writes i heard the diesels are considered cleanerburning than gas engines because the emit less of carbon monoxide hydrocarbons and oxides of nitrogen co hc nox but they can put out a lot of particulate matter i heard something about legislation being discussed to clean up diesel emissions is there anything in the works to install scrubbers for diesels how about the feasibility of installing them on trucks and cars would it be any different than a catylitic converter id assume easier since were removing particulate matter instead of converting gasses lets hear peoples opinions vw and mercedes have tinkered with particulate traps also vwuses a kind of turbocharger on their jetta ecodiesel that helpsreduce particulates as well although i dont know themechanics of itmany diesel carsbusses and trucks in europe are now beingequipped with catalysts and traps in an effort to clean updiesel emissions already well below legal limits anywayits a shame gm had to soil the diesels reputation inpassenger cars and prevent further resource devotion toresearch into making this outstandingly efficient engine evenfurther ahead of gas engines in emissionserikfrom bornscepteribmcom christopher j bornsubject re mercury villager minivan good buyin icjpsasuacadbitnet icjpsasuacadbitnet writesmy nissan quest has been doing mpg city though its first few tankswere more like mpg the v and at are remarkably smooth agreed i own a mercury villager and im very impressed with the v andthe at in the past ive been biased towards manualstandard transmissionsi ownedan aerostar with a speed it was awesome but settled with the at in thevillager and have been pleasantly surprised with its performance btw consumers report in their report on the villager alluded to somefunny noises from the at ive been listening for them but havent noticed anythingunusual chrischristopher j bornbornralvmsvnetibmcomfrom akyfnysuedu albion h bowerssubject re drag coefficientsvxsin a previous article gwmsplsplloralcom gary w mahan sayscould someone explain how to make sense of drag coefficients ie cd mentioned in magazines i understand that lower numbers signify better aerodynamics butwhat does this mean in the real world is there a way to calculate new top speedsassuming the car is not rev limited at top speed or mileage benefits if a identical car had the cd reduced from to its pretty complex and cd isnt the whole story either cd for cars isusually calculated based on the frontal area of the car so a large carwith a good cd could get the same drag force as a smaller car with apoorer cd to calculate drag use this formulad rho v cd swhere d is the drag force lbs rho is the local air density slugsftv is the velocity fts and s is the frontal area ft note that thepieces called rho v are sometimes called qbar or dynamic pressurea fancy aero term for air pressure or force note that power isp f vwhere p is power lbffts f is the force drag in this case lbf and vis velocity fts note that if you put the whole equation into one by substituting d forforce you get a velocity cubed term thats why huge increases in powerresult in little increases in speed ditto for decreases in cd so if you have a mph car and reduce cd from to your new topspeed is sound of trumpet fanfare mphsorry to dissappoint al bowers dod alfa ducati hobie kottke blad iaido nasawell goodness sakesdont you know that girls cant play guitar mary chapincarpenterfrom tim nagy tncandrewcmuedusubject ree mgb questionsthe whire wheels arent chromed they were to be painted silvergreythe accelerating from a stop shouldnt be doggy because of the lightweight of the cardont pull the topto make it reach the snaps i pulled a couple out ofthe top doing that replacing the spanps usually doesnt work let itsit in th e sun open on the car for a couple hours the try gentlyi continually blew up the connecting rod bearing be sure your notburing too much oildont expect too much of a smooth ride the lever arm shocks hold theroad and your bladder the are ultraexpensive supposedly the can berebuilt j c whitney sell a shock replacement kit the uses standardshocksi had to rebuid boththe brake and clutch master cylinder in addition tothe clutch slave this work made a world of changesbe sure the carb is the original type replacement my had dualstomberg oil dampenned side draft carbsask if the clutch has ever been replaced to replace the engine andtranny have to be pulled as a unitif you need more i had mine all through hiogh school lots ofmaintenance to use every dayfrom hkonmitedu henry konsubject sunroof leaks im all wetmy sunroof leaks ive always thought those things were a royal paincan anyone provide any insight i know the seal isnt great maybe i could weld the stupid thing shuthkfrom dchanciscocom derek chansubject re service indicator of a bmwin article aprwestminsteracuk jkjecwestminsteracuk shazad barlas writes derek there is a tool available to reset the service indicator on bmws but the lights will come back on after weeks the tool is in fact illegal in europe atleast it is often the case that the unsuspecting punter trots off to buy a used bmw and a few weeks later all the lights come on other than that i know of no other tool anyone else about changing oil every miles thats ok on newer audis they only require it after every miles i am talking about an oil change just a query do you drive your car very very carefully like no sudden acceleration etc if yeah then the m oil change seems quite reasonable but if you drive kinda fast id get a bit up tight abot that thingy a point to note just because the first light came on at k doesnt mean all the others will come on every k too shazshazhmm but the service indicators that i have works this way there are green yellow red indicators initially all green indicators will be on for few minutes when you start your car the computer will actually sense how you drive your car and as time goes by the green indicators will start to go off one by one and then the yellow indicator will turn on and then the red indicator will go on and you should get service when by the time green indicators are off after service the mechanicor you will reset the service indicators and the computer starts counting againso i expect to have a toolor a procedure to reset it so the green lights will come on and the yellow and red lights will go offi wonder how people can do oil change themself without knowing how to reset theindicatorits the first european car i have and changing oil at miles is a surprise to me and its a big plus but i wonder how that could happensince the oil lose its lubrication ability over time i thought its the oil andnot the vehicle that determines how often we should change oilany bmw owner on the net response welcomedps my initial question is how do you seset the service indicator of a bmwderek from herlingcrchhnosubdomainnodomain brent herlingsubject re improvements in automatic transmissionsin article aprwestminsteracuk jkjecwestminsteracuk shazad barlas writes i just wanted to know to wheelspin in an auto you keep the gear in n gas it then stick the gear in d ive never tried this but am sure it works but does this screw up the autobox were having a bit of a debate about it hereah yes the neutral slami know that gm tested the old ths and ths by shifting from reverse toforward gears repeatedly while holding the engine at high rpms the units holdup incredibly well this is also the recommended technique to rock a stuckvehicle out of the mud i think the hydraulics are up to the task but themechanicals of the driveline may object by breaking somethingericy i agree about the durability of the old th trannies from gm while i never intentionally slamed my firebird ci conv into gear i would leave the trannie in low read st grab hold hit the pedal and once the tires grabbed take off when i reached about mph the turbo auto would shift to s read super or nd and leave about to foot of double stripped rubber on the ground most everyone i knew at the time was quite impressed with peeling out at mph the trannie held up just finemotor mounts would last about a year until i tied the motor down with largechains oh yeafyi pontiac ci bored over large valve heads holley spread bore crain blazer cam dont remember the specs positrac hooker headers dual exhaust get this conv leather seats power windows power top ac cruise etc oh yea i also pulled the cocktail shakers weights from the front and removed the lead pellet from the accelerator pedal damn us regulations oh how i miss that car under sec and about to mpg well i dont miss the mpg front wheels off the ground with three quick jabs at the pedal bent pushrods stripped rocker studs every months i really wonder what kind of revs i was turning no tachre improvements in automatic transmissions anyone seen one of these lately id buy it back in a secopen top brentfrom woobindanceeewashingtonedu woobin leesubject re extensionsin article aprericssonse etxmststaericssonse writesi was wondering what the country extension aresometimes i just dont have a clue from wheresome people are writingthese are the extensions i know ofch switzerlandse swedenfi finlanduk ukcom usedu us are both com and edu us fr franceplease feel free to add to this list markusnznew zealandauaustraliajpjapankrkorea woobin lee image computing system labwoobinuwashingtonedufrom kensibcaryitsrpiedu brian c kensingsubject re manual shift bigotsi prefer a manual to an automatic as it should be i believe that automaticsshould only be manufactured for people with physical disabilities who otherwisewould not be able to drive automatic transmissions allow drivers to be lazymore time is available to fiddle with the radio or to look at the sceneryinstead of concentrating on the road the manual transmission keeps the drivealways doing something granted it isnt a large movement plus driving shouldbe fun driving a manual is fun driving an automatic is a chorein the case of shift speed automatics can be made to shift far fasterthat any human could move a stick if i was racing id want and automatic fornormal driving go with the manualfrom bobcpyramidunredu bob conradsubject re new anticarjacking campaignin article aprfreenetcarletonca aefreenetcarletonca nigel allen writeshere is a press release from the national crime prevention council the campaign urges drivers to remember to lock up roll up andlook around lock car doors immediately after entering or leaving the car roll up windows as far as possible and look around and be alert to avoid situations that are suspicious that reminds me of a blurb in the police blotter in my school paper alongthe lines of police were called because so and so reported therewere suspicious people hangning around the business building turnsout it was two black men leaving the building after doing homework lateone nightfrom ramantranslabitsuciedu balaji v ramanathansubject re plymouth sundancedodge shadow experiencesin article qofeainnnhshelleyuwashingtonedu gaiacarsonuwashingtonedu iwe are gaia writesjust stopped putting money into it i must have put at least worth of repairs over its lifetime i am sorry but lee iacocca can biteme bullshit whoever backs em best is just afraid the stupid things areathe part about spending on repairs reminds meof an article i read in a magazine comparing the year ownership costsof a toyota camry and a ford taurus or something like that the resultwhich they announced with great flourish was that it cost the same at theend of the period that was their argument to prove that you dont gowrong buying the ford taurus over the camrynow if i remember correctly the camry costs about or so morein initial costs essentially it means that you spend about extraon repairs on the taurus that is ridiculous every time your carneeds repairs it is extra hassles loss of time and a dozen other thingsi would much rather spend more in initial costs than spend morein repair costs cut here for signature balaji ramanathan institute of transportation studies i dont believe in luckuniversity of california irvine i rely on itfrom dougsingrescom doug schneymansubject my two cars chevy nova cl and dodge se as you can see i have two cars both worth about eachthe problem is that maintenance costs on these two cars isrunning about per year and insurance per yearwhat am i doing wrongwithin the last two months the follows costs have occureddodge se dodges attempt at the american german car replace head gasket new radiatorchevy nova cl chevys attempt at a japan import tuneupoil changevalve gasketmiddle exhaust pipe miscnote also that the chevy nova cl has only horsepwerdoes anyone out there have a chevy nova with enough powerto get up even a small hill without knocking is theresomething wrong with my car i even use octane gasi have consider going to octane if i can find itanyway what are the best maintenance items to doityourselfand what equipment is needed thanks doug car doug from waynenjfrom arnehedbtihno arne henriksensubject re v v v v vxthe devil reincarnate ssaveolecdaccom wrote i am curious about knowing which commericial cars today have v engines v i dont know of any v legend mr mr v dont know of any v jaguar xjs please add to the list thanks s ssaveolecdaccomfrom tom wetzel twetzelucsindianaedusubject re replacementcustom seats where to getin article aprcoloradoedu jerry bowman bowmanjcsnorgwrites what car are we talking about if its camaro chevellegto nova etc there are a bunch of places to get them a corvette but i dont want to put corvette seats in it the original seats are in exc shape but they are uncomfortable as hell im going to store those and find a set to drive in i have all the vette catalogs but im looking for a more generic type seat i can modify the brackets but cushion height and overall width are a concern ive looked through some local boneyards without success i would just like to find a pair of cheapos to use this summer tomfrom vlasiscybernetcsefauedu vlasis theodoresubject re the mustang you know im a ford fan i must say so im looking forward to the next mustang i have faith that it will be a fine product more desireable than the camaro is now you know thats mho truethats your opinion they beat ford to the market with the camarofirebird but really only in words production of these vehicles will be limited until the end of the year keeping selling prices above msrp for the most part since there are so many twitching camaro fans out there i wouldnt press ford to hurry the mustang since the final wait could be worth it besides no bowtie fanatic is gonna buy the mustang anyway true again i wouldnt take a free mustanghonest the next mustang will be fords highest profile car it attracts way more attention than the camarofirebird because its heritage is more embedded in the general public dont lie to yourself and believe ford will forfeit that fyi they already did too bad that the current mustang cant even compete with the new camaro without using an active imagination right now few cars can compare with the camaro think about it for a car that will out perform all but a few exotics if you are now swearing at me look at the statsthey dont lie there are no comparable cars in its class certinaly not for its price you knowintelligent critical spews like the mustang bites man some of you are already beginning i predict that the mustang and camaro will be comparable performers as usual i also agree this subject is one that will never be setteled except maybe at the track unless the ford gets the v hp romeo you dont seriously believe that it was designed for the mark viii only do you hey can you imagine the potential of a modified lt folks in a few years we will surpass the levels of performance achieved in the late s thats scaryyou ford vs chevy people must live in the planet of detroit or droidlike they say in the airforce with enough horsepower anything will flyi can put a valve v with twin garrets on yugo and get sec qmthats useless its still a yugo that will loose any race on a trackor on the streethave you detroit beings compared the ultralongthrow stick shifts ofthe with the mr turbo or rx i ll buy it in mos or the torsen differential of the rx compared to the differential of the that sounds in every hairpin turn and bythe way and camaro both have drums on the rear breaks hello this is the s vlasis theodoresoftware engineerjust say no to signaturesfrom reillyadmailfnalgov rob reillysubject re changing brake fluidis it necessaryin article aprgmuvaxgmuedu lcarrgmuvaxgmueduwrote hi ive been seeing all these articles about changing brake fluid and i am wondering if this is really necessary i have an toyota corolla sr with and i am in the process of doing preventative maintenance and i was wondering if this was something that i should add to my list of things to do any information would be greatly appreciated i really love this car and would like to keep it for as long as possible thanx lisa sign me only a manual will doamplifying on jeff gosss answer the absorbed water will rust yourbrakelines and master cylinder and calipers and you could suddenly lose allyour brake fluidfrom musicerichtriumfca fred w bachsubject re dirty dieselsin article aprvirginiaedu ejvjvirginiaedu erik velapoldi writesnatarajartsgmotcom writes i heard the diesels are considered cleanerburning than gas engines because the emit less of carbon monoxide hydrocarbons and oxides of nitrogen co hc nox but they can put out a lot of particulate matter i heard something about legislation being discussed to clean up diesel emissions is there anything in the works to install scrubbers for diesels how about the feasibility of installing them on trucks and cars would it be any different than a catylitic converter id assume easier since were removing particulate matter instead of converting gasses lets hear peoples opinions vw and mercedes have tinkered with particulate traps also vwuses a kind of turbocharger on their jetta ecodiesel that helpsreduce particulates as well although i dont know themechanics of it many diesel carsbusses and trucks in europe are now beingequipped with catalysts and traps in an effort to clean updiesel emissions already well below legal limits anyway its a shame gm had to soil the diesels reputation inpassenger cars and prevent further resource devotion toresearch into making this outstandingly efficient engine evenfurther ahead of gas engines in emissions erik i sure dont know what and how they measure in regards to diesel motors in cars trucks and busses but i think they are probably measuring the wrong pollutants or at the wrong time or both i certainly find it offensive to drive behind a diesel bus or diesel truck and some diesel cars they stink and its always rollupthewindows panic time when one comes by or ducks in front of me when i am driving with my family i dont think the combustion mixture is kept under very good control in diesel engines and thats why they stink so the invisible unsmellable pollutants are reduced in diesels yeah well so what someone forgot about the visible stinky kind and as far as i am concerned those kind are just as bad i am all for destinking the diesel vehicles itll keep the traffic signs cleaner too fred w bach operations group internet musicerichtriumfca triumf triuniversity meson facility voice loc wesbrook mall ubc campus fax university of british columbia vancouver bc canada vt a these are my opinions which should only make you read think and question they do not necessarily reflect the views of my employer or fellow workersfrom hhdharveygtecom horace dediusubject re mbenz series vw passatgo with the mercedes if you can afford it i think the wagon starts aroundk although it could be kthere is no comparison with any of the other cars listed horace dediu gte laboratories sylvan roadinternet hdediugtecom waltham ma from mcrosbiebatmanbmdtrwcomsubject re viper car alarmsin article cfrcdocsuiucedu ucsuiucedu ronald e garnett writes hello auto enthusiasts i recently had more car mangled broken into and decided to get an alarm installed its a viper and has a shock sensor sensors for each door ignition cutoff and automatic door locksi have this same alarm installed in my syclone it works great the shocksensor is very sensitive but much more practical than the motion sensor i haveon my other car it doesnt trigger if the car is rocked gently by the windbut any kind of shock sets it off even kicking the tire sets it off itworks great what worries me is the hood and hatch if someone could pry them up gently enough then they could bypass the alarmthe shock sensor is adjustable and there are two cycles on it you can adjustit to be sensitive enough that there is no way you could open the hood withoutsetting off the alarm although i know that you cannot pop the hood on thesyclone without setting off my alarm now and yet i have had zero none falsealarms with this system the alarm tells you when you disarm it whether it hasbeen activated in your absence i have been able to trace every alarm to itscause and it was not a false alarm im also wondering how easy it would be for a thief to crawl underneath the car and cut the battery cable to disable the alarm i guess it would be possible depending on the vehicle my syclone is so tightin the engine compartment that it would be tough to do this there aresupplemental power supplies you can put on with this viper alarm but i donthave one i really think that if someone wants my car that bad the alarmwont keep them from it even with a supplemental power supply viper also sells some fancy field disturbance sensor that supposedly detects people approcahing the car this is primarily for convertibles i have a convertible and have looked atthis feature in detail alpine actually makes a better radar unit if you wantto get one of these it has zones in it that can be shut down independently sothat if one side of your car has pedestrian traffic or something else thatwould trigger an alarm it shuts down the zone or rather pulls it in tighteri dont see the real benefit to these unless you have a convertible that youleave the top down onavoid the voice alarm that can be added to the radar package it talks topeople as they walk by i saw one installed on a lotus esprit the kids wouldtaunt it seeing how close they could get before it warned them to get back the owner finally disabled it which defeats the purpose in my mind im interested in the opinions of you netters about these problems and about the viper in general i am real happy with my viper one other feature i really like is you can tuneit to your preferences you can have it arm passively or not you can disablethe chirp for armingdisarming you can have it lockunlock the doors when thealarm is armeddisarmed i like these features i hate the chirp when the alarm armsdisarms so mineflashes the lights only i like the door lock feature although i have to becareful to take my keys with me because it doesnt know if you have left yourkeys in the car when it passively arms and locks the doors but if you aremeticulous about taking your keys with you it takes care of the rest the car is an ford probe gt that used to be in great shape ron garnett i looked seriously at the alpine system too it is a real nice system butmore money and it has a motion sensor standard instead of the shock sensor the shock sensor is betterand the viper shock sensor is better cyclethan the optional alpine one imho i think the viper gives you a lot of goodvalue for the money but it isnt absolutely tamperproof no system is except maybe the one that james bond had on his lotus in for your eyes only anyone know where we can get one of those installed maybe that was what theyhad in the van in the world trade center huhmerrillfrom leapmanaustinibmcom scott leapmansubject re autofomfomblin a i tried the autofom stuff on my saturn sc and was so disappointed with itthat i returned it for a refund i polished the car for hours and couldntremove the swirl marksthin film that was all over the finish it alsoattracted more dirt than without the stufffrom leapmanaustinibmcom scott leapmansubject car alarms which onebefore we get into another discussion on the relative merits of a car alarmlets go on the assumption that one is desired the question then remainswhich one ive owned a hornet and was satisfied but not enough to getanother for my new car the alpine has been highly recommended but what aboutclifford and vses derringer any others i want all of the standard stuffdoor lock interface starter kill light flash led valet mode passiveactiveshockmotion sensor etc thanks for the advicefrom cstkocrsvdelcoelectcom spiros triantafyllopoulossubject funny car taxes was re market accessin article racfnhagateberkeleyedu robohenocfberkeleyedu henry robertson writeskeep in mind that owning any car in korea is a luxury that only the rulingclass can afford every government agency worth its salt finds some reasonto levy a tax on car ownership last i heard there were seven differentfees to pay to own a car we used to have a tax in greece named after the queens mother the queenleft monarchy was abolished but the tax stucksimilar single purpose taxes have stuck ie to help the victims of the earthquake of xx build the metroobmoralconclusion next time someone proposes a car tax or gasoline taxpromising its temporary it aint spiros spiros triantafyllopoulos cstkocrsvdelcoelectcomsoftware technology delco electronics gm hughes electronics kokomo in i post therefore i armmfrom homicsdcsduwmedu sammysubject changing mt oil on m maximahello again another question i just got my hands on quarts of readline gear oil at a quartnow i need to know how to throw it into my cari own an nissan maxima se any ideascan i mix the oil in there with this stuff or should i drain first thenonly use this stuffif you know where if there is one the drain plug on the manual transmissionon the maxima is i would really appreciate any commentsalso have any of you maxima owners thied this stuff in your carsthanks in advsammyfrom callisonuokmaxecnuoknoredu james p callisonsubject re v v v v vxin article aprolecdaccom ssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars todayhave v enginesv i dont know of anyvs i dont know of any is and flats are abundantv legend mr mra whole htload minivans pickups just about any car above thesubcompactcompact range and below the fullsize range with a fewexceptionsis are much more rare now the only one i personally know of thatsstill in production is the venerable ford cid in the fseries pickupsi think that jeeps big s are also straight sixes but im not abig jeep personv dont know of anywhere are you to not know of vs there are mustangs cadillacslincolns camaros corvettes thunderbirds all real fullsizepickups crown vics chevy mobyhhhhcaprice and even a fewjapanese and european veehickles with vsv dodge viper dodge promises a truck with a vv jaguar xjsdont ferarri and lamborghini both use vs extensivelyjamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom cstkocrsvdelcoelectcom spiros triantafyllopoulossubject re v v v v vxin article aprtelxonmistelxoncom joestelxonmistelxoncom joe staudt writesin article aprolecdaccom ssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars todayhave v enginesv i dont know of anybecause there is no such thinga friend had a ford taunus era early s that did have a v in iti lost a bet on it i find it hard to believe there are no recent carswith a v in them any recent onesspiros spiros triantafyllopoulos cstkocrsvdelcoelectcomsoftware technology delco electronics gm hughes electronics kokomo in i post therefore i armmfrom davebingrescom dave brower dbms hack subject re manual shift bigotsin article aprrtsgmotcom kissaneblack john g kissane writesas a matter of interest does anyone know why autos are so popular in the us while here in europe they are rare just wonderingprimarily milage gas is much more expensive so people are veryconcerned about it taking a few more liters per kilometer thisalong with narrow old cities also results in smaller cars withsmaller engines these engines usually dont have the torque to meshwell with an automatic so having engines that dont work well withautos and a great concern for milage the usual eurocar has amanualnote that not many big benzes come with manuals if youve got themoney for the car youve got the money for the gas and the engine todrive through the slushboxas automatics become more efficient the bigotry is probablyreduced still everyone knows how to drive a manual and cars arecheaper with one and it saves a little expensive fuel so therearent compelling reasons to go automaticdb from jafomirandaaccumcom sean reifschneidersubject re too fastthis whole discussion is just a religous war id rather have a rxthan the mustang l for times the price thats how you explainporsches selling some folks would rather have the stangshrugsean test signaturefrom jkjecwestminsteracuk shazad barlassubject re v v v v vxv anyone anyone heard of a cizata vt its mainly sold in the middle east where they dont have as strict a legislation as in the usa and ecfrom jkjecwestminsteracuk shazad barlassubject re nissan nomenclature was re manual shift bigots wantedthanx craig in addition to craigs coments and to clear up any further confusion the sx of usa was reffered to as a silvia turboin the uk performance figures of uk sx are svmax mphshaz oh one more q you know that new prelude vtec well is there an auto versionin the usa ive heard of them in japan but not uk also do you guys get auto miatasfrom jkjecwestminsteracuk shazad barlassubject emergency brake on opel was nissan maximasince were on the subject of brakes does anyone know why a wd vauxhallopel disengages drive to the rear wheels when the brakes are applied vauxhallboast about how the car is more stable in fwd mode during braking than in wdmode how is this so shazfrom jkjecwestminsteracuk shazad barlassubject re dirty dieselsyeah diesels are cleaner than petrol powered cars they even have catalysts fitted to disels now oh and citroen have even launched the first sports diesel car in the world which is probably true if you assume if its for production purposes mercbenz had a prototype which runs on diesel back in around it did and read this mphshazfrom jkjecwestminsteracuk shazad barlassubject re thoughts on the vw corrado vrin the ec the corrado vr is rated as best handling car this side of a as it goes i just read an article in autocar motor comparing the vr to a ford probe later to be launched in the uk the vr is more powerful even more so coz its instead of in the ec and more fun to driveetc etc but the probe has a slightly smoother engine thanx mazda mxthey sum it up as both cars are fast the vr is a bit more exhilirating to drive but only if youre prepared to work harder shazfrom callisonuokmaxecnuoknoredu james p callisonsubject re extensionsin article romsinnnbkctronnewsctroncom smithctroncom writesin article gfpftjwivqvwyvandrewcmuedu daniel u holbrook dhqandrewcmuedu writesthese are the extensions i know ofch switzerlandse swedenfi finlanduk ukcom usedu us are both com and edu us fr francedk denmarkno norwaycom and edu are both united states one refers to commercial institutionsthe other to mental i mean educational institutions gov is alsopretty much us it refers to government institutions internet was built onthe aarp backbone a us defense contractor network that used the extensioni think you mean arpa aarp is the american association of retired personsand i seriously doubt that theyd want young whippersnappers buildinganything on their backbones what with decalcification and all to identify the type of organisation internet extended the convention forother countries but the us retained the old conventionsthe general convention is that if it doesnt have a country tag on it itsa us site that includescomcommercial edueducational milus military sites govus govt nonmilitary sites eg nasa sitesorganyone who is none of the abovethere are sites with such tags that are nonus sites but they will havethe country extension eg xxxxeduau is an extension i saw todayus sites can also use the us extension but as mr smith pointed out the internet was built on the arpanet backbone and they defaultto us sites if theres no country codei would suggest that anyone who didnt know this or wants to knowmore about it on a nonsystemadministrative level check outthe book thewholeinternetusersguideandcatalog by ed krolor is it catalog and users guide i can never remember and my copyis my desk at home its a very good notnecessarilytechnicalguide to the internet and the various utilities that lurk on it includingusenet i dont think its part of the nutshell series but it ispublished by oreilly and associatesthis should go to one of the news newsgroups but damned if ican figure out which one jamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom jkjecwestminsteracuk shazad barlassubject radar detectors in the ukdid youy guys know that it is legal to own a radar detector but is illegalto use it isnt that a bit like owning a gun but not being allowed to use itmy mate just switches his off whenever the cops are around from edwardsworldstdcom jonathan edwardssubject re comparing saabs bmwsin article rjskbizecsumassedu suriganzerecsumassedu writeshiwould someone like to post a comparative analysis quantitativemeasures hp etc and more so the qualitative feel of how they comparefor the driving feel handling noise responsiveness etc for thesaab s and the bmw seriesany comments on just comparing the with the re handling i take it that the saabs and bmws are comparable for reliability andall thatwould be nice if flaming wars could be avoided andfolks just post their experiences i had a saab turbo and now have a bmw isthere is no comparison for handling reliability or overall quality ofengineering the bmw wins hands down after years i was sick and tiredof the all the little problems and entropic decay of the saab the yearold bmw is still as sweet as it was newbut i see you are posting from western ma bmws suck in the snowi have aggressive snows plus a hundred pounds of sand in the back and istill try to avoid driving in the snow i happily took the saab throughblizzard conditions without a worry i would say this is the single designflaw in the bmw jonathan edwardsedwardsintranetcomintranet incfrom benseoasysdtnavymil ron bensesubject re dumbest automotive concepts of all timein article aprnscclehighedu amhnscclehighedu alois m himsl writesin article aprjpldevvaxjplnasagov nancyhayduke nancy feagans writesashtrays and cigarette lighters these should be an optionyou forget that the cigarette lighter plug is essential for plugging in radardetectors and lights the ashtrays are also essential because they are greatplaces to keep change and tokenswouldnt you rather have some type of standard electrical plug instead of that fire hazard waiting to happen adaptor i know i would and i would also prefer to have sensibly placed cup holders instead of an ashtray my car came with coin holders already built inronfrom adnritvaxiscritedusubject re bmw iin article aprwestminsteracuk jkjecwestminsteracuk shazad barlas writesin article aprultbiscritedu adnritvaxiscritedu writesthe radio does not work untill the car warms up and you honk the horn hahaa hahahah hahahahahahaaaaa i cant stop its killing me hahah i was dead serious when i posted it i actually have an attempt of explanationto this phenomenon but ill keep you guessing i still want responces of which i got exactly mikesfrom ckauxacsouiucedu oriolefanuiucsubject re v v v v vxcbhwindsurfscducaredu cris hannu writesin article aprolecdaccom ssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars today have v engines v i dont know of any v legend mr mr v dont know of any yeah rightthe bmw xx are vs or vs cant remember which the auto show wasa while agothe is a v l from the il is there a or v jaguar xjs please add to the list thanks s ssaveolecdaccom cris hannu windsurfing the high countrycray research inc ncar boulder co cbhwindsurfscducaredu chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom benseoasysdtnavymil ron bensesubject re its a rush was re too fastin article aprstdvax oaddabstdvax dirk broer writesstill its amazing in germany you can have cars traveling mph and mph on the same to lane road around washington dc they cant keep traffic flowing at actually thatd be mph and mph the legal speed limit for trucks in two lanes each direction its a hell of a rush when those trucks fly by or was that me flying by them who cares the rush is really something else and so is the draftronfrom damelioprogresscom stephen dameliosubject re the mustangvlasiscybernetcsefauedu vlasis theodore writeshave you detroit beings compared the ultralongthrow stick shifts ofthe with the mr turbo or rx i ll buy it in mos or the torsen differential of the rx compared to the differential of the that sounds in every hairpin turn or the price tag of the rx vs a mustang part of the definition ofa mustang is that it should be affordable by the masses of courseford knows youre argument they own a big piece of mazda take a goodlook at a mach iii now an rx hhhmmmmmand bythe way and camaro both have drums on the rear breaks hello this is the s that is a tragedy but i dont think new camaros or the new mustangs willsteve alan kulwicki winston cup champion from adnritvaxiscritedusubject re mr seats for salein article aprnoaoedu grovesnoaoedu lee groves writesfrom article aprultbiscritedu by adnritvaxiscritedu i have a pair of sport seats from mr for sale blueblackas the owner of an mr and having several friends who own themi am very uncomfortable when i see an ad like this i have knownseveral people who have lost the seats from their mr in the middleof the night to support the celica retrofit trade and the insurance companies have been very miserable to deal within all cases when these seats are seen for sale they are most often stolenso it would be nice to see a statement saying where they came fromthat would at least help to soothe the reflexive fear that someoneis making a buck at someone elses expenseill give this seller the benefit of the doubt but people should beaware the the vast majority of mr seats on the marketespeciallythose that are in celicasare stolenlee btw they are incredible seats so if its legit go for it i am the original owner of the seats and the original poster i take very serious offence in your statement i see a lot of computers advertized on the net and my friend just had beenreleived of his machine all the netcomputer ads are for stolen computerswhere did you learn logicas for the seats they were replaced by a much harder literally celica gtsseats due to my back problem that is why i had to reuse the mr bracketsand thats why the mr seats i sell are attached to celica bracketsplease in the future think before you make allegations like the aboveit hurtsmikesfrom callisonuokmaxecnuoknoredu james p callisonsubject re super mega automobile sightings exotics togetherin article rfqinnkphantomgatechedu grahamtphantomgatechedu graham e thomas writesjmmhvirginiaedu the blade runner writesa gt gotta be in my top favoritecarsofalltimelist where is this place was the car for sale come on ineed detailsor not anyways i just had to say wow at thesighting of such a fine beast but remember the mustang willforever be the true king of the road the place was in what used to be a small town now a suburb north of atlanta i dont know if the car was for sale or not you wouldnt puta price on the window on this type of car anyway damn straight as far as ive heard unless the owner is veryhard up the gts are not for sale at any price that meremortals could affordand maybe the mustangwill be forever king of the road the gt isnt road legali think the gt actually is street legal although that particularquestion is moot see the price figures belowthis car was right hand drive werent they all like that how much doesa gt go for how many were madei wish i could find my shelbyamerican guide it included the gtregistry as of or so there were precious few of them made fifty is the number that springs to mind they made just enoughto qualify for the manufacturers cup or whichever series itwas that shelby broke ferarris year winning streak in in and they are all accounted for the last price i saw estimated on agt was a little bit over yes thats right one millionus dollars it was second only to some worthless piece of ferrarithat it would blow the doors off of i dont recall offhand what the drive configuration was althoughim certain some must have been lhd as they had to be sold to qualifyfor racing the drivertrain was the ford hiriser i think andor sideoiler coupled to various speed transmissions theyalso used speed manuals they had lots of problems with theoriginal trannys breaking under the load of the layout wasrearengine reardrive with the bundle of snakes exhaustheadersi can remeber other bits and pieces of info but icant remember whether they applied to the gt or the shelbycobra daytona coupeill try and find that referencejamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom matthewsoswegooswegoedusubject mg tseries for sale mgtf with frameup restoration in early s a local show winnerdriven very little and stored inside since then mostly collected dirt dust needs attention to brake cylinders like all mgts but otherwiseready to run chrome paint not fancy but it is mechanically excellentthe engine a cc was completely overhauled by a machine shop it ispriced at mgtd good shape but hasnt been run since s needs engine workbut no rust and everything is with it including a top side curtains andcarpet that were new and havent seen the outdoors since the s mgtd basket case id call it a parts car but its too goodfor that everything seems to be there except the tach would makea good project car or parts car if you insist no apparent rust but theupholstery is a disaster stored inside since the s the top wasnew but now soso this one has wire wheels looking for all three cars will be sold as they stand with no hassles or hagglestime has passed by and it is time to part company prices are negotiablereply via matthewsoswegooswegoedu or us mail to p o box oswego ny harry matthews kaou wrvowrvnwrvj internet matthewsoswegooswegoedulearning resources satellite tv bitnet matthewssnyoswvasuny college cable tv voice mail oswego ny alloy ntnxpc mhos are mine not suny oswegosfrom eliotstalfosengrwashingtonedu eliotsubject re horizontally opposedboxer engines was v v v v vxin article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writesnone of the configurations are perfectly inherently balanced whichis what i was talking about balance shafts and mass on eitherends of the cranks can eliminate these forcesmoments which issomething i also pointed outand didnt you also say that it was easier to add masses than toadd balance shafts the sad truth is that some makers dontbother to put balance shafts on their big shaky sthe three cranks i refer to i i i evenfiring deg k j fp mp fsrlzcost ms j j flat evenfiring deg k i fp mp fs a crank spacing msarlzcost j j flat evenfiring deg k i fp mpazcost fs mshow about if this is ridiculous kindly explain why its been more than yearssince i studied this stuff flat s and is both have the potential to be nearly vibrationfree because subaru does that has nothing to do with is ingeneral or porschei think subaru somehow connecting themselves to porsche is anabsurdity and im not a porsche fan big wing dings theseconfigurations overhead cams etc etc etc have been aroundfor nearly years the point that they are trying to make is that while everybody settlesfor the orthodox inline they are using a horizontally opposed which is unique in that market segment and porsche also uses a flatsix in their so whats the problem i dont see any claim thattheir engine is as good as a porsches they are simply pointing outthat they use the same configuration as a porsche if you want tonitpick ad campaigns i think there are far more blatant excesses thanthiseliotfrom dchanciscocom derek chansubject re service indicator of a bmwthanks for all the recommendations i have decide to ignore the service indicators and do oil change myself every milesthanks again for all the responses derekfrom hskmicroplexcom harjeet kalsisubject new mercedes diesels hi fellow auto enthusiastsdoes anyone have any info on the new valve per cylinder diesels mercedesis working on any specs on outputs engine size will they be direct or indirect injection etc would be welcome from what i hear these should be out late this year next yearthank you in advance for your repliesharjeethskmicroplexcom from bowmanjcsnorg jerry bowmansubject re replacementcustom seats where to getin article cuqshusenetucsindianaedu tom wetzel twetzelucsindianaedu writesin article aprcoloradoedu jerry bowman bowmanjcsnorgwrites what car are we talking about if its camaro chevellegto nova etc there are a bunch of places to get them a corvette but i dont want to put corvette seats in it the original seats are in exc shape but they are uncomfortable as hell im going to store those and find a set to drive in i have all the vette catalogs but im looking for a more generic type seat i can modify the brackets but cushion height and overall width are a concern ive looked through some local boneyards without success i would just like to find a pair of cheapos to use this summer tom call around to some wrecking yards in your area andif they have any look at fiero seats they are right down on the floor like a vette and not too wideif you cant find any let me know and ill call around here for you im sure these yards ship stuff all the timefrom sbonsibdatacacstratuscom steve bonsibsubject after market sunroofs power moonroof big type who makes the besthello alli know that after market sunroofs may have left a bad taste in some of your mouths but i am really interested in finding a good brand if one exists please let me know if you have heard of any makers with a goodreputation few failures no leaks that sort of thing and whether ornot you have had first hand experience with that manufacturer who isgenerally regarded in the industry as the best price no object maker of power sunroofs stevesteve bonsib reply to sbonsibcacstratuscomstratus computer marlboro ma from westesnetcomcom will estessubject wanted toyota previa alltrac low milesim looking to buy a toyota previa alltrac with low milesif you are selling one or want someone to buy out an existing leaseplease contact me by mail will estesinternet westesnetcomcomfrom leeabsodaberkeleyedu arkboon leesubject centreforce clutchany one with experience in having a centreforce clutch or any otheron hisher carim considering to replace my old stock clutch on my crx siwhat is a fair pricemartinfrom jackwboihpcom jack woodsubject re chevygmc x fullsize pickups opinionsdick grady gradyworldstdcom wrote i am considering buying a chevy or gmc x fullsize pickup with the extended cab any opinions about these vehicles have there been any significant problems dick grady salem nh usa gradyworldstdcom so many newsgroups so little timei bought a brand new chevrolet k hd x extended cab lastmay it has had many many problems see my earler post that describesthe situation i went to bbb arbitration and they ruled that chevroletmust buy it back from me if you do get one stay away from the speedmanual with the deep low first gear they have put three of them in mytruck so far after about miles overdrive either startsrattling or hissing loudly there is no way to fix them chevrolet says that the noise is a characteristic of the transmissionalso if you are planning to use your truck to tow thegear ratios in that tranny suck on a steep hill you get up to about mph in second gear at rpm yellow line if you shift to thirdthe rpm drop to only and you begin to loose speed i shouldpoint out that the v they put in the hd gvw trucks is adetuned motor compared to the one they put in the light duty ones theydropped the compression ratio supposedly for engine longevityreasons so the light duty may pull better than my truck doesother things that have gone wrong include the ventilation fan times so far paint had specs of rust embedded in the paint from beingshipped by rail with no covering and suspension parts link betweenstabilizer and control arm fell offany company can make a bad individual car chevrolet included whatreally bothered me was the way they reacted they made no attemptto deal with me except to tell me to take it back to the dealer for them to attempt to fix it one more time so i bought a brand newford f hd super cab with a and an automatic i will neverbuy another chevroletjackwhpdmdboihpcomfrom aefreenetcarletonca steve huisubject highmileage audi questiona question for any highmileage audi owners out there i aminterested in buying a audi s for cdn thereason the car is selling for so little is that is has km on it just under mi the cars ownerclaims the car is in good condition my question is howreliable are audi s with mileage that high would itbe worthwhile for me to buy the car any problem areas thati should look out forany help would be greatly appreciated post responses andoremail methankssteve hui from finnegannrlsscnavymilsubject re v v v v vxin article aprengrwashingtonedueliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines eliotwouldnt that make them an i or would they really be an henceforth referred to asunderscore kennethfinnegannrlsscnavymilfrom aaspocwruedu andrew a spencersubject re impala ss going intoin a previous article georgehowellgoucherwbffvamprorg george howell saysgm has always screwed the rest of the divisions in favor of thecorvette the current platform is no exception the detuned camaro andfirebird is a load of crap to keep people from realizing that they canbuy one of these instead of a corvette and save about i like the idea of an impala ss but if they really wanted to impressme they would throw in a big phat imagine the cops in their tauruspolice package and litres as they stare at your taillightsgimme a break you know chevyd screw that up just like that almost greattruck with the big phat have you ever seen the mufflers on that thingits amazing it moveswhich isnt to say its not a good ideabut im quite sure chevyd screw it up the same waydrewgeorge howell m m ooo ppp aaa rrr mm mm o o p p a a r r m m m o o ppp aaaaa rrr m m o o p a a r r m m ooo p a a r r ford better living through american horsepower george howell georgehowellgoucherwbffvamprorg from buckgranitemabullcom ken bucksubject re questions about insurance companies esp geicowratunisqluucp wharfie writesmy car was recently destroyed in a hail storm i fully expected to get jerked around by the insurance companyi wasnt the only one who had hail damage state farmopened its claim centers on evenings and weekends and flew downadditional adjusters from dallasi have no experience with state farm but i think its important todifferentiate your experience from a typical accidenthail damage is clearly not the fault of the owner and also tends tobe well publicized in the media so its to the ins cos benefitto respond promptly and helpfully damage like this doesnt implyanything about the likelihood of future claims unless you live in anarea that gets frequent damaging hail storms so theres no reasonfor them to stop covering youthats a lot different from atfault accidents or theftrelated claimswhich may be more indicative of claim patternsfrom balsamostarglenetdeccom antonio l balsamo save the wailssubject re warped brake discs on taurus lfrom bswutrcutccom bruce s winterssubject re warped brake discs on taurus l in the past few years i have owned mustang gts and now own a tbird sc they all have had this problem there was a recall on the tbird for the brake problem the ford dealer replaced the rotors and pads but the rotors warp after about k miles between this problem and the fit and finish problems on the tbird ill never buy a ford again i just had my rotors on my taurus gl changed less than miles ago andyou guessed it im noticing slight warpage in the left rotor i had a mechanic friend of mine look at it and he said that there is a high spot on the rotor that is causing the problem this is a brand new rotor bought from a ford dealership cant they even produce a brand new rotor that is not warped im currently negotiating with them to swap it out for a new rotor this is my first american build car and im not overly impressed tony name antonio l balsamo company digital equipment corp shrewsbury mass work email balsamostarglenetdeccom from pweslipknotmitedu paul w emerysubject v engineson the subject of the vford in the uk used v engines exstensively intheir ford transit vansthis brings back a memory from the seventiesiplayed in a band at the time and for something like pounds four ofus bought a tranny to cart the gear around init was in terribleshape cosmetically because its last owner was a pig farmerwe spentdays cleaning it up and putting in a partition and more seating but tilthe day it died everytime you turned on the fan to the defroster driedpig shit came flying out the vents back to the engine if i remember right it was a cc v and thatthing could haulwe could fill it with equipment and up to people andit went like a bat out of hellof course there were no pollution controlson the engine and the gas was leaded and higher octane than we get now when the mechanical fuel pump quit we put in an electric one from a morris minor that worked great ah fond memories pweslipknotmitedu id like to own a squadron of tankspaul w emery ron nastythe rutlesm i t magnet lab cambridge mass usa costellobeatlesspinaltapfawltytowersmuttsavengersstartrektngenglandrutles from pzhaegdstogovau paul heuersubject re lemon law does anyone know the lawkchuppkchupp kevin chupp writesmy father is have lots of problems with a year old van what is thelemon law what should he do if he qualifiestalk to philip greenspun he took ford to court recently and despite muchmanouvering and trickery on fords part he won well actually i thinkford settled out of court on the provision he shut his mouth and stopped causing them trouble i love it when the little guy wins i dont havephilips address anymore but a philip where are you call may bring himout of hidingcheerspaul paul heuer phone avionics technology dstopzhaegdstogovau fax po box salisbury south australia from sarcunixfcccolumbiaedu stuart alexander ridgwaysubject re mr seats for salein article aprultbiscritedu adnritvaxiscritedu writesin article aprnoaoedu grovesnoaoedu lee groves writesas the owner of an mr and having several friends who own themi am very uncomfortable when i see an ad like this when these seats are seen for sale they are most often stolenso it would be nice to see a statement saying where they came from ill give this seller the benefit of the doubt but people should be aware the the vast majority of mr seats on the marketespeciallythose that are in celicasare stoleni am the original owner of the seats and the original poster i take very serious offence in your statement me thinks thee dost protest too much please in the future think before you make allegations like the abovehe made no allegations and specifically gave the seller the benefit of thedoubt he simply made the net aware of the fact that many of these seats arestolen so watch out and ask questions when buying thats good advice tofollow when buying anything from a third party on the net or elsewhereit hurtstouchy touchymikes alex ridgwayfrom jmhhoppervirginiaedu jeffrey hoffmeistersubject re the mustangin article aprvirginiaedu jmmhvirginiaedu the blade runner writesi just have got to remind all of you that this is it yesthats right somtime this fall ford the granddaddy of carswill be introducing an allnew megacoolwaytoofastforaccorddrivers mustang its supposed to be streamlined looking similar to the mach iii concept carford came out with around january i cant wait anyone outthere hear anything about it recentlyif everything ive read is correct ford is doing nothing but reskinning the existing mustang with minor suspension modificationsand the pictures ive seen indicate they didnt do a very good jobof it the new mustang is nothing but a recycle of a year old carjefffrom blairmeduvmedu blair robertsonsubject re service indicator of a bmwdchanciscocom derek chan writes in article aprwestminsteracuk jkjecwestminsteracuk shazad barlas writes derek there is a tool available to reset the service indicator on bmws but the lights will come back on after weeks the tool is in fact illegal in europe atleast it is often the case that the unsuspecting punter trots off to buy a used bmw and a few weeks later all the lights come on other than that i know of no other tool anyone else shaz hmm but the service indicators that i have works this way there are green yellow red indicators initially all green indicators will be on for few minutes when you start your car the computer will actually sense how you drive your car and as time goes by the green indicators will start to go off one by one and then the yellow indicator will turn on and then the red indicator will go on and you should get service when by the time green indicators are off after service the mechanicor you will reset the service indicators and the computer starts counting again so i expect to have a toolor a procedure to reset it so the green lights will come on and the yellow and red lights will go off i wonder how people can do oil change themself without knowing how to reset the indicator its the first european car i have and changing oil at miles is a surprise to me and its a big plus but i wonder how that could happen since the oil lose its lubrication ability over time i thought its the oil and not the vehicle that determines how often we should change oil any bmw owner on the net response welcomed ps my initial question is how do you seset the service indicator of a bmw derek there is a perfectly legal tool available to reset the bimmer service lightsit will cost you from a mailorder and buying one far outweighsthe possible consequences of destroying all the electronics if you trydi it yourself you wonder how people do an oil change without knowing how it resetwhy is reseting so important the only reason for doingit is stop the annoyance of a red light staring at you forget this in european cars you only need to change the oil every crap anyone serious about keeping their engine in good shape andextending its life will change it every inc filter dont waitfor the servive lights to come on before servicing the car i bought a bmw about months ago it had green lights on i have changedthe oil every completly flushed brake fliud changed all filtersoilair and fuel changed transmission and drive oilsand done almost all of the other things req for service and a service after nearly miles i am still on green lightsafter a winter in burlington and it is snowing today that is not badgood luck blairblair e robertson a new zealander in vermontuniversity of vermont posting his own ideasmedical research faciltysmooth muscle ion channel groupcolchester vermont email blairnorthpolemeduvmedutelephone from jameslgalaxynsccom james lu xsubject how good is car wash waxquestion whats your experience with car wash waxthis is the liquid type of wax in bottles that you pour it inwater sponge it on you car hose it off and dry it with clothmany people have used it it is very easy to work with and givesseeminly the same visual results as that of paste type of waxbut does it last long does it have any negative effects to carpaintcan you forward your reply directly to my email id thanksjamesfrom mricemozartcolumbiascncrcom mark w ricesubject re review ford taurus shoin article uupcbcuttinghoutxus davidbondscuttinghoutxus david bonds writesgkoccasionally i have trouble shifting into reverse the shiftergkrefuses to enter the gate and i often grind the synchros trying togkget it into gear ill be watching this carefully in the next couplegkof monthsenter st wait seconds and then go into reverse they use the samesynchros and youll never at least i havent groundemtofit when usingthis techniqueor do like the manual says and put it in rd first then you can quicklygo into reverse no waitingmark mark rice markricecolumbiascncrcom my viewsfrom walkerraspenwpiedu robert a walkersubject re broncosdoes anybody have any information on the second generation broncos imnot talking about bronco iis im referring to the broncos that beganproduction in based on the f chassis i believeahh broncos well personally i have a the blue book is justa hair over grand i bought it for and then bought new tires front end rebuild carb rebuild then i did the unthinkableand blew the engine not bronco specific unmaintained engine with more bucks there now it is in nice condition well after new seats outof a tbird radio amps speakers alarm well the radio and amps were free and i bought the speakers used for bucks and the other speakersi took out of my old jeep sell a jeep for a bronco you might askbut it was a wagoneer its a lovely specimen solid front and rearaxels ford and a dana up front watch the rear axel wrap i busted off my ubolts once i added traction shocks after that and havent had a problem since also the bottom of the doors tend to rot bottom of the tailgates likes to rust right up to the new onesthat might be in your budget the post broncos have that sicklyttb front end and little stamped and folded steel radius arms wereas the have nice big cast iron longer radius armsie more prspectivewheel travel the only rust i have is on my doors and a fewdings in the sheet metal i dont know when the removeable tops werediscontinued but they are fun i just ordered a full convertable topfor for minecredit card dont ever break the window if youhave the double laminated bronzed privacy glass in your cap it is over bucks to replace my bronco also does pretty good offroadi havent bottomed out my suspension yet and have crossed over foot deep of water with no problems handles rocks like a charm tooone problem is it is wide and you sometimes cant follow a cj or atoyota between two rocks or trees and your grandmother will havea hard time getting up into itbobfrom mwalkerchamaeeceunmedu mark walkersubject re rfi art of clutchless shiftingin article aprmagnusacsohiostateedu sjcostanmagnusacsohiostateedu scott j costanzo writes he was as smooth as silk it wasthe most amazing shifting demonstration ive ever seen having said all that i still dont know why anyone would want to shift a synchronized tranny without aclutch why do itego trip mark walker my old man always saidmwalkerchamaeeceunmedutoo much is just right home guess that applies to my preferencesalbuquerque nm in performance carsfrom mwalkerchamaeeceunmedu mark walkersubject re rfi art of clutchless shiftingin article lrrpsuvmpsuedu lrrpsuvmpsuedu writesi have they showed the foot cam and telemetry for rusty wallace shifting at atlanta last year and he never touched the clutch except very slightly when downshifting hp is pretty powerful to mei doubt his trans uses standard syncros there are several mechanisms forcoupling a gear with the transmission output shaft some of which are finefor racing and unsuitable for street use mark walker my old man always saidmwalkerchamaeeceunmedutoo much is just right home guess that applies to my preferencesalbuquerque nm in performance carsfrom smorrissumaxseattleuedu steven a morrissubject re lexus and infinitiin article afqzkhsiveyissandrewcmuedu joseph d mazza mazzandrewcmuedu writesbtw i just saw the new q on tv this weekend the big changes agrille has been added looks nice too and some wood for theinterior otherwise it looked largely unchanged they changed the lights and slope of the hood along with the newgrille otherwise it is unchangedinterestingly their lack of wood and lack of a grille was a bigdesign statement they tried to defy conventional wisdom and carvetheir own niche unfortunately sales were only half those of thelexus and hence they now join the pack i still wonder if much ofthe problem wasnt the slow start from the initial ad campaignpersonally i like the q without the grille steve morris ma internet smorrissumaxseattleueduaddiction studies pgm uucp uwbeaveruunetgtenmcdataiosumaxsmorrisseattle university phone dept or directseattle wa from pbhandartsegwtsecom parminder bhandarisubject info about audi usedi am thinking of buying a used audi autothese cars look good and audi do have a good rep for these cars in europewhere im fromi was just wondering if there anything about these cars that i should knowparmsfrom pbhandartsegwtsecom parminder bhandarisubject question about integra auto boxim new to this group and this may have been discussed already in which casemy apologies buti have a integra with an auto box according to the manual the car hasa lock up torque converter or something similarwhat is it what does it do and how does it workexcuse my ignorancedoes anybody knowparmsno sig yetfrom pbhandartsegwtsecom parminder bhandarisubject new integra for ive heard unconfirmed rumours that there is a new integra being releasedfor does anybody have any info on thisthe local sales people know as much as i can throw themparmsstill no sigfrom mhembructsegwtsecom mattias hembruchsubject re drivers seat best cars of the yeartomhmetricscom tom haapanen writesthe golf also won ajacs automobile journalists association of canada car of the year awardand unless i am mistaken i screwed up my borrowed vcr and got the first minutes the corrado slc was awarded ajacs sports sporty car of theyearmattias tom haapanen tomhmetricscom software metrics inc waterloo ont stick your index fingers into both corners of your mouth now pull up thats how the corrado makes you feel car january mattias hembruch my views do not necessarily reflect those of the tse email mhembructsecomfrom aaspocwruedu andrew a spencersubject re rfi art of clutchless shiftingin a previous article luskyccwfccutexasedu jonathan r lusky saysin article lrrpsuvmpsuedu lrrpsuvmpsuedu writesim not familiar with the trannies used in winston cup but in the transamcars ive played with the transmissions were the racing variety withdog clutches instead of sychros in a transmission with dog clutches thegears are always engaged with each other and moving the dog clutchesengages the gears to the shafts motorcycle transmissions are the same wayshifting without the clutch on a transmission with syncros can and will causetransmission damage the only question being how long it takesto grenadesomething for the trans in my pulsar se it was about k miles butit had a weak tranny in the first placejust out of curiosity how is this dog clutch any different from a synchrotransmission what you described sounds the same to me in fact what littleive studied on trannies the instructor referred to the synchros as dogsand said they were synonymous the gears are always meshed in a synchronizedgearbox and you slip the synchro gears back and forth by shifting or at leastthat is what i was taught explain por favourthanxdrewps emails fine if this is inappropriate for here or if im the only bonheadwho doesnt know the difffrom aaspocwruedu andrew a spencersubject re v v v v vxin a previous article finnegannrlsscnavymil saysin article aprengrwashingtonedueliotstalfosengrwashingtonedu eliot writesthe subarus all use degree vees in their engines eliotwouldnt that make them an i or would they really be an henceforth referred to asunderscore i think that it is technicaly known as a degree vee configurationcould be wrongthis is how ive seen them referred todrewfrom goyalutdallasedu mohit k goyalsubject which radar detector should i buyi just entered the market for a radar detector and am looking forany all advicerecommendationswarningsetc from anyone in this groupemail is preferredthanksfrom antkasxgsusgigsuedu k a sturrocksubject re viper car alarmsucsuiucedu ronald e garnett writesron viper also sells some fancy field disturbance sensor thatron supposedly detects people approcahing the carronif your viper system were tuned like a neighbors is you wouldnt getany sleep because of the damn thing waking every one in the neighborhoodupwe all used to try to ignore the alarm but have now made a pact tobombard the house with nighttime visits and phone calls when ever weare awakened because some thunder storm passed over the next countyor a stray dog looked at the carcar alarms are a serious painintheassksps real men dont have car radios since the exhaust is too loud to hear it anyway grin k a sturrock anthropology georgia state university ksturrocgsuedufrom cadizrtsgmotcom jay cadizsubject gts headlight coversi have a eagle talon and i wanted a pair of gts headlight covers actually they are turning signalcovers since the talons that year had popup lightsi went to a auto shop and bought the taillight blackouts for but they did not have the turningsignal covers in stock i asked how much it would beand he told me it would cost me another i thoughtthis was a bit high for two small pieces of plasticcan anyone find me a cheaper pair or even a used onejay cadizcadizmarblertsgmotcommotorola incarlington heights ilfrom jimbhpinddacuphpcom james brudersubject re manual xmissionadvice needed i dont think that a transmission fluid change will solve your problem unless you are in an extremely cold climate and using a very heavy weight fluid follow the manufacturers recommended oil weight some of the cars i have had all standard transmissions or speeds recommend changing the transmission fluid at miles under normal driving conditions ive gone without changing the transmission oil and had to replace the transmission bearings my older cars used weight oil whereas my honda uses motor oil or maybe weightfrom jimbhpinddacuphpcom james brudersubject re changing brake fluidis it necessaryi agree with jeffs reply ive never changed the brake fluid except whenhaving a brake job which is usually at around miles alot offreeway driving however i will start to do this as preventativemaintenance on my new car also there are brake system flushing agentsthat can be used but the problem is that if any of the agent is left in thesystem it can cause problems so its been recommended not to use them unlessyou are certain that you can remove all of the flushing agent just foryour info i was quoted a price of labor and fluid forflushing the brake system this in conjunction with a break job so i dontknow if it was more without the brake job this is in the sf bay areafrom jimbhpinddacuphpcom james brudersubject re vibration when brakes are appliedhi javier how are things at corp my old stomping ground was clevelvibration when applying the brakes can be caused on disc brakes at leastby warped rotors when the brakes are applied there results uneven pressureon the rotor turning the rotors by a brake shop will remedy this problemas long as there is enough rotor width left for turning ie within specthere could be some possible front end suspension problem but a brake shopshould be able to confirm warped rotors by a visual inspection which is freefrom wenkingcscaltechedu wenking susubject re mercury villager minivan good buyin article rcrinnvarsumaxseattleuedu smorrissumaxseattleuedu steven a morris writesthe villagerquest seem like the best of the cravanvoyager copies tocome along since the mazda mpv the nissan maxima engine paired withthe maxima speed auto trans should be an excellent drive train andthe rest of the vehicle seems well engineered only the price iscontroversialhmm the last time i checked villagerquest does not have a maximaengine and is very much under powered for its weightfrom chuckofreudarcnasagov chuck frysubject re v enginesin article aprllmitedu singerllmitedu matthew r singer writesdidnt the saab sonnett have a v i recall someone telling that it wassomething like of a ford not only the sonett correct spelling but the wagon and sedanused a cc or cc v from ford of germany this particularmotor had a degree vee angle a balance shaft and siamesed exhaustports this motor was later stretched into the v commonly seen in thecaprithe v could make pretty reasonable power for its size but in thesaab it made too much torque for the transmission which had beendesigned for a cylinder stroke chuck fry former sonett iii owner chuck fry chuckofreudarcnasagov this space for rent i alone bear responsibility for the claptrap abovefrom kmacciscocom karl elvis macraesubject ford explorer question and suv reviewok so in my ongoing search for a sport utility heres the latesttoyota runner small small small small the interior of this vehical is impossiblefor a large person too bad it would have been the winner otherwisenissan pathfindervery low ceiling my head hit the roof fun on bumps no also hasa cheaplooking interiorisuzu trooperclass act this is a really really nice vehical very comfortablehandled ok has really cool grab handles everywhere but its hugeand the engine is a bit too small for its bulk also the manual shift is weird and kind of awkward id buy this if it were k cheaper or shorter but at this size and for this price no i kept picturing trying to park in in san francisco no thankschevy blazercheap looking small not as small as the toyota and nissan but still too smallford explorerthis is no sports car and its certainly not for the serious off roaderbut its big enough to be comfortable without being as huge and heavy as thetrooper its engine has plenty of power for everyday driving though it wouldbe nice if it had a bit more the automatic tranny is pretty nice head andshoulders above my mazda mpv the steering is not as tight as id likebut its acceptable the two door has easytoenter back seats easier to getinto in fact than the drivers seat of the runner and with a shorterwheelbase and the easier availability of a manual tranny yes im a manual shift biggot i admit it its the one im thinking of buying so that said is there anyone out there who has one of these and hates itanyone had any major problems heard any horror stories also any reason to buy the ford over the mazda navajo both being essentiallythe same vehicalthankskarl karl elvis macraesoftware release supportcisco systems kmacciscocom or batmanciscocom dod fj shovels and rakes and implements of destructionarlo guthriefrom cmcciccicom carl mercersubject corvette car cover for saleim not sure if this made it out so ill try againi have an ecklars sp corvette car cover for sale the cover is canvason the outside and felt on the inside it is weather proof and in greatcondition im asking and ill pay shipping originally in october of carl mercer cmccicom evening dayfrom ppdclnextsccsouiucedu paul parksubject re new integra for in article cyptdtsegwtsecom pbhandartsegwtsecom parminder bhandari writes ive heard unconfirmed rumours that there is a new integra being released for does anybody have any info on this the local sales people know as much as i can throw them parms still no sighere we go againnow these are just rumors so dont quote menew integra supposedly wedge shaped again hp and allwheel drivein top models then a variant called the zxr comes later roadsteri think it gets unveiled at end of summernothing about an airbag was mentioned but im sure itll have onealong with a nice hefty increase in sticker from dcdsehoustongeoquestslbcom dan daysubject re car buying story was christ another dealer service scamin article aprnewsgatespsmotcom rapwemailspsmotcom writesbefore you go in find out the invoice prices of the car add a reasonable profit for the dealer offer them that price and stick to itwhoa watch your terminology dealer invoice is not dealer costyoull hear lots of ads screaming two dollars over dealer invoicesounds like a real deal huh no you know what the dealer invoicealso called factory invoice is its a piece of paper with numberson it that the factory sends the dealer what do the numberssignify absolutely nothing its a marketing gimmick that thesalesman can wave in your face to impress you note that nowhereon the invoice does it claim to be the real price of the car andmost ads which mention dealer invoice will end with a very fastlow voice saying something like invoice may not reflect actualdealer cost actually i guarantee it does not reflect actualdealer costalso the reasonable profit for dealer is usually around three percentadjust according to the dealer cost of the car and any options thatyou want haggle like hell with the salesman over the cost ofdealer prep and protection package ie a few squirts ofpaint and fabric protectant while youre at it ask the salesmanto toss in a thing or two that doesnt cost him any cash my wife and i got a joyride in a twinturbo mitsubishi gt whenwe bought our mitsubishi minivanfrom newmancpsmsuedu timothy s newmansubject ford probe import car of the yearokay okay i know the ford probe is made in the us in fact itsmade in michigan at a mazda plant my question are most of the partsfrom american or japanese sources i have been told that most of the usassembly plants for japanese automakers import almost all of the parts used inthe vehiclesany information anyone has on this will be appreciatedtim newmannewmancpsmsuedufrom behannasylnjneccom chris behannasubject re best radar detectorin article aprwestminsteracuk jkjecwestminsteracuk shazad barlas writeshi now that we have these gatso photo speed traps here i was wondering if anyone knows if radar detectors are capable of detecting photo cameras ifnot are there any other devices which will yup radar detectors that detect ka band will pick up photo radaras its reflected from some poor slob ahead of you that just got nailedbtw many photo radar installations in the southern us becametargets for highpowered rifles or had their lenses decorated with cowflop etc not that im advocating destruction of public property but youget the picturelater chris behannadod hd fxwg wide glide jubilees red ladybehannasylnjneccom cbt baby bikedisclaimer now why would nec zx needs a nameagree with any of this anyway i was raised by a pack of wild corn dogsfrom cpbemailmotcom philip bushsubject re plug wires do they really need replacementin article rgvvamhavenumdedu vadikcsumdedu vadim maslovwrote hi netters i went to all tune and lube for routine maintenance and they said i need to change plug wires because they are original ones and you driven k miles on them i had a strong suspicion that they just wanted to make money wires had no visible defects and my repair manual doesnt recommend any scheduled maintenance for them is it plain vanilla rip off or there can be some backing behind their suggestion to replace wires i have ford taurus vadim maslovi once had a sparking problem with my mustang and simply changingthe spark plug wires fixed it philip bush national champion motorola inc schaumburg il sho convention show email cpbemailmotcom rd place concours phone judged from johnneskimocom john navitskysubject re ford probe opinions centered around the gtin article heiseracsbuedu bill heiser writesin article chuckeosncsuedu chuck kesler writesjeremy g mereness zonkercmuedu sayscan anyone offer any opinions of the ford probe ala how they do inthe long run repair records reliability mileage etcive found mine probe gt to do quite well window problem deleted artical has been trimmedi have had my probe looked at twice by my local dealer where i purchasedthe car the first time they made this problem worse the second timeafter advising them of the service bulletin mentioned on my fordprobe mailinglist they said they didnt know of the bulletin they adjusted the window andmade it much better however it now makes a scritch scritch noise on roughroads and still squeals when i openclose the window in wet weather anyoneelsess do thisive not had any of the air or leakage problems that have been reported butdo get the squeal that bill describes i live in seattle so the wet weathermay be a factorford only gives key with the car cmon ford spend an extra few penniesif i recall correctly i got two keyshorn buttons behind air bag in spokes and not in center personal preferenceyouvegottopositionthefingersperfectlytomakeitbeep buttons areterriblethis is true im wondering if this may be a safety concern ie if peoplepound on the place where the airbag livesspeaking of the horn i was surprised to find that the probe comes with oneof those nice merican sounding horns instead of the japanese sounding kindthe previous probes had japanese hornsno opiniontransmission the speed is a musti have always been a speed guy almost every car ive ever owned has beena speed because i got a good deal on this car with the miles iknowingly overlooked the fact that it has an automatic but it is a prettyhightech automatic it is a fully electronicaly controlled speed withthe speed is much more fun we opted for the automatic for a number ofreasons but its still fun and in some ways more practicalno shakerattle noises when going over bumpspotholes stilldittoshakes and rattles has been my main gripe ive gotten them to fix theworst of them but i fear that with the rather harsh ride the car willbe a virtual potpouri of rattles when it gets olderi too would suspect that this may be truetires vr goodyear eagles left hoping for k very very very well it sticks to the road like glue even on a roughsurfaceyesinterior is very very nice too very pleasing to the eye and ergonomicallysounddefinitely fordmazda did a very very nice job on this one thecar has a much more expensive than it actually is look and feel to itdittoyes this cars stiff suspension isnt for everyone i personally like itbut if you find it a little harsh but otherwise like the car id stronglysuggest looking into the mxagree check it out i dont mind it but would say that if it was much stiffer it might be a problem how about the r rx for suspension well i wouldnt encourage passengercarrying in the probe unless theperson in the front seat likes to sit with his knees to the dash asmentioned in the consumer reports writeups consider the back seatas a parcel shelf no biggie to me though if it had been id nothave bought the car but its definitely not a family cartrue ive heard that the exhaust system has trouble but mine works finei havent heard about this one i know that some of the very early probes and maybe had problems with prematurely rusting mufflers whichive had this problem and read about it or at least i assume the onei had was the one i read about in any case what happened was theweld between the muffler and the pipe feeding it ok so im not a mechanicbroke in my case the dealer welded it ordered replacement parts andput them on when they got them i suspect this is some sort of designflaw or production flaw in any case i have an earlier model and wouldexpect it to be worked out on newer ones in any case it is a warranteerepair or they get the keys backfrom what ive heard it sounds like fordmazda had some qc problems with the probe and probably mx when they first went into production but i think these problems have mostly been corrected at this point thatsalmost always to be expected with a completely new car like this thoughi have to agree that they seem to have some qc problesm but i seriouslyfeel the car design is sound and expect it to do very welli second this there seems to be some things that slipped through but thecar seems very sound while not perfection what is you get an awfullot for your money bill heiser heiseracsbuedu heiserworldstdcom boston university boston ma btw bill has a probe mailing list you might want to subscribe to it if you are interested in more detail try requestfordprobeworldstdcomdid i get that right never can remember if the request goes on thefront or the back john navitskyjohnneskimocom exercise a right today from sam swett ssbcandrewcmuedusubject re review ford taurus shoexcerpts from recautos apr re review ford tauru by markw ricemozartcolu in article uupcbcuttinghoutxusdavidbondscuttinghoutxus dav id bonds writes gkoccasionally i have trouble shifting into reverse the shifter gkrefuses to enter the gate and i often grind the synchros trying to gkget it into gear ill be watching this carefully in the next couple gkof months enter st wait seconds and then go into reverse they use the same synchros and youll never at least i havent groundemtofit when using this technique or do like the manual says and put it in rd first then you can quickly go into reverse no waitingone more way which works in manual trans cars ive driven and it is mypersonal favorite the other suggestions above are great but try thisone too while pushing the shifter gently towards reverse let the clutch outslowly right to the friction point and the shifter will be pulled intoposition if you do it right the car wont jump backward nor will thegears grind you will just glide backsamfrom ckauxacsouiucedu oriolefanuiucsubject re viper car alarmsmcrosbiebatmanbmdtrwcom writesin article cfrcdocsuiucedu ucsuiucedu ronald e garnett writes hello auto enthusiasts stuff deleted viper also sells some fancy field disturbance sensor that supposedly detects people approcahing the car this is primarily for convertibles i have a convertible and have looked atthis feature in detail alpine actually makes a better radar unit if you wantto get one of these it has zones in it that can be shut down independently sothat if one side of your car has pedestrian traffic or something else thatwould trigger an alarm it shuts down the zone or rather pulls it in tighteri dont see the real benefit to these unless you have a convertible that youleave the top down onavoid the voice alarm that can be added to the radar package it talks topeople as they walk by i saw one installed on a lotus esprit the kids wouldtaunt it seeing how close they could get before it warned them to get back the owner finally disabled it which defeats the purpose in my mindstuff deleted ron garnett more stuff deletedmerrillmy neighbor runs a viperr distributorship and installs them on allsaturns sold in my area anne arundel county md he has an sc with theviper voice alarm installed the alarm does everything turn on the car the radio the heater roll down windows unlock the doors the alarm goesoff more frequently on hot days when a person walks by it gets sensitive upto about feet in degree heat it isnt as bad as convetional siren alarmsbecause it doesnt continue to wail it just says protected by viper pleasestand back and shuts up mainly because the person walks away befuddled chintan amin the university of illinois urbanachampaign mail llamauiucedusig under construction hard hat areafrom davidganglionannarbormius david hwangsubject re best radar detector valentinein article aprsequentcom troysequentcom troy wecker writeslet me explain why i feel the bogey counter feature is a gimmickradar waves bounce off objects especially metal that is how radarspeed measurement works a high frequency microwave x band approx ghz and k is approx ghz is sent out and reflected back to theantenna off of an automobile or other objects if an object is movinga doppler shift about hz per mph on x band occurs is measuredand converted to miles per hour these waves bounce all over theplace and they can reflect many times and go in many directionsfrom what i understand the valentine can only tell if thesemicrowaves are coming from the front rear or both there are onlytwo antennas if they are coming from both this in interpreted as aside bogey bogey counts are determined as sources by theirrelative strength to one another even if they are reflections of thesame sourceim certainly no engineer and really have no scientific basison which to make this argument but dont you answer your ownquestion is the reflected signal shifted at all from theact of being reflected if so wouldnt it then be easy forthe detector to discriminate between reflections and directsourceshere is the problem since the microwaves reflect how does the unittell if it is a source or a reflection take a valentine anddrive to the local grocery store that uses an xband radar dooropener you can tell by the small black box above the door pointeddown at about a degree angle and your detector going off when itgets near the valentine will count or bogeys from alldirections front rear and sides it doesnt say which side thecount changes as cars drive by and reflections change is there or sources not at the store i go to as i drive around with astandard detector i can only find one source and that is the dooropener for the front doortroy weckertroysequentcomsequent computer systemsbeaverton or david w hwang md davidganglionannarbormiusfrom davidganglionannarbormius david hwangsubject re best radar detector valentinein article aprconvexcom tobiasconvexcom allen tobias writesin article aprsequentcom troysequentcom troy wecker writeseach valentine is hand tuned to maximum performance is all the radar bandsof coverage this of course adds to the labor cost and in turn the cost of theuniti live in the backyard of the folks who make the stalker radar system thevalentine has saved me many many many times from the stealth revenueenhancement traps of the local area i have had all the major brand detectorsand imho nothing else even comes close to the vi dont work for valentine i am just a satisfied user of their unitif you really want the nitty gritty details on all this call the nice folksat valentine research they will be more than happy to explain their perspective on radar detection and analysis methods the calls free atit seems that there are more and more bands available forpolice radar each month i have recently purchased withinthe last months the bel stw while it is not a perfectdetector by any means it does do the job fairly well now however i pick up a car magazine at the airport andread about this super ka wideband which is a superset ofthe ka wideband that this latest generation of detectorswas touted as covering so now bel has a new series of detectors out that cover allthe usual bands x k ka photo ka wideband as well as thenew super ka wideband just as there comes a point of diminishing returns when chasingincreased pc computing power with faster and faster cpus forthe average home consumer at least it seems that there isnow the same concern with radar detectors does it make senseto upgrade just months after purchasing my new detectoris valentine upgrading their equipment if so it might be worth it for me to upgrade to the valentine i was in the market for a valentine when i purchased the bel but the month waiting time was just too much for me since i hadinadequate protection with my passport life was much simplerwhen there was just x and k band and escort has the bestequipment on the market and there was no need to continuouslyshop for a new detector i hope that the flood of new radar bands ceases with this new super wideband business allen tobias technical email convex computer corp marketing tobiasconvexcom waterview parkway richardson tx no one cares how much you know until they know how much you care david w hwang md davidganglionannarbormiusfrom homicsdcsduwmedu sammysubject car tinting shello againanyone here done any tinting work what are the best brands out therehow about applicationsi heard there was a water based brand that syou can move around till its just right and you then let it dry like thatalso i would consider having it professionally done how much aroundwisconsin or chcago area that does a decent job fairly cheap college kidthanks for all the infops what is the maximum legal tint limithomicsdcsduwmedufrom adammicrowarecom adam goldbergsubject re choice of gaugesin article cyboeivcdhpcom dmunroevcdhpcom dave gauge writesif you had free reign to design your own instrument cluster whichgauges would you choose to have beyond the basic setoil pressure oil temperaturecoolant temperaturemanifold vacuumammeter voltmeterfuel pressure maybe problematic since you either need an electronicsensorgauge pair or you have to mount the damn thing outside the carin addition itd be nice to have a big red idiot light check guagesconnected to oil pressure oil temp coolant temp ammeter voltmeter with heaps of guages its hard to look at them all allthe time in the case of oil pressure for example you want to knowright away if your oil pump goes bad unlike coolant temperature aminute or two of oil pressure would be a very bad thingtmadam adam gadamgmicrowarecom or uunetmcrwareadamgthe above is not to be construed in any way as the official or unofficialstatements of microware or any microware employeesfrom callisonuokmaxecnuoknoredu james p callisonsubject re super mega automobile sightings exotics togetherin article cxpkjbconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writesin article rfqinnkphantomgatechedu grahamtphantomgatechedu graham e thomas writesjmmhvirginiaedu the blade runner writessighting of such a fine beast but remember the mustang willforever be the true king of the road especially the shelbyamerican gtkr king of the road so namedto steal gms planned camaro king of the roads thunder and maybe the mustangwill be forever king of the road the gt isnt road legali think the gt actually is street legal although that particularquestion is moot see the price figures belowsome gts are street legal some arentthis car was right hand drive werent they all like that how much doesa gt go for how many were madei found my shelbyamerican guide there were a grand total gtsbuiltgt coupesgt road carsgt mk iigt mk iiis gt roadsters mirages gt mk ivs total additional uncompleted mk iiistwelve of these cars were prototypes racing coupes road coupeseight mk ii coupes lhd mk iiis and rhd mk iiis the other breakdowns follow the above list eg were mk ivs the lhdrhdbreakdown is only given on the mk iiisthe prices for those which can be bought are around the millionmark last i heard with a projection of some million orthereabouts in it was second only to some pennyante ferarri shelby won the fia world manufacturers cup with his cobras in thatwas also the year that he retired them from the shelbyamerican racingteam in favor of the ford gt program the next year that victorybroke a year ferarri winning streakwell theres lotsa info i could spout but ill refrain much ofthis information comes from hot rod magazines shelby americancobramustang guide which has more info on the shelbyamerican fords than you could ever want to knowjamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom zorropicassoocistempleedu john grabowskisubject re taurussable rotor recallantonio l balsamo save the wails balsamostarglenetdeccom wrote from opdbsvmcclatechedu subject taurussable rotor recall my taurus gl with only k on the clock also has rotor warp apparently they havent fixed the problem yet but try convincing the ford service person to fix it for freeright tonygads i have heard so many horror stories with taurus and sable cars i thoughtthese were premium american automobiles the way they sell youd think sois ford really no better than in the late s when it was turning out tincans like the granada and the fairmount which would you get a taurus or a camry or accordjohnzorropicassoocistempleeduzorroastroocistempleedufrom rwfnscclehighedu robert william fusisubject re im getting a car i need opinionsin article aprnscclehighedu ipnscclehighedu danny phornprapha writesi have as my budget im looking for a sports or gt carwhat do you think would be the best buy im looking for specific modelsthanksdanny id say an rx would be right up there you could easily deal down to it has some of the most impressive performance figures around and automotive magazines eat it up one car to seriously consider in that price range rob fusi rwflehighedu from boylecactusorg craig boylesubject re new integra for in article cyptdtsegwtsecom pbhandartsegwtsecom parminder bhandari writesive heard unconfirmed rumours that there is a new integra being releasedfor well you can just about set your watch by honda releasing new models every years and an upgrade half way through the cars life the local acuradealership tells me that the new integra will be out very soon ie mayjuneits hard to find specific details as the integra has been deleted frommost of the rest of the world i have seen them in canada and australiaas well as the us but it was discontinued after the first generationin europe normally you can see new japanese models appear in europeor japan first and extrapolate from there cd reported that the enginewould be a carryover i thinkcraigdoes anybody have any info on thisthe local sales people know as much as i can throw themparmsstill no sigfrom callisonuokmaxecnuoknoredu james p callisonsubject re the mustangin article czzdktmentorccpurdueedu marshattfeserveccpurdueedu zauberer writesdisclamer this is not a flame if you anger easily please go onpetebreelofiitedu brenta peterson writesthe next mustang will be fords highest profile car it attractsway more attention than the camarofirebird because its heritageis more embedded in the general public dont lie to yourself andbelieve ford will forfeit thatfyi they already didoh really whentoo bad that the current mustang cant even compete with the newcamaro without using an active imaginationthe mustang cobra can check it outright now few cars can compare with the camaro think about it for a car that will out perform all but a few exoticsif you are now swearing at me look at the statsthey dont lie there are no comparable cars in its class certinaly not for its priceehhhh maybe the mustang cobra does a good job for a lower priceand its just a taste of whats ahead in the th anniversary ofthe original pony carunless the ford gets the v hp romeo you dont seriously believethat it was designed for the mark viii only do youhey can you imagine the potential of a modified ltfolks in a few years we will surpass the levels of performance achieved in the late s thats scaryjust think corvettes are almost up to the performance levelsof a cobra wow in a few years they might be up to theperformance levels of a ford gt wow man just thinkabout it jamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom amhnscclehighedu alois m himslsubject re bmw iin article aprultbiscritedu adnritvaxiscritedu writesi looked at that bimmer yesterday its an has about kmi accordingto owner odometer stopped working at kmi drivess well sounds goodbody is ok he wants i liked the car despite its auto tranny but my wife will be a primarydriver on this one and she wants autothe radio does not work untill the car warms up and you honk the horn the ac seems to have a leakthe sunroof is sticky but operationalodometer does not work as mentioned beforeidle is a bit bouncy going from rpm to rpmwipers are slowthats teh gripes the owner says that he changed radiator alternatorrotors and calipers exhaustthe biggest problem is that the owner is a shifty sob telling strangestories i hate that i would never buy from a persom like that except howoften you see a descent i for that amount of money he also said thatalthough i could bring a mechanicin he wouldnt let me check the car by takingit to a garage suspicious and who knows what milage is on itso let me know what to check for given theres practically no rusti know there was an article on i in rd a few years back anybody rememberswhat issuemikesdont buy it all of the things you mentioned will just give you headacheslater on also it sounds like the car needs a lot of work and as you probablyknow bmws are not cheap to fix either the owner sounds like a shadycharacter just trying to take advantage of someone sure sounds goodbut you should calculate how much the repairs will be it sounds like youwould have to sink in at least to get everything fixed if not morealso never trust anyone as far as mileage is concerned who knows how manymiles are on it and how it was driven sure people tell you bmws hold up butyou have to consider any car is subject to wear and tear for all you know itcould have miles on it the thing you have to remember is that thisisnt the last i around either just wait and keep shopping for around you can probably find one that is better needs less repair and haslegitimate mileage unlike the one you are considering take it from a guy whohas been taken a couple of times good luckal himslfrom callisonuokmaxecnuoknoredu james p callisonsubject re the mustangin article otnmbwwcybernetcsefauedu vlasiscybernetcsefauedu vlasis theodore writesi can put a valve v with twin garrets on yugo and get sec qmthats useless its still a yugo that will loose any race on a trackor on the streeta yugo that will go mi in seconds will not lose on thestreet thats just too damn quick it might be wrapped arounda telephone pole at the end of that quarter mile but it willbe there alonehave you detroit beings compared the ultralongthrow stick shifts ofthe with the mr turbo or rx i ll buy it in mos or you could replace the stock shifter with a hurst shortthrowshifter available from ford motorsport or any number of otheraftermarket products to boost the performance of a mustang orcamaro can you do that with a rx or verily with anymr with the detroit aftermarket you can build a mustang orcamaro which is superior to either car you mention for less thanthe sticker price of eitheror the torsen differential of the rx compared to the differential of the that sounds in every hairpin turn well gee it works and it doesnt break it transmits power tothe drive wheels and its essentially zero maintenanceand theresan aftermarket in parts for ford and chevy rearends tooand bythe way and camaro both have drums on the rear breaks hello this is the s well the mustang cobra which from all reports uses thesame running gear as mustang has wheel disks i cantspeak for the new camaro but i think it does tooalso stop and think about the markets here the mustang is andalways has been a massmarket sporty car thats where thepony car class came from with a performance model thatswhy it has the econobox running gear that was also factoredinto the design of the mustang from the day lee iacocca conceivedhis baby it was designed as a widemarket carsporty yet accessiblewith room for performance tweakingthe cars you listed are designed for a specific market nicheand they both fit those niches very well the mustang at leastdoes well in multiple markets i cant speak for the camarojamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom asdchacadalaskaedusubject re last of the v interceptors mad maxtony i believe first of all that maxs car is an austrailianbuilt car i dont think its a chopped up us unit it may be called akangaroo or roo or something similarnot sure but i do recall readingthat austrailian cars used ford v engines the ford v interceptoris i think a ci cop car motor whatever the case that small carwith a screaming big block ford would probably smoke the tires formileskilometers i hope someone out there can elaborate on the subjectsmoke em hard smoke em fast laterdavid hertrich lincoln continental cifrom jdroutscottskidmoreedu jtd is lostsubject re what car is thisdeloreans never had a factory v they were considering productionwith a turbo or twin turbo i forget version of the standard v asto who produced it you got mejonathanjdroutscottskidmoreedufrom boylecactusorg craig boylesubject re the mustangin article cmuxbprconstellationecnuoknoredu callisonuokmaxecnuoknoredu james p callison writesin article czzdktmentorccpurdueedu marshattfeserveccpurdueedu zauberer writesdisclamer this is not a flame if you anger easily please go onpetebreelofiitedu brenta peterson writesthe next mustang will be fords highest profile car it attractsway more attention than the camarofirebird because its heritageis more embedded in the general public dont lie to yourself andbelieve ford will forfeit thatfyi they already didoh really whentoo bad that the current mustang cant even compete with the newcamaro without using an active imaginationthe mustang cobra can check it outso you think a mustang cobra can match the performance of a new zinteresting belief craigwho neither owns nor wants to own any gm or ford productcraigfrom cfclevelandfreenetedu chunhung wansubject re im getting a car i need opinionsin a previous article ipnscclehighedu danny phornprapha saysi have as my budget im looking for a sports or gt carwhat do you think would be the best buy im looking for specific modelsthanksdanny hey you programmers out there danny phornprapha please consider this iplehighedu bugs are another endangered earth lucc student konsultant species needing your protection work for an all out sports car id go for the rx without the sportssuspension which is too stiff for a little more practicality and morecomfort the nissan zx turbo is a good buy and for a good dose ofluxury the lexus sc is perfect with a manual transmission of course however the toyota supra is coming out soon and if you like its looksthe performance is supposed to be great almost race car like i dontparticulary like the mitsubishi gts or the dodge stealths as they aretoo heavy and arent very nimble handlers for a sports car a motion picture major at the brooks institute of photography casanta barbara and a foreign student from kuala lumpur malaysiathe mind is the forerunner of all statesfrom brothermrcnextcsouiucedu jesse mccabesubject theres rust on my beamer helpactually i wasnt too surprised since i bought it with the rust any of you got some ideas of getting rid of this cheaply key word it has eaten all theway through on the door panels can i use bondo also is there a good paint that will bond to aluminum rims the paint thatiwas on my rims has peeled off actually theres some rust looking stuff onthe rims themselves but it comes off pretty easily one more thinghave any of you done selfpainting to a car how do you start what do i needto do this please help mejessefrom mchaffeedclnxt michael t chaffeesubject re chryslers compact lh sedansckauxacsouiucedu carolinafanuiuc writesshoppaalmachcaltechedu tim shoppa writesi thought that the v was originally designed for a truck not necessarilya pickup and then just sort of dropped into the vipers frame becauseit fit and was available a friend of mine and i saw and heard a viperand my friends first response was that it sounded like a truck it soundedfine to me but then again i dont like the whiny noise that most modernsports car engines make btw the viper we saw was moving at about mphjust like all of the other cars on the freeway heading east out of laon a friday afternoon looked really nice thoughactually i was under the impression that the v in the viper wasnot the v that dodge was developing for its new kenworths i have alwaysthought it was the exhaust system and not the engine that produced the noiseof a carwell yes the exhaust is where the majority of the noise comes out but thebasics tone firing cadence etc are determined by the engine configurationin the case of the viper yes we are discussing a huge multicylinder degengine which will sound somewhat like a truck and my understanding btw isthat that v engine was designed originally with the intention of being adaptible for either the trucks or the viper and from what ive heard no firsthand knowledge its doing a pretty good job at bothand the best exhaust sound in the world is now and will always be a degreedohc colombodesigned v periodmichael t chaffeemchaffeeuxcsouiuceduemailmchaffeesumtercsouiucedunextmailsig under constructionexcusefrom skukretichemicalwatstaruwaterlooca sanjai kukretisubject advice on used carhi i was looking for some helpful adviceim a university student with about to spend and im looking for a used car does anyone have any useful advice they could offer to a firsttime buyer im not looking for anything sporty just something functional and reliable less maintenance costs anybody have any ideas on what models might suit methankssanjaifrom tedebearlelandstanfordedu theodore chensubject re plymouth sundancedodge shadow experiencesin article bdbdcnewsserviceuciedu ramantranslabitsuciedu balaji v ramanathan writesthe part about spending on repairs reminds meof an article i read in a magazine comparing the year ownership costsof a toyota camry and a ford taurus or something like that the resultwhich they announced with great flourish was that it cost the same at theend of the period that was their argument to prove that you dont gowrong buying the ford taurus over the camrynow if i remember correctly the camry costs about or so morein initial costs essentially it means that you spend about extraon repairs on the taurus that is ridiculous every time your carneeds repairs it is extra hassles loss of time and a dozen other thingsi would much rather spend more in initial costs than spend morein repair costsdid you account for depreciation i seriously doubt that a tauruswould rack up an extra in repair costs over yearsteddyfrom aaspocwruedu andrew a spencersubject re wife wants convertiblein a previous article nuetkeptsmotcom keith nuetzman x p sayshelpmy wife has informed me that she wants a convertible for her next carwe live in south fla so we are definitely in the right are for onemy wife has mentioned the miata but i think it is too smalli would like to wait for the new mustangs dec i thinkanyone have any opinions on anyall convertibles in a reasonable price range thanxgeo metro lsidrewfrom aaspocwruedu andrew a spencersubject re too fastin a previous article callisonuokmaxecnuoknoredu james p callison saysin article qnevgusenetinscwruedu aaspocwruedu andrew a spencer writesin a previous article wratunisqluucp wharfie saysin article qkonrearmorycenterlinecom jimfcenterlinecom jim frost writeslarger engine thats what the sho is a slightly modified familysedan with a powerful engine they didnt even bother improving thebrakesthat shows how much you know about anything the brakes on thesho are very different inch or i forget discs all aroundvented in front the normal taurus setup is smaller discs front drums rearone i saw had vented rears tooit was on a lotof course the sales man was a fooltitanium wheelsyeah rightthen later told me they were magnesiummore believable but stillcrap since al is so m uch cheaper and just as goodi tend to agree tho that this still doesnt take the sho up to standardfor running on a regular basis the brakes should be bigger like or sotake a look at the ones on the corradoswhere they havebraking regulationswell lets seemy tbird sc has a computercontrolled adjustablesuspension wheel abs disks vented front rear pointbelts sturdy passenger compartment aerodynamics good enough for nascar without too much change hp ftlb supercharged l vwheel independent suspension plus limitedslip differential with a top speed in excess of mph and rides on vrated tires i have yetto find rs in any other speed rating is that up to standard if not why notjamesjames i really hate to do this but try reading the damn postsnever was a tbird mentioned the discussion was about shos andstangs not being up to spec i do not know about tbirds ionly know that the specs quoted for the sho by previous poster soundeda little anemic for me to say that it was up to snuff this does notin any way disencourage me from wishing to own one nor does it make ita bad car it merely means that i think ford could have added that extrabit of safety and tossed in larger brakes as the wheels are plenty largeenough for them to fit if memory serves right which it may very well notand the motor plenty powerful enough to need itc yadrewfrom mchaffeedclnxt michael t chaffeesubject re warningplease readmatmcinnnusccnussg matthew macintyre at the national university of senegal writescallisonuokmaxecnuoknoredu james p callison writes im not going to argue the issue of carrying weapons but i would ask you if you would have thought seriously about shooting a kid for setting off your alarm i can think of worse things in the world glad you got out of there before they did anything to give you a reason to fire your gun i think people have a right to kill to defend their property why not behonest do you really care more about scum than about your cari cant tell if matt is being sarcastic here or not but to be honest manyautomobiles are worth far more to their owners in value and investmentthan the people that would take them i dont have figures on average propertytax in the us or how much of it is allocated for housing projects inferiorpublic schools jails or the like but i have a feeling that the amount thegovernment steals from an honest productive citizen to breed this trash is significantly less than the value of many automobiles and for those who willargue that the animals out there stealing cars and everything else not tomention committing completely senseless acts of violence such as rape cannotbe valued in terms of money because they are human beings i submit that theyare not human beings jim callison i think is on the right track and chintan amin remarked earlier that we cannot blame environment for the actionsof a single criminal i couldnt agree more one could trace any crime backto the environmentupbringing of the criminal should we let all of them outfrom pickpockets to rapists to inside traders because what they did wasnttheir fault where does one draw the linemichael t chaffeemchaffeeuxcsouiuceduemailmchaffeesumtercsouiucedunextmailsig under constructionexcusefrom mchaffeedclnxt michael t chaffeesubject re viperrmtrfaradayclasvirginiaedu roy matthew thigpen writeslast night i had a dream that my dad bought a viperi took it out for a test drive without his knowledgeand had to push it all the way home just to avoid a ticketwierd dream i wonder what it meansvelllets seevas you muzzah in der passenger seat or vas you muzzah inder leefing room vit you fazahmfeeling a tad bit freudian doubtless inspired by the magnificent phallicnesssome word of the viperfrom callisonuokmaxecnuoknoredu james p callisonsubject re warningplease readin article aprnusccnussg matmcinnnusccnussg matthew macintyre at the national university of senegal writescallisonuokmaxecnuoknoredu james p callison writes im not going to argue the issue of carrying weapons but i would ask you if you would have thought seriously about shooting a kid for setting off your alarm i can think of worse things in the world glad you got out of there before they did anything to give you a reason to fire your gun i think people have a right to kill to defend their property why not behonest do you really care more about scum than about your caryo watch the attributionsi didnt say thatagain this isnt an appropriate forum for discussions on whether youshould shoot someone for property damagevandalismtheft but everyresponsible gun owner realizes that there are limits and the punishmentmust fit the crime i mean think about itis a really harmlessprank worth killing overas i said the situation described punks setting off alarms andtaunting people to come out could turn very ugly very quickly andit is worth being prepared when your life is potentially on the linejamesjames p callison microcomputer coordinator u of oklahoma law center callisonuokmaxecnuoknoredu callisonaardvarkucsuoknoredu disclaimer im not an engineer but i play one at workthe forecast calls for thunder tbird sc its a hell of a thing killing a man you take away all he has and all hes ever gonna have will munny unforgivenfrom mchaffeedclnxt michael t chaffeesubject re manual shift bigotseliotlanmolaengrwashingtonedu eliot writesin article cliwcaxnewsrichbnrca peon wo email eric youngblood writesin article qnlocsvelaacsoaklandedu mjepookiepasswayneedu michael j edelman writesthe big disadvantage of automatics is the hp they consume that nevergets to the wheels in this respect they are at a disadvantage to a manualonly when the torque converter is not locked up there are autos out therewith converter lock up in nd rd and th gearswrt performance converter lockup is purely irrelevant the lockup onlyoccurs at light throttle settings and serves only to improve mpg mind youa converter clutch does a lovely job of improving mpg but the additionalmechanical advantage of the converter gives you more acceleration vs lockedconverter clutch than its inherent losses take awaymichael t chaffeemchaffeeuxcsouiuceduemailmchaffeesumtercsouiucedunextmailsig under constructionexcusefrom gyubbncom george yusubject re the kuebelwagenthwangmentorccpurdueedu tommy hwang writessorry for the misspelling but i forgot how to spell it after my series of exams and noon hand reference hereis it still possible to get those cute wwii vw jeepwannabesa replica would be great i think tkh according to the complete guide to specialty cars th edition fromcrown publishing its the vw kubelwagen w dots over the uthe company is wolfkam po box vika oslo norway voice line fax linean excerpt from the blurb this fine kubel clone from wolfkam is a very close copy of the original and offers the same allweather and crosscountry capabilities as its wwii forebears the robust fiberglass body kit is very complete and includes all the hardware you will need except for your own vw donor car the phone number is the entire att dialing sequence call and ask for karl torum or send cash or international money order for a complete literature packagegeorgeps id be happy to share what info i have on other kit cars and kit car manufacturerspps im looking for a used or partially completed porsche speedster convertible d replica from intermeccanica id appreciate any leads or advicestories from any owners out therefrom nhensonccwwuedu barrybsubject re plymouth sundancedodge shadow experiencesdaubendrnextworkrosehulmanedu darren r daubenspeck writes they are pretty much junk stay away from them they will be replaced next year with all new models junktheyve made the cd lists for years due to their excellent handling and accelerationthey have been around since about oh or so theyre not the newest on the lot and mileage is about five to eight mpg under the classleader you can get into a l v hp shadow for k the i turbo a bit more and a droptop for k how can car be any good that has s n a c u d n ewritten on the back with crooked letters as if a yearold hadwritten it hehhehehehahahaabout as silly as cryslers attemps to make the label on the backof some of their other cars appear like they are mercedessorry i couldnt resistbarrybfrom klfdruwaattcom franklinklsubject re v v v v vxin article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writes ckauxacsouiucedu oriolefanuiuc writes aaspocwruedu andrew a spencer writes i think that it is technicaly known as a degree vee configuration could be wrongthis is how ive seen them referred to then what is a flat engine flat deg v horizonatlly opposed usually it also equals boxer however i think the term is traditionally reserved for s and s and firing order matters this was talked about here in ra many months back i cant remember the consensus examples ferraris tr is a flat boxer porsches is a flat subarus impreza is a flat regards not to inject a nonautomotive note to this thread but the bmw opposedtwin used in motorcycles for a long time is and always has been known asa boxer ken franklin they say theres a heaven for people who waitama and some say its better but i say it aintgwrra id rather laugh with the sinners than cry with the saintsdod the sinners are lots more fun yknow only the good die youngfrom crhregentetechniktumuenchendbpde christian huebnersubject re last of the v interceptors mad maxasdchacadalaskaedu writestony i believe first of all that maxs car is an austrailianbuilt car i dont think its a chopped up us unit the last v in mad max is based on a holden australia holden islinked with gm vauxhall gb and so theyre quite unlikely to use ford partschris crhregentetechniktumuenchendefrom klfdruwaattcom franklinklsubject re v v v v vxin article aprengrwashingtonedu eliotlanmolaengrwashingtonedu eliot writes in article aprmagnusacsohiostateedu bqueisermagnusacsohiostateedu brian j queiser writes examples ferraris tr is a flat boxer porsches is a flat subarus impreza is a flat i think you got it the other way round the ferrari flat is a degree v and not a true boxer while the subaru and porsche are true boxers dont know about the vw bug though but i suspect that it is also a true boxer eliotare you serious the auto that had a lot to do with bringing the termboxer to the popular forefront was the ferrari berlinetta boxeror the bb had a liter opposed cylinder engineken franklin they say theres a heaven for people who waitama and some say its better but i say it aintgwrra id rather laugh with the sinners than cry with the saintsdod the sinners are lots more fun yknow only the good die youngfrom mcarronesocbitnetsubject re nissan nomenclature was re manual shift bigots wantedthe european version is called sx and have a liter engine withturbo and have more power than the us version hp it goes from to kmh in sec and have a top speed of kmh milesh i just purchased one new and i am looking for a repair book i couldnot find one in france and germany does anybody knows where to find one is there one in the uk probabaly no use to look in the us as the sx have here a different motori am very pleased with the car and have no problem with it but like to havegood technical documentation about the car i own regardsfrom rxkgreminyosxxrmitozau geof evanssubject re v v v v vxssaveolecdaccom the devil reincarnate writes i am curious about knowing which commericial cars todayhave v enginesv i dont know of anyv legend mr mrv dont know of anyv jaguar xjs please add to the list thanks s ssaveolecdaccom is this a joke geof evans domain rxkgreminyosxxrmitozau if they really wanna knowtell em that god was drunk from pfkcruxcitcornelledu philip f kromer ivsubject does a car wash hurt the cars finishcan taking the car to a car wash hurt the cars finishand if so is it better to hand wash it about once a month or just take it to the car wash anywayare detailing places worth the money if i do a good careful job on washingand waxing is a detail place going to be worth itreply to my email address pfkcruxcitcornelledupkmy views reflect cornells sue them drysubject tires comparisonfrom vpopescopusuucp valentin popescuevei am looking to buy new pr tires r or hr i donthave much to spend but i would like a tire that will last doesanyone have any experience with the following brandsrikenfalkenbfggeneralthere are others but these i can find here for under likei said i am mostly interested in threadwear then speed since ihardly get to drive them over or mph also is it true thatnoone will give you warranty on such tires according toa tire dealerfinally do hr tires last longer than r tires threadwear againor is that strictly a speed factorthanks for any replies whatever doesnt kill me makes me stronger internet vpopesccalstatelaedu bitnet vpopesccslabitnetfrom cstkocrsvdelcoelectcom spiros triantafyllopoulossubject re lexus and infinitiin article issacwis issacwisunomahaedu issa elhazin writesdont the numbers in the car names above refair to the engine size in liters ie ls litre engine sc liter sport coupe and q liter similar kinda to bmw and mb nameing deal issafunny i thought the numbering scheme for both lexus and infiniti wasrelated to sticker price more than anything else ie infiniti g aroundk q around k lexus es rip around k lexus es aroundk etcis there a conspiracy theory there spiros spiros triantafyllopoulos cstkocrsvdelcoelectcomsoftware technology delco electronics gm hughes electronics kokomo in i post therefore i armmfrom kevinhhslrswihaslerascomch kevinhsubject re v enginesin article aprkronosarcnasagov chuckofreudarcnasagov chuck fry writes in article aprllmitedu singerllmitedu matthew r singer writes didnt the saab sonnett have a v i recall someone telling that it was something like of a ford not only the sonett correct spelling but the wagon and sedan used a cc or cc v from ford of germany this particular motor had a degree vee angle a balance shaft and siamesed exhaust ports this motor was later stretched into the v commonly seen in the caprii think it was the reverse the v being of the v the v could make pretty reasonable power for its size but in the saab it made too much torque for the transmission which had been designed for a cylinder strokeit was also the worst engine that ford europe have ever made bloodyawful reputation its most successful application being the transitvansaab gave up with this motor and then made the triumph half a stag v under license i believe but with litre capacity and perhaps a differentarrangement for the cylinder head studs before developing their own straight four from the triumphkevinhhaslerascomchfrom jmhhoppervirginiaedu jeffrey hoffmeistersubject re impala ss going intoi still cant understand all the hype about the impalla ss it still hasthe ugly caprice body orca on wheels the caprice was the worst newbody style to come out of detroit ever now just because the lt engineand a few suspension tweeks are being addedits still ugly its still a barge gms answer to everything is throw ina v and someone will buy it or add some plastic ground affectsand a few stickers and call it a gt gtz or ss and someone will buy itimho gm needs to scrap the caprice body completely and start over with ablank sheet of paper no minor modification wheel well treatments tailamp modification or nose redesign or even the lt engine will helpthe existing capricejefffrom eliotlanmolaengrwashingtonedu eliotsubject re best radar detector valentinere extended ka bandsi recently bought a band detector you guys must all think imnuts right well i did a little research into ka usage in thisarea and found out that ka is not currently being used in this stateas well as surrounding states heres how i found out a cop friend who did spend time nailing speeders doesnt even know what ka is hes heard of k which is what they use here and i explained that ka is used for photo radar etc he then said yeah ka stands for k automatic duuhh he then went on to say that plans were being made for getting laser guns as far as going high tech were concerned but he didnt know too much my year old band whistler was consistently going off at speed traps even the real sneaky ones when i called the escort shop they confirmed that ka is not used here or in surrounding states they did claim that laser was being used a lot here which i was quite skeptical ofso in the end instead of spending a lot of money andor waitingmonths for a state of the art detector i got a low priced highperformance band escort incidentally its performance is equalto their top of the line model in x and k band detection i know thatescort has been surpassed by other brands lately but ive never fullyrelied on a detector and i was convinced that the escorts would be atleast quite good which was good enough for me and my walleteliotfrom johnsonspectracom boyd johnsonsubject re automotive crash test performance and maintenance statsi wroteis there a resource available to the consumer comparing all of the makesand models of automobiles trucks vans etc for survivability in acrash of different severitiesalso ive found very little objective data comparing differentvehicles for handling pickup braking expected maintenance etci recall years ago consumer reports annual buyers guide was much moreinformative in those aspects than it is nowthanks to a reply from someone i looked a little further and found whati was looking for the april cr magazine has most of the above thingsdespite recent articles here the ratings looked pretty good forrelative comparison purposes unfortunately the crash test comparisonsdidnt include half of the cars im comparinganybody know how honda civic hatchbacks and toyota tercels fare inan accident boyd johnson noscspectracomjohnson san diego california intermittent newsfeed at best and only to selected groupsmy opinions certainly dont match those of my employerfrom markmbigfootspsmotcom mark monningersubject re car buying story was christ another dealer service scamin article aprslcsslbcom dcdsehoustongeoquestslbcom dan day writes in article aprnewsgatespsmotcom rapwemailspsmotcom writes before you go in find out the invoice prices of the car add a reasonable profit for the dealer offer them that price and stick to it whoa watch your terminology dealer invoice is not dealer cost thats probably true but its the closest to it that youre going to get the actual dealer cost depends on a lot of things and even the dealer probably doesnt know exactly what it will be until all the factory kickbacks incentives etc are paid and that often depends on his volume at the end of the monthquarterwhatever it might be a funny munber but its all you have to start with except the sticker and anyone who pays sticker price is really being ripped offmarkfrom mobasservuvlsieevilledu bijan mobasserisubject re v v v v vxwe have seen lots of discussion on automobile engine configuration let me ask a similar question from the aviation field you must have seen images of prop planes with all cylinders exposed i have seen up to cylinders positioned radially in a circular fashion with the prop at the center of the circle this arrangement always brings up a geometric dilemma how can one crankshaft throw accomodate rods or are the pistons displaced but not visible from the outsidebijanfrom sontakkehelixenetdeccom vikas sontakkesubject re review ford taurus shoin article kfrewcwaqwttandrewcmuedu sam swett ssbcandrewcmuedu writes one more way which works in manual trans cars ive driven and it is mypersonal favorite the other suggestions above are great but try thisone too while pushing the shifter gently towards reverse let the clutch outslowly right to the friction point and the shifter will be pulled intoposition if you do it right the car wont jump backward nor will thegears grind you will just glide back sami can vouch for this method in my sho this is the only sure way of putting in the reverse without any problem every timevikas sontakkedigital equipment corporation maynard mainternetsontakkehelixenetdeccom uucpdecvaxucbvaxallegradecwrlhelixenetsontakkesontakkehelixenetdecwrldeccomfrom etxmststaericssonse markus strobl subject re license plates in article anlolliesolbournecom guerrasolbournecom edi guerra writesi would like to know if anyone still has a copy of the list of license platesthat were posted some time ago regarding special names and sayingsthxsedigme toomarkusfrom straitcheetahcsluiucedu jeffrey c straitsubject bmw partsgreetings automobile enthusiasts can anyone tell me if there isa mail order company that sells bmw parts discounted cheaper thanthe dealershipssorry if its a faq email replies very much appreciatedthanks jeff strait straituicslcsluiucedu university of illinois phone if you ladies leave this island if you survive basic recruit training you will be a weapon a minister of death praying for war from cheekeentartarusuwaeduau desmond chansubject re honda clutch chatter i also experience this kinda problem in my bmw during coldstart ups the clutch seems to be sticky and everytime i drive out forabout km the clutch seems to stick onto somewhere that if i depressthe clutch the whole chassis moves along but after preheating itbecomes smooth again i think that your suggestion of being somehumudity is right but there should be some remedy i also found out thatmy clutch is already thin but still alright for a couple grand morefrom chriscampwpicpittedu chris emersonsubject those nasty insurance people hello everyone i have an insurance questionallstate insurancesituation person wrecks car car is drivable to dealer person reports accident no other cars involved driver estimates damage cost exceedes cost of car insurance people claim car is totalled because of exceeding repair costsperson says wwhhhaatttt but i drove the car here and takes it to another place other place estimates in damage less than the dealerone more hitch the car is registered in florida but the accident occurred in pennsyvaniaquestion should the insurance recognize and pay for the damages of this now fixable car even though they prematurly declared totalledplease respond via email if you think you know anything about this sort of thing chriscampwpicpitteduthanksfrom bobcoscom bob blackshawsubject re ford probe import car of the yearin rirvjflmsuinfoclmsuedu newmancpsmsuedu timothy s newman writesokay okay i know the ford probe is made in the us in fact itsmade in michigan at a mazda plant my question are most of the partsfrom american or japanese sources i have been told that most of the usassembly plants for japanese automakers import almost all of the parts used inthe vehiclesany information anyone has on this will be appreciatedford aimed for us content when they designed the new probe in actualpractice it came out to us content if my is any example the that is imported may be the engine and brakes at least the hadmissybitchy brakestim newmannewmancpsmsuedubobfrom rjwaderainbowecnpurdueedu robert j wadesubject re saturn extended warrantyin article crrwgwaustinibmcom loginaustinibmcom writesive owned a saturn for and year and a half and didnt have the extendedwarranty but just traded it in for a for reasons that i wont mentionunless someone wants to know i opted for the year mile extended with deductible its sorta like buying health insurance you could say thatyoure not sick now and havent been sick for a while but you cant guaranteethat you wont be sick tomorrow a little money invested today is better thanbeing sick tomorrow and now being able to pay for it or having to pay a lotmore tomorrow than you can todayjustify all you want extended warranties are a ripoff high profit item forthe dealer and you didnt buy yrk you get yrk free so what youbought is yrk and you still have to pay every time you use this great warranty better to put your money in the bank and use it for repairsifwhen you need it considering that your last car was only years oldare you sure you will even keep this new one past its free warranty periodbtw typical profit on extended warranties is around thats right only of the money needs to go into the collective pot to pay for any futurerepairs that the group of extendedwarrantypeople collectfrom rjwaderainbowecnpurdueedu robert j wadesubject re the mustangand bythe way and camaro both have drums on the rear breaks hello this is the s vlasis theodoregood point you would think by now that most car companies would just make wheel disc standard and be done with it can it really cost that much morefor disc especially when you think of the economies of scale they would gainby just making them all wheel disc no seperate parts numbers and orders etc btw the z and trans am and formula have wheel disc but the bottomline models have the rear drumsfrom jkjecwestminsteracuk shazad barlassubject re is car saftey important safety is an important criterium for me when buying a car i wont buy a small car like a civic or whatevergreat safety handling speed for me evengreater safety handling speed for the richie merc selfrom cgspsuvmpsuedusubject re changing oil by yourself idiotsin article aprcstulaneedu marklukecraycom markdean saysquit whining on the net about changing your oil yourselvesif you cant handle such a simple procedure as changing youroil then get somebody else to do it and get the hell off thenetwork mdcool off these people have as much right to be here as you dobtw is this the kind of friendly helpful service we shouldexpect from crayfrom nancyhayduke nancy feaganssubject re dumbest automotive concepts of all timein article benseoasysdtnavymil benseoasysdtnavymil ron bense writesin article aprnscclehighedu amhnscclehighedu alois m himsl writesin article aprjpldevvaxjplnasagov nancyhayduke nancy feagans writesashtrays and cigarette lighters these should be an optionyou forget that the cigarette lighter plug is essential for plugging in radardetectors and lights the ashtrays are also essential because they are greatplaces to keep change and tokenswouldnt you rather have some type of standard electrical plug instead of that fire hazard waiting to happen adaptor i know i would and i would also prefer to have sensibly placed cup holders instead of an ashtray my car came with coin holders already built inronexactly you took the words right out of my mouth ron nancy j feagans jet propulsion lab nancyjpldevvaxjplnasagovnot a shred of evidence exists in favor of the idea that life is seriousfrom djanzenkitssfuca dartsubject corolla spdhi there maybe you can help mei have an corolla with a speed as the subject line says the gearboxseems excessivly clunky i used to have an corolla and it was also somewhat clunky but it had more miles on it and it wasnt nearly asbad as this car is there fluid in the speed case if there is could itjust be low or in need of a change as i recall only the autos have fluidor am i just mistaken please no flames for owning an import i also havean old dodge but its not in very good shape these daysthanksderekfrom gibbonsafrasersfuca darren gibbonssubject datsunnissan z carswell the opel deal fell throughnow im looking at a datsun z for sale in our local buysell anyprevious owners have any experience with these cars besides lookingfor rustgood compressionlow miles and all the other usual carthings one looks for is there anything special about these cars thati should watch out forhow about things like handlingperformancemileageetc these carslook hot to my eyes at least and bear more than a passingresemblance to the aston martin db zagatosp which has to be oneof the most beatiful cars ever madewhat is the difference between z z z the zx is rather unappealing imho but the other cars are decentthanks againdarren gibbonsgibbonsasfucafrom alungmegatestcom aaron lungsubject re waxespolishesin article aprmagnusacsohiostateedu bbarnardmagnusacsohiostateedu bret d barnard writeswith spring upon us its time to start waxing again i was wondering if anyonehad any suggestions about waxes and polishes i know carnuba wax is often recommended on the net but i was wondering about the colored waxes to cover upsome minor scratches do the colored waxes give on overall good quality shineare they good for the paint or clear coatwhat about liquid glass is it a clear polish which dries clear thus fillingscratches is it good for the paintclear coatplease post with both good and bad experiences and hey lets name names brands here all gimmicks stick with plain ol carnauba wax thats nonabrasiveeagle meguiars turtle wax and a few others are good examplesthe colored waxes just color in the scratches so theyre not so apparent the better approach is to buff minor scratches completelyoff with a cleanermild abrasivenever tried liquid glass although i still have this sample they sentme a few years back aaron from bedintaccuucp deb waddingtonsubject info needed gauchers diseasei have a yr old male friend misdiagnosed as having osteopporosis for two years who recently found out that his illness is the rare gauchers disease gauchers disease symptoms include brittle bones he lost inches off his hieght enlarged liver and spleen internal bleeding and fatigue all the time the problem in type is attributed to a genetic mutation where there is a lack of the enzyme glucocerebroside in macrophages so the cells swell up this will eventually cause deathenyzme replacement therapy has been successfully developed and approved by the fda in the last few years so that those patients administered with this drug called ceredase report a remarkable improvement in their condition ceredase which is manufactured by biotech biggy companygenzymecosts the patient per year gauchers disease has justifyably been called the most expensive disease in the worldneed infoi have researched gauchers disease at the library but am relying on netlanders to provide me with any additional informationnews stories reportspeople you know with this diseaseideas articles about genzyme corp how to get a hold of enough money to buy some programs available to help with costsbasically any help you can offerthanks so very muchdeborah from mcdonaldariesscsuiucedu j d mcdonaldsubject re jiggersin article cupportalcom mmmcupportalcom mark robert thorson writesthis wouldnt happen to be the same thing as chiggers would ita truly awful parasitic affliction as i understand it tiny bugsdig deeply into the skin burying themselves yuck they have thesethings in oklahomaclose my mother comes from gainesville tex right across the borderthey claim to be the chigger capitol of the world and i believe themwhen i grew up in fort worth it was bad enough but in gainesvillein the summer an attack was guaranteeddoug mcdonaldfrom fulkcsrochesteredu mark fulksubject re breech baby info neededin article aprtrentuca xtkmgtrentuca kate gregory writesin article aprcsrochesteredu fulkcsrochesteredu mark fulk writesanother uncommon problem is maternal hemorrhage i dont remember theincidence but it is something like in or births it is hardto see how you could handle it at home and you wouldnt have very much timething you might consider is that peoples risk tradeoffs vary i considera risk of loss of a loved one to require considerable effort inthe avoidingmark you seem to be terrified of the birth processthats ridiculousand unable tobelieve that womens bodies are actually designed to do itthey arent designed they evolved and much as it discomforts us inhumans a troublefree birth process was sacrificed to increased brain andcranial size wild animals have a much easier time with birth than humans dodomestic horses and cows typically have a worse time to give you an ideamy family tree is complicated because a few of my pioneer greatgreatgrandfathers had several wives and we never could figure out which wifehad each child one might ask why this happened my greatgreatgrandfathers were by the time they reached their forties quite prosperousfarmers nonetheless they lost several wives each to the rigors ofchildbirth the graveyards in spencer indiana and boswell north dakotacontain quite a few gravestones like ida wf of jacob liptrap andbaby may you wantedto section all women carrying breech in case one in a hundred or athousand breech babies get hung up in second stagemore like one in ten and the consequences can be devastating i havedirect experience of more than a dozen victims of a fouledup breech birthand now you wantall babies born in hospital based on a guess of how likely maternalhemorrhage is and a false belief that it is fatalit isnt always fatal but it is often fatal when it happens out ofreach of adequate help more often it permanently damages ones healthclearly womens bodies evolved to give birth i am no believer in divinedesign however evolution did not favor troublefree births for humans you have your kids where you want you encourage your wife toget six inch holes cut through her stomach muscles expose herselfto anesthesia and infection and whatever other just in case measuresyou think are necessarymy arent we wroth i havent read a more outrageous straw man attackin months i can practically see your mouth foamwere statistically sophisticated enough to balance the risks althoughi cant produce exact statistics years after the last time we lookedthem up rest assured that we balanced csection risks against other risksi wouldnt encourage my wife to have a caesarean unless it was clearlyindicated on the other hand i am opposed on obvious grounds to waitinguntil an emergency to give inand bear this in mind my wife took the lead in all of these decisionswe talked things over and i did a lot of the leg work but the maindecisions were really hersbut i for one am bothered by your continuedsuggestions especially to the misckidders pregnant for the firsttime that birth is dangerous even fatal and that all theseunpleasant things are far better than the risks you run just doingit naturallyi dont know of very many home birth advocates even that think thata firsttime mother should have her baby at homeim no luddite ive had a section im planning a hospital birththis time but for heavens sake not everyone needs thatbut people should bother to find out the relative risks my wife wasunwilling to take any significant risks in order to have nice surroundingsin view of the intensity of the birth experience i doubt surroundingshave much importance anyway somehow the values youre advocating seemall lopsided to me taking risks even if fairly small of seriouspermanent harm in order to preserve something that is after allan esthetic consideration mark a fulkuniversity of rochestercomputer science departmentfulkcsrochesteredufrom lawrence curcio lcbandrewcmuedusubject analgesics with diureticsi sometimes see otc preparations for muscle achesback aches thatcombine aspirin with a diuretic the idea seems to be to reduceinflammation by getting rid of fluid does this actually work thankslarry c from uabdpodpouabedugila stephen hollandsubject re lactose intolerancein article nghuscharvardedu nghuscharvardedu holeung ng wrote when i was a kid in primary school i used to drink tons of milk without any problems however nowadays i can hardly drink any at all without experiencing some discomfort what could be responsible for the change ho leung ng nghuscharvardeduyou became older and your intestine normalized to the weaned state thatis lactose tolerance is an unusual state for adults of most mammalsexcept for h sapiens of northern european origin as a h sapiens of asian descent assumption based on name the loss of lactase is normalfor you steve hollandgilauabdpodpouabedufrom bennettkuhubccukansedusubject smokers lungshow long does it take a smokers lungs to clear of the tar after quitting does your chances of getting lung cancer decrease quickly or does it takea considerable amount of time for that to happenfrom dougbcommmotcom doug banksubject re blood cholesterol gabe mirkins advicein article pkauinnnqamojoengumdedu georgecengumdedu george b clark writes forget about total cholesterol when assessing health risk factors instead use a relationship between ldl and hdl cholesterol if your ldl is you need an hdl of at least gee what do i do my ldl is only and my hdl is only i must be risking something but is it the same risk as those with very high ldl if your triglycerides are above and your hdl is below the drug of choice is gemfibrozil lopid taken as a mg tablet thirty minutes before your morning and evening mealswhat about exercise and a lowfat diet what are the longterm effects of this drug doug bank private systems divisiondougbecscommmotcom motorola communications sectordougbnwuedu schaumburg illinoisdougbcasbahacnsnwuedu from cliffbusterstaffordtxus cliff tomplaitsubject re sex problemlsalbnyvmsbitnet larry silverberg writesi have question that i hope is taken seriously despite the subject contentproblem my long time girlfriend lately has not been initiating any sexualactivity for the last four months things have changed dramatically to make this shorter summary nothing that i can think of haschanged she suggested we go to a sex counselor but i really dont want to just yetany suggestions would be appreciatedif you think you can help me please contact me by email for further infoplease serious replies onlythanks larrylarrythe subject content is serious as is the questionon one hand you state that things have changed dramatically but at thesame time nothing you can think of has changed your girlfriend seemsto want to see a counselor but you dont id recommend that you examine your hesitation to see a counselor itsa very good environment to examine issues the fact of the matter is your girlfriend has a different perception thanyou the two of you need to address the issue in order to resolve itplease consider going to a counselor with your girlfriend what could itpossibly hurtcliff the paramedicfrom uabdpodpouabedugila stephen hollandsubject re prednisonewhat are the significant long term side effects i have been taking prednisone mg twice a day for a while to control ulcerative colitis it seems like if i reduce the dosage the problem becomes worse at this point i see myself taking prednisone for a long long time perhaps for ever i was wondering about long term major side effects things like potential birth defects arthritis etc i have been putting on weight my face looks puffed and round experience sudden mood swings as i understand these are all short termi second what spenser aden said in reply additionally it is hard to saywhat type of response you are having to prednisone since you did not sayhow long you have been on it patients are generally kept on steroids formonths before thinking about tapering alternatives to daily dosing are every other day dosing in your case mg every other day would be a startanother option if it is not possible to get you off prednisone is to startazathioprine like spenser said you should generally be on another drugin addition to your prednisone like asulfidine a lot of the specificsabout options though depends on severity location and duration of disease as well as histology so take advice off the net for what itis worth i treat patients with uc and crohns an educated patient is a good patient but let your doctor know where the advice came from so thingscan be put in context you should also be a member of the crohns andcolitis foundation of america office info hotlinebest of luck to yousteve hollandgilauabdpodpouabedufrom nyedacnsvaxuwecedu david nyesubject re mental illnessreply to dabbottaugeanelecengadelaideeduau derek abbott are there any case histories of severe mental illness cases remarkablyrecovering after a tragic accident or trauma eg through nobodys faultbeing trapped in a fire and losing your legs say i know of a patient who was severely and chronically depressed and triedto kill himself with a bullet to the temple he essentially gavehimself a prefrontal lobotomy curing the depression david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom nyedacnsvaxuwecedu david nyesubject re cant breathereply to ronrothrosecom ron roth while youre right that the s vertebrae are attached to each otherthe sacrum to my knowledge can be adjusted either directly orby applying pressure on the pubic bone ron youre an endless source of misinformation there are no sacralvertebrae there is a bone called the sacrum at the end of the spineit is a single solid bone except in a few patients who have alumbarized s as a normal variant how do you adjust a solid bonebreak it no dont tell me i dont want to know david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom rousseauaimmunexcomsubject re lactose intolerancein article nghuscharvardedu nghuscharvardedu ho leung ng writes when i was a kid in primary school i used to drink tons of milk without any problems however nowadays i can hardly drink any at all without experiencing some discomfort what could be responsible for the change ho leung ng nghuscharvardedufrom rousseauaimmunexcomsubject re lactose intolerancein article aprimmunexcom rousseauaimmunexcom writes in article nghuscharvardedu nghuscharvardedu ho leung ng writes when i was a kid in primary school i used to drink tons of milk without any problems however nowadays i can hardly drink any at all without experiencing some discomfort what could be responsible for the change ho leung ng nghuscharvardeduoops my original message died ill try againi always understood perhaps wrongly that the bacteria in our digestivetracts help us break down the components of milk perhaps the normal flora of the intestine changes as one passes from childhoodis there a pathologist or microbiologist in the houseannemarie rousseauemail rousseauaimmunexcomplease note that these opinions are mine and only mine from kxgstpittedu kenneth gilbertsubject re smokers lungsin article aprkuhubccukansedu bennettkuhubccukansedu writeshow long does it take a smokers lungs to clear of the tar after quitting does your chances of getting lung cancer decrease quickly or does it takea considerable amount of time for that to happenthe answer to your first question is rather difficult to answer withoutdoing a lot of autopsies the second question is something thats beenknown for some time it appears that within about years of quittingsmoking a persons risk for developing lung cancer drops to that of theperson who never smoked assuming you do not get lung cancer in theinterim the risk to someone who smoked the equivalent of a pack perday for years is around times as high as a nonsmoker stillrather low overall but significant personally id be more concernedabout heart disease secondary to smoking its much more common andeven a small increase in risk is significant there kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from kxgstpittedu kenneth gilbertsubject re cant breathedavid nye nyedacnsvaxuwecedu wrote reply to ronrothrosecom ron roth while youre right that the s vertebrae are attached to each other the sacrum to my knowledge can be adjusted either directly or by applying pressure on the pubic bone ron youre an endless source of misinformation there are no sacral vertebrae there is a bone called the sacrum at the end of the spine it is a single solid bone except in a few patients who have a lumbarized s as a normal variant how do you adjust a solid bone break it no dont tell me i dont want to know oh come now surely you know he only meant to measure the flow ofelectromagnetic energy about the sacrum and then adjust these flowswith a crystal of chromium applied to the right great toe dontyou know anything kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from euclidmrcnextcsouiucedu euclid ksubject re antiviral herbskxgstpittedu kenneth gilbert writesunfortunately it was rather poorly researched and would not be availabletoday if it were just invented keep in mind however that those werethe days when a bottle of coca cola really did contain coca extract anda certain amount of active cocaine times have changed and our attitudesneed to change with them well yes that was a part of my point aspirin has its problems butin some situations it is useful ditto stuff like licorice root takinganything as a drug for theraputic purposes implicitly carries the ideaof taking a dose where the benefits are not exceeded by any unwantedadditional effects taking any drug when the potential illeffects arenot known is a risk assumed by the parties involved and it may be thatin a given situation the risk is worthwhile like prozac for instance prozac has been shown to be theraputic insome cases where the tricyclics fail but prozac hasnt been in usethat long and it really isnt clear what if any effects it may havewhen taken over long periods of time even though it has been testedby present day standards should prozac be taken off the market becauselongterm effects if any are not known imho id say noeuclid kenneth gilbert university of pittsburgh general internal medicine pittsburgh pa kxgstpittedu dammit not a programmer kenneth gilbert university of pittsburgh general internal medicine pittsburgh pa kxgstpittedu dammit not a programmer euclid k standard disclaimers applyit is a bit ironic that we need the wave model of light to understand thepropagation of light only through that part of the system where it leaves notrace hudson nelson universityphysicsfrom jfareisswaterlooncrcom jim faresubject ringing earsa friend of mine has a trouble with her ears ringing the ringing is so loudthat she has great difficulty sleeping at night she says that she hasnt had a normal nights sleep in about months she looks like it too this is making her depressed so her doctor has put her on antidepressantsthe ringing started rather suddenly about months ago she is quickly losingsleep social life and sanity over thisdoes anyone know of any treatments for this any experience copingmechanisms any opinions on the antidepressant drugs jffrom mcovingtaisunaiugaedu michael covingtonsubject re twitching eyelidim surprised nobody mentioned that twitching of the eyelid can be asymptom of an infection especially if it also itches or stingsit happened to me and antibiotic eyedrops cleared it up nicely michael a covington internet mcovingtaiugaedu artificial intelligence programs phone the university of georgia fax athens georgia usa amateur radio ntmi from dyerspdcccom steve dyersubject re fibromyalgiain article apredtsmokecstorontoedu craigcstorontoedu craig macdonald writes it may be extremelycommon something like of the population it is treatable withtricyclic antidepressanttype drugs elavil pamelor why is it treated with antidepressants is it considered apsychogenic conditionno that these drugs happen to be useful as antidepressants is neitherhere nor there steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom dyerspdcccom steve dyersubject re analgesics with diureticsin article ofklvewbavuktoandrewcmuedu lawrence curcio lcbandrewcmuedu writesi sometimes see otc preparations for muscle achesback aches thatcombine aspirin with a diureticyou certainly do not see otc preparations advertised as suchthe only such ridiculous concoctions are nostrums for premenstrualsyndrome ostensibly to treat headache and bloating simultaneouslytheyre worthlessthe idea seems to be to reduceinflammation by getting rid of fluid does this actually work thats not the idea and no they dont work steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom jmilhoanmagnusacsohiostateedu jtsubject re ringing earsin article ncrwatwaterlooncrcom jfareisswaterlooncrcom jim fare writesa friend of mine has a trouble with her ears ringing the ringing is so loudthat she has great difficulty sleeping at night she says that she hasnt had a normal nights sleep in about months she looks like it too this is making her depressed so her doctor has put her on antidepressantssometimes i have a problem with doctors prescribing medicine likethis i of course dont know the exact situation andantidepressants may work but it isnt helping the ringing at all is itthe ringing started rather suddenly about months ago she is quickly losingsleep social life and sanity over thismine started about three years back turns out i have tinnitusbilateral translation ringing in both ears basically if thisis what it is shell probably get used to it it would keep me upand drive me nuts too but nowadays i have to plug both my ears withmy fingers to check to see if they are ringing usually they are butyou get so used to it it just gets tuned out yes this is what iveread about it not just from my own personal experiencedoes anyone know of any treatments for this any experience copingmechanisms any opinions on the antidepressant drugsmillions have it according to my physician you just learn to copewith it like i mentioned earlier by ignoring it it eventuallybecomes unconsciousthe doc also said it could be caused by diet ie too much caffeineand stress but i havent changed my lifestyle much and it just comesand goes it is always there somewhat but now i rarely notice it whenit really kicks inalso it doesnt necessarily mean there is any hearing loss eithercaused by it or causing it i had an ent earnosethroat exam andpassed in fact my hearing is quite good considering i dont take asgood of care of my hearing as i shouldher reaction is normal if it is tinnitus chances are good shellbegin to not even notice it this info is taken mostly from a few experts my own experience andsome readings sorry it was a few years back and dont have anyspecifics handyjtfrom amigancupportalcom mike medwidsubject emphysema questiona friend of mine is going in later this week for tests to see if hasemphysema his lung capacity has decreased over time his father diedof the disease he works in woodworking i believe he has a veryoccasional cigarette perhaps one cigarette a day or even less he tellsme thisive never seen him light up he has some pretty healthylife style habits good diet exercise meditation retreats therapyetc anyhowhe is very concerned with this check up i know reallynothing about the disease i believe it interferes with the liningof the lung being able to exchange oxygen is a diagnosis of emphysema a death sentence if he were to give up smokingentirely would that better his chances for recovery what are some modern therapies used in people with this disease i would appreciate any information thanks amigancupportalcomfrom jfareisswaterlooncrcom jim faresubject re oily skin problemin article aprvaxcstevenstechedu uhwongvaxcstevenstechedu writesi have a very oily skin my problem is when i wash my face it becomesoily in half an hour especially in the nose region is this an illness howcan i prevent it from occuring in such short time is there a cleanser outthere that will do a better job that is after cleaning my face wont becomeoily in such a short timei dont think thats a problem my face is quite oily too i had a moderateacne problem for many years i then found that if i vigorously scrub my facewith a nail brush and soap irish spring twice a day the acne was not a problem i can still leave a pretty health nose print on a mirror after mindont ask but acne is not a real problem anymore jffrom jimzisfeinfactorycom jim zisfein subject re migraines and scansdn from nyedacnsvaxuwecedu david nyedn a neurologydn consultation is cheaper than a scanand also better because a neurologist can make a differentialdiagnosis between migraine tensiontype headache cluster benignintracranial hypertension chronic paroxysmal hemicrania and otherheadache syndromes that all appear normal on a scan a neurologistcan also recommend a course of treatment that is appropriate to thediagnosisdn also since many people are convinced they have brain tumors or otherdn serious pathology it may be cheaper to just get a ct scan then havedn them come into the er every few weeksdn and easier than taking the time to reassure the patient rightdn personally i dont think this can ever be justifiedsigh it may never be justifiable but i sometimes do it evenafter i try to show thoroughness with a detailed history neurologicexamination and discussion with the patient about my diagnosissalted with lots of reassurance patients still ask why cant youorder a scan so we can be absolutely sure aunt millie often getsinto the conversation as in they ignored aunt millies headachesfor years and then she died of a brain tumor aneurysm orwhatever if you can get away without ever ordering imaging for apatient with an obviously benign headache syndrome id like to hearwhat your magic isevery once in a while i am able to bypass imaging by getting an eegmind you i dont think eeg is terribly sensitive for brain tumorbut the patient feels like something is being done as if thehours i spent talking with and examining the patient werenothing the eeg has no ionizing radiation its much cheaperthan ct or mri and the eeg brings in some money to my department slmr email jimzisfeinfactorycom jim zisfein from jimzisfeinfactorycom jim zisfein subject re migraine and exercisejl from jlecherpbsorgjl i would not classify a mild headache that was continuous for weeksjl as migraine even if the other typical features were there egjl unilateral nausea and vomiting photophobia migraines are byjl common agreement episodic rather than constantjl jl well im glad that you arent my doctor then or id still be sufferingjl remember i was tested for any other cause and there was nothing imjl otherwise very healthyjl the nagging pain has all of the qualifications its on one side andjl frequently included my entire right side right arm right leg right eyejl even the right side of my tongue hurt or tingled noise hurt light hurtjl thinking hurt when it got bad i would lose my ability to readthe differential diagnosis between migraine and nonmigranous painis not always important because some therapies are effective inboth eg tricyclic antidepressants such as amitriptylinenonsteroidal antiinflammatory drugs such as ibuprofen othertherapies may be more specific betablockers such as propranololwork better in migraine than tensiontype headachethe most important thing from your perspective is that you gotrelief also please understand that a diagnosis other thanmigraine does not necessarily mean psychogenic i suspect thatorganic factors play as large a role in tensiontype headache as inmigraine slmr email jimzisfeinfactorycom jim zisfein from julkunenmessiukufi antero julkunensubject what about scimedchemistrythere is this newsgroup scimedphysics and there has been quite a lotdiscussion in this group about many chemical items eg prolactincholesterol tsh etc should there also be a newsgroup scimedchemistry antero julkunen dept clinical chemistry university of kuopio finlandemail julkunenmessiukufi phone fax from kturnercopperdenvercoloradoedu kathleen j turnersubject mystery illness with eye problemsa friend has the following symptoms which have occurred periodicallyevery few months for the last years an episode begins with extremetiredness followed by traveling joint pains and stiffness affecting mostly the elbowsknees and hips generalized muscle pains tinnitus and a feeling of pressure in her ears severe sweating occuring both at night and during the day hemorrhaging in both eyes her opthamologist calls it peripheral retinal hemorhages and says it looks similar to diabetic retinopathy she isnt diabeticthey checked distorted color vision and distorted vision in general telephone poles do not appear to be straight loss of peripheral vision many tests have been run and all are normal except for something called unidentified bright objects found on a mri of her brain the onlything that seems to alleviate one of these episodes is prednisone attimes she had been on mg per day whenever she gets down to mgthe symptoms become acute againshe is quite concerned because the retinal hemorrhages are becomingworse with each episode and her vision is suffering none of the docs shehas seen have any idea what this condition is or what can be done to stopit any suggestions or advice would be greatly appreciated thanks in advance kathy turnerfrom cafomenuucp chuck forsberg wakgxsubject re my new diet it works great in article aprinmetcambinmetcom mazurbluefincambinmetcom beth mazur writesin apromenuucp cafomenuucp chuck forsberg wakgx writesgordon your experience is valid for many but not all thefact that you know a few people who have been overweight and arenow stable at a lower normal or just less weight does notcontradict the observation that only per cent can maintainideal weight with current technologyactually the observation is that only of those who seek helpfrom your socalled diet evangelists can maintain their weight ihappen to agree with keith lynch that there are many people who canand do lose weight on their own and who are not reflected in thedismal failure rate that is often quotedwasnt there a study where a researcher asked a more general populationperhaps some part of a university community about weight loss and heshefound that a much higher percentage had lost and maintained in fact adiposity mentions a similar study search for lifeevents in any recent version of adiposity the problem with anecdotal reports about individuals who havelost weight and kept it off is that we dont know what causedthe weight gain in the first place this is critical becausesomeone who gains weight because of something temporary drugeffect life event etc may appear successful at dieting whenthe weight loss was really the result of reversing the temporarycondition that caused the weight gain chuck forsberg wakgx tektronixreedomencaf author of ymodem zmodem professionalyam zcomm and dsz omen technology inc the high reliability softwarev nw sauvie is rd portland or from swkirchsunnrlnavymil steve kirchoefersubject re cant breathegetting back to the original question in this threadi experienced breathing difficulties a few years ago similar to thosedescribed in my case it turned out that i was developing type idiabetes although i never sought direct confirmation of this from mydoctor i think that the breathing problem was associated with thepresence of ketones due to the diabetesi think that ketosis can occur in lesser degree if one is restrictingtheir food intake drastically i dont know if this relevant in thiscase but you might ask your daughter if she has been eatingproperly steve kirchoefer code kirchoeferestdnrlnavymilnaval research laboratory microwave technology branchwashington dc electronics sci and tech divisionfrom jperkskikentcommuucp jim perkowskisubject re jiggersin article ppaebtbigbootewpiedu susanwpiwpiedu susan writes a friend of mine has a very severe cause of jiggers for over a year now they cause him a lot of pain i recently read i dont know where about a possible cure for jiggers does anyone have any information on this i cant remember the name of the treatment or where i read itill probably get flamed for this but when i was a kid we would go tomy uncles cabin on middle bass island on lake erie we always came homewith a nasty case of jiggers large red bumps where the buggers hadburrowed into the skin my mother would paint the bumps with clearfinger nail polish this was repeated daily for about a week or so theapplication of the polish is supposed to suffocate them as it seals ofthe skin all i can say is it worked for us one word of cautionthough putting finger nail polish on a jigger bite stings like hellif i do get flamed for this just put jam in my pockets and call metoastkentcommjperkskialdhfnakronohus and kentcommjperkskilegendakronohussubject teenage acnefrom pchurchswellactrixgennz pat churchillmy yo son has the usual teenage spotty chin and greasy nose ibought him clearasil face wash and ointment i think that is probablyenough along with the usual good diet however he is on at me toget some product called dalacin t which used to be adoctorsprescription only treatment but is not available over thechemists counter i have asked a couple of pharmacists who sayeither his acne is not severe enough for dalacin t or that clearasilis ok i had the odd spots as a teenager nothing serious hisfather was the same so i dont figure his acne is going to escalateinto something disfiguring but i know kids are senstitive abouttheir appearance i am wary because a neighbours son had this wierdmalady that was eventually put down to an overdose of vitamin a fromacne treatment i want to help but with appropriate treatmentmy son also has some scaliness around the hairline on his scalp sortof teenage cradle cap any pointersadvice on this we have tried acouple of anti dandruff shampoos and some of these are inclined tomake the condition worse not bettershall i bury the kid till hes the floggings will continue until morale improves pchurchswellactrixgennz pat churchill wellington new zealand from rogcdchpcom roger haaheimsubject re sex problemlarry silverberg lsalbnyvmsbitnet wrote hello out there she suggested we go to a sex counselor but i really dont want to just yetinteresting does she know you have placed this info request on thenet for the world to see if not how do you think she would reactif she found out why would you accept the advice of unknown entitiesrather than a counselor any suggestions would be appreciatedsee the counselorwell you askedfrom newsaiojscnasagov usenet news systemsubject re oily skin problemin article aprvaxcstevenstechedu uhwongvaxcstevenstechedu writes hi there i have a very oily skin my problem is when i wash my face it becomes oily in half an hour especially in the nose region is this an illness how can i prevent it from occuring in such short time is there a cleanser out there that will do a better job that is after cleaning my face wont become oily in such a short time thank you for any suggestion if this is a disease everyone should have it my skin has always been oily i used to say if i were hot enough you could fry an egg on my oily facei am now yrs old and my skin looks younger im told than some peoplesskin at its still oily i have only a very few tiny wrinkles thankyour lucky stars for that skin from jecwatsonibmcomsubject contraceptive pilla very simple question it seems to me that the contraceptivepill just prevents the ovule to nest in the vagina and forces it tofall every month but it does not prevent the fertilzation of the ovule is it true if yes is there a risk of extrauterinepregnancy that is the development of the ovule inside the fallopiantube jcherbonnierjeczurichibmcomfrom bmdelanequadsuchicagoedu brian manning delaneysubject brain tumor treatment thanksthere were a few people who responded to my request for info ontreatment for astrocytomas through email whom i couldnt thankdirectly because of mailbouncing probs sean debra and sharon soi thought id publicly thank everyonethanks im sure glad i accidentally hit rn instead of rm when i wastrying to delete a file last september hmmm news whatsthisbriansubject re cant breathe updatefrom rginzbergeaglewesleyanedu ruth ginzbergthanks to all those who responded to my original post on this question thefinal diagnosis was stress i did not take her for a chiropractic adjustmentrachel receives all her medical care at keller army hospital since she is amilitary dependant and the army does not yet provide chiropractic adjustmentsas part of its regular health care i am hoping that the arrival of spring break and college acceptance letters will help unfortunatelyshe was waitlisted at the college she most dearly wanted to attend so itseems as though that stressor may just continue for a while meanwhile she is going on a camping trip with her religious youth group forspring break which seems like a good stressreliever to methanks again for everybodys helpadvicesuggestionsideasruth ginzberg rginzbergeaglewesleyaneduphilosophy departmentwesleyan universityusafrom kaminskinetcomcom peter kaminskisubject re what about scimedchemistryin julkunenmessiukufi julkunenmessiukufi anterojulkunen writesthere is this newsgroup scimedphysics and there has been quite a lotdiscussion in this group about many chemical items eg prolactincholesterol tsh etc should there also be a newsgroup scimedchemistryits got potential instead of chemistry how about splitting theclassification into biochemistry which are probably the topicsyoure thinking of and pharmaceutical which otherwise might end upin biochemistrythis is separate from the issue of whether there is sufficient potentialnews volume to support either or both groupsill add em to my medicalhealth newsgroup wish list which im lookingforward to posting and discussing but not for another days or sopetefrom shaferrigeldfrfnasagov mary shafersubject re inner ear problems from too much flyingon apr gmt vidamdavcrmdaca vida morkunas saidvida can one develop innerear problems from too much flying i hearvida that pilots and stewardesses have a limit as to the maximumvida number of flying hours what are these limits what are thevida main problems associated with too many longhaul over hoursvida tripsthe crew rest requirements are to prevent undue fatigue the cockpitcrew pilot limits are somewhat more stringent than the cabin crewlimits for this reason crew rest requirements address amount of timeon duty plus rest time a tired crew is an accidentprone crewthe only limits i know of for innerear problems are in militaryaircraft which are frequently unpressurized or less reliablypressurized not being able to clear the ears renders aircrew membersdnif duties not involving flying or grounded until the ears clearflying can accentuate problems if ears dont clear if you dont havebig pressure changes you may not know that youve got a problem butif you zip up to or ft the usual cabin altitude in anairliner and then back down to sea level you may discover a problemears dont clear readily because of allergies colds infections andanatomical problems the last wont change the first three canmedication decongestants or antihistimines usually can helpchewing gum sucking hard candy or a bottle for babiesyawningthese will help all four causesmary shafer dod kotfr nasa dryden flight research facility edwards cashaferrigeldfrfnasagov of course i dont speak for nasa a mig at your six is better than no mig at all unknown us fighter pilotfrom kxgstpittedu kenneth gilbertsubject re contraceptive pilljecwatsonibmcom wrote a very simple question it seems to me that the contraceptive pill just prevents the ovule to nest in the vagina and forces it to fall every month but it does not prevent the fertilzation of the ovule is it true if yes is there a risk of extrauterine pregnancy that is the development of the ovule inside the fallopian tube actually that is not how the pill works but it is how the iud worksthe oral contraceptive pill actually prevents ovulation from occuringby providing negatve feedback to the pituitary gland and thus preventingthe lh surge that normally occurs at the time of ovulation with the iudwhat happens is that fertilization may occur but the device preventsimplantation within the wall of the uterus not the vagina kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from bytorcruziosantacruzcaussubject lupusi have a friend who has just been diagnosed with lupus and i know nothingabout this disease the only thing i do know is that this is some sort ofskin disease and my friend shows no skin rashes in fact they used a blood test to determine what had been wrong with an on going sacroilliac joint problem i am finding a hard time finding information on this disease couldanyone please enlighten me as to the particulars of this disease please feel free to email me at bytorcruziosantacruzcausthanks in advancefrom bbeslerouchemchemoaklandedu brent h beslersubject is an oral form of imitrexsumatriptan available in casumatriptanimitrex just became available in the us in a subcutaneousinjectable form is there an oral form available in ca a friendyesreally not me has severe migranes about times per week welive right by the ca border and he has gotten drugs for gerd prescribedby a us physician and filled in a ca pharmacy but not yet fda approvedin the us what would be the cost of the oral form in ca also ifanyone would have that info thanksfrom jmetzaustinibmcom subject re twitching eye i had this one time i attributed it to a lack of sleep since it disappearedafter a few nights of good zzzsfrom vidamdavcrmdaca vida morkunassubject inner ear problems from too much flyingcan one develop innerear problems from too much flying i hear that pilotsand stewardesses have a limit as to the maximum number of flying hours what are these limits what are the main problems associated with too manylonghaul over hours tripsfrequent flyerfrom rjbcbnewskcbattcom robertjbrownsubject re human breastfeeding myths or reality in article cvhwohlttriposcom homertriposcom webster homer writes rjasoarvnetibmcom robert j alexander md writes i have an additional question how long should a mother breast feed her child a friend of mine is still nursing her two year old is this beneficial her exhusband is trying to use her coninued nursing of a two year old as proof of her being unfit to be a mother what studies have been done on breast feeding past a year etc upon the psychological health of the child web homer my wife breastfed my three boys months months and monthsrespectively and they are and years old respectively sofar everybody seems fairly normal i noticed a negative correlationwith ear infections and length of time nursed in my very small samplei do notice that the and year old seem to eat a lot could thatbe from the breast feeding i dont understand the unfit mother charge other than any tactic isnot too low down for some folks during divorcechild custody battlesmost of the developing nations practice breast feeding to and yearsold are they screwed up because of it would they be much betteroff if they could use cows milk or commercial formula doctors bobby akguarjbfrom josecsduwoca jose thekkumthalasubject recurrent volvulus recurrent volvulus this is regarding recurrent volvulus which our little boy has been suffering from ever since he was an infant he had a surgery when he was one year old another surgery had to be performed one year after when he was two years old he turned three this february and he is still getting afflicted by this illness like having to get hospitalised for vomitting and accompanying stomach painhe managed not having a third surgery so far one thing me and my wife noticed is that his affliction peaks around the time he was born on nearabouts like in march every year any significance to this why does this recur me and my family go through severe pain when our little boy have to undergo surgery why does surgery not rectify the situation also which hospital in us or canada specialize in this malady what will be a good book explaining this disease in detail will keeping a particular diet keep down the probability of recurrence as time goes on will the probability of recurrence go down considering he is getting stronger and healthier and probably less prone to attacks or is this assumption wrong any help throwing light on these queries will be highly appreciated thanks very much josecsduwocafrom mrbcbnewsjcbattcom mbruncatisubject re smokers lungsin article aprkuhubccukansedu bennettkuhubccukansedu writes how long does it take a smokers lungs to clear of the tar after quitting does your chances of getting lung cancer decrease quickly or does it take a considerable amount of time for that to happenseems to me that i read in either a recent ny timesscience times or maybe it was science news that there isevidence that exsmokers risk of lung cancer never returnsto that of a person who has never smoked i think it mayget close ill find the article and post it since mymemory is hazy on the specifics if you are interestedmichaelfrom gebcspittedu gordon bankssubject re various migraine therapiesin article chtmwhjolsench lindyolsench lindy foster writesive been treated to many therapies for migraine prophylaxis and treatmentand it looks like theyll try a few more on me i have taken propanololi think it was mg xdaily with no relief i have just been startedmg per day of propranolol is a homeopathic dose in migraine if you got fatigued at that level it is unlikely that you willtolerate enough beta blocker to help you if we go the antidepressant route what is it likely to be how doantidepressants work in migraine prophylaxisprobably a single nightime dose we dont know how they work in migraine butit probably has something to do with seratonin gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re vangus nerve vagus nervein article seismocssgov bwbseismocssgov brian w barker writesmostly right is there a connection between vomitingand fainting that has something to do with the vagus nervestimulation of the vagus nerve slows the heart and drops the bloodpressure gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re migrainesin article drandmarspinnerosforg drandspinnerosforg douglas s rand writesso ill ask this my neurologist just prescribed cafergot andmidrin as some alternatives for me to try he stated thatthe sublingual tablets of ergotamine were no longer availableany idea why he also suggested trying mg ibupropheni just found out about the sublinguals disappearing too i dontknow why perhaps because they werent as profitable as cafergottoo bad since tablets are sometimes vomited up by migraine patientsand they dont do any good flushed down the toilet i suspectwell be moving those patients more and more to the dhe nasalspray which is far more effective gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re aids related questionsin article pxfpsuvmpsuedu pxfpsuvmpsuedu paula ford writesa friend of mine was a regular volunteer blood donor during surgery hewas given five units of blood and after a suitable recovery time he wentto donate blood at a bloodmobile he was hiv and did not know itthe red cross notified him with a registered letter thats all nocounselling no nothing he died two years ago this week he left behindhow long ago was this when i said youd get counselling i meant ifyou did it now long ago practices varied and agencies had to gearup to provide the counsellinga wife and a fouryearold son many people have suggested that his wifeshould sue the red cross but she would not she says that without theblood transfusions he would have died during the surgerygood for her what we dont need is everyone suing community serviceagencies that provide blood that people need testing is not fool proofthe fact that he got aids from a transfusion if he really did doesnot mean the red cross screwed up prior to or so there wasnta good test and a lot of bad blood got through this wasnt the faultof the red cross when did he get the transfusions gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re health care reformin article lmcwrcwrgracecom custerwrcwrgracecom linda custer writesthis is my first post and i am not even sure it will work here goesdid anyone read the editorial on page in the march edition of timemagazine noting that managed care is extremely inefficient of all the possibleclients that billary could be pandering to the insurance industry is the worstcomments i agree adding layers of managers and bureaucrats simply eat upmoney that could be spent on those who actually are doing the worksuch as doctors and nurse and supplies the most efficient systemis probably one that has limited management and a fixed budget suchas englands or even canadas im afraid we are on the wrongtrack the problem may be that the insurance lobby is too powerful gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re health care reformin article marcnsvaxuwecedu nyedacnsvaxuwecedu david nye writesand may be a total disaster and that the canadian model is preferable aposition with which i agree the other is surprising sympathy for thephysicians in all of this to the effect that beating up on us wonthelp anything im not sure about that did you see the poll they took that showedthat most people thought physicians should be paid per yeartops thats all i make but i doubt that most physicians are goingto work very hard for that kind of bread many wouldnt be ableto service their med school debts on that mike royko had a goodcolumn about it gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from kmcspittedu ken mitchumsubject re update help was what is this is it lymesin article marequatorcom jodequatorcom john setel odonnell writesimho you have lyme disease i told you this in private email and predictedthat you might next start having the migrating pains and further jointimho the original poster has no business soliciting diagnoses off the netnor does drmr odonnell have any business supplying same this is onemajor reason real physicians avoid this newsgroup like the plague it isalso another example of the double standard if i as a physician offeredto diagnose and treat on the net i can be sued but people withoutqualifications are free to do whatever they want and disclaim it all withim not a doctorget and keep this crap off the net periodkmfrom kmcspittedu ken mitchumsubject re patientphysician diplomacyin article chyouizmentorccpurdueedu hrubinpopstatpurdueedu herman rubin writesin article kybuucp kmkybpghpaus ken mitchum writesditto disease is a great leveling experience however some peopleare very much afronted to find out that all the money in the worlddoes not buy one health everyone looks the same when they dieif money does not buy one health why are we talking about payingfor medical expenses for those not currently adequately coveredherman i would think you of all people wouldcould distinguishbetween health and treatment of disease all the preventionmedicine people preach this all the time you cannot buy healthyou can buy treatment of disease assuming you are lucky enoughto have a disease which can be treated a rich person with aterminal disease is a bit out of luck there is no such thingas adequately covered and there never will be and for what its worth ill be the first to admit that all mypatients diekmfrom kmcspittedu ken mitchumsubject re immotile cilia syndromein article marncsuedu andreaunityncsuedu andrea m freekwiatkowski writesi would like to know if there is any new information out there about thesubject or any new studies being conducted i am confident in mypediatrician and her communication with the people in chapel hill butsince this is a lifelong disorder and genetically transferred i wouldlike keep current i do realize that since this is a relatively newdisorder first documented in in a fertility clinic in scandanaviaand is therefore controversiali do not know a lot about this except from seeing one patient withkartageners syndrome which is a form of immotile cilia syndromein which there is situs inversus bronchiectasis and chronicinfections situs inversus means that organs are on the wrongside of the body and can be complete or partial it is interestingmedically because the normal location of organs is caused in partby the normal rotation associated with ciliary motion so that inabsence of this laterality can be random people with situsinversus are quite popular at medical schools because of theirrarity and the fact that most doctors get a bit upset when theycant find the patients heart sounds because theyre on the wrongside according to harrisons immotile cilia syndrom is an autosomalrecessive which should imply that on average one child in fourin a family would be affected but there may be much more currentinformation on this and as usual in medicine we may be talkingabout more than one conditiion i would suggest that you ask yourpediatrician about contacting a medical geneticics specialist ofwhich there is probably one at ncsukmfrom kmcspittedu ken mitchumsubject re lung disorders and clubbing of fingersin article slaglemarsgimsdlmsclockheedcom slaglelmsclockheedcom writescan anyone out there enlighten me on the relationship betweenlung disorders and clubbing or swelling and widening of thefingertips what is the mechanism and why would a physiciancall for chest xrays to diagnose the cause of the clubbingpurists often distinguish between true clubbing and pseudoclubbing the difference being that with true clubbing theangle of the nail when viewed from the side is constantlynegative when proceeding distally towards the fingertipwith pseudo clubbing the angle is initially positive thennegative which is the normal situation real internistscan talk for hours about clubbing im limited to a coupleof minuteswhether this distinction has anything to do with reality isentirely unclear but it is one of those things that internistslove to paw over during rounds supposedly only true clubbingis associated with disease the problem is that the list ofdiseases associated with clubbing is quite long and includesboth congenital conditions and acquired disease since many ofthese diseases are associated with cardiopulmonary problemsleading to right to left shunts and chronic hypoxemia it isvery reasonable to get a chest xray however many of the congenital abnormalities would only be diagnosed with a cardiaccatheterization the cause of clubbing is unclear but presumably relates tosome factor causing blood vessels in the distal fingertip todilate abnormally clubbing is one of those things from an examination which isa tipoff to do more extensive examination often howeverthe cause of the clubbing is quite apparentkmfrom kmcspittedu ken mitchumsubject re open letter to hillary rodham clinton how about posting one of her replies to your letterskmfrom kmcspittedu ken mitchumsubject re menangitis questionin article cnznmzxcrdnnscrdgecom brooksbybrighamnosubdomainnodomain glen w brooksby writesthis past weekend a friend of mine lost his month olddaughter in a matter of hours to a form of menangitis theperson informing me called it nicereal meningicocis spin retrospect the disease struck her probably sometime on friday evening and she passed away about pm on saturdaythe symptoms seemed to be a rash that started small andthen began progressing rapidly she began turning blueeventually which was the tipoff that this was seriousbut by that time it was too late this is all second hand infomy question isis this an unusual form of menangitis how is it transmittedhow does it work ie how does it kill so quicklythere are many organisms viral bacterial and fungal which cancause meningitits and the course of these infections varieswidely the causes of bacterial meningitis vary with age in adultspneumococcus the same organism which causes pneumococcal pneumoniais the most common cause while in children hemophilus influenzaeis the most common causewhat you are describing is meningitis from neisseria meningitidiswhich is the second most common cause of bacterial meningitis inboth groups but with lower incidence in infants this organismis also called the meningococcus and is the source of thecommon epidemics of meningitis that occur and are popularized inthe press without prompt treatment and even with it in some casesthe organism typically causes death within a day this organism feared as it is is actually grown from the throatsof many normal adults it can get to the meninges by differentways but blood borne spread is probably the usual case rifampin an oral antibiotic is often given to family and contactsof a case of meningococcal meningitis by the waysorry but i dont have time for a more detailed reply meningitisis a huge topic and scimed cant do it justicekmfrom gebcspittedu gordon bankssubject re aids related questionsin article pxfpsuvmpsuedu pxfpsuvmpsuedu paula ford writeswe know ours is not hiv and people need it i think my husband should giveblood especially because his is o and i understand thats a very usefulblood typeits o that is especially useful still he isnt punishing thered cross but some o person that needed his blood and couldntget it you are right nagging probably wont help gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re update help was what is this is it lymesin article marequatorcom jodequatorcom john setel odonnell writesi shouldnt have to be posting here physicians should know the lymeliterature beyond steere cos denial merrygoround patientsshould get correctly diagnosed and treatedwhy do you think steere is doing this isnt he acting in good faithafter all as the discoverer of lyme for all intents and purposesthe more famous lyme gets the more famous steere gets i dontsee the ulterior motive here it is easy for me to see it thethose physicians who call everything lyme and treat everythingthere is a lot of money involvedim a computer engineer not a doctor jim i was building a computer manufacturing company when i got lyme i lost several years of my life to neartotal disability partially as a resultthe company failed taking with it over jobs my savingsand everything id worked for for years im one of the luckyones in that i found a physician through the lyme foundationand now can work almost fulltime although i have persistentinfection and still suffer a variety of sypmtoms and nowi try to follow the lyme literaturewell it is tragic what has happened to you but it doesntnecessarily make you the most objective source of informationabout it if your whole life is focussed around this youmay be too emotionally involved to be advising other peoplewho may or may not have lyme certainly advocacy of more researchon lyme would not be out of order though and people like youcan be very effective there gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re cant breathein article ptpmvvagateberkeleyedu romdasuclinkberkeleyedu ella i baff writesre the prostate treatment is worse than the diseasein medicine there really is something histologically identified as prostate tissue and there are observable changes which take place that whenever they occur can be identified as prostate cancer what if i told you that most chiropractorstreat subluxation spinal demons which dont exist at all therefore any tissue damage incurred in a chiropractic treatment performed in an effort to exorcise this elusive silent killer such as ligamentousdamage and laxity microfracture of the joint surfaces rib fractures strokes paralysisetc is by definition worse than nontreatmentjohn badanes dc caemail romdasuclinkberkeleyeduwhat does dc stand for couldnt be an antichiropractic postingfrom a chiropractor could it my curiosity is piquedprostate ca is an especially troublesome entity for chiropractorsit so typically causes bone pain due to spinal metastases that itgets manipulated frequently manipulating a cancer riddled boneis highly dangerous since it can then fracture ive seen atleast three cases where this happened with resulting neurologicdamage including paraplegia this is one instance where knowinghow to read xrays can really help a chiropractor stay out of troubledo chiropractors know what bony mets from prostate look like gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re menangitis questionin article cnznmzxcrdnnscrdgecom brooksbybrighamnosubdomainnodomain glen w brooksby writesthis past weekend a friend of mine lost his month olddaughter in a matter of hours to a form of menangitis theperson informing me called it nicereal meningicocis spin retrospect the disease struck her probably sometime on friday evening and she passed away about pm on saturdaythe symptoms seemed to be a rash that started small andthen began progressing rapidly she began turning blueeventually which was the tipoff that this was seriousbut by that time it was too late this is all second hand infomy question isis this an unusual form of menangitis how is it transmittedhow does it work ie how does it kill so quicklyno the neiseria meningococcus is one of the most commonforms of meningitis its the one that sometimes sweepsschools or boot camp it is contagious and kills by attackingthe covering of the brain causing the blood vessels to thromboseand the brain to swell upit is very treatable if caught in time there isnt much timehowever the rash is the tip off infants are very susceptibleto dying from bacterial meningitis any infant with a fever whobecomes stiff or lethargic needs to be rushed to a hospital wherea spinal tap will show if they have meningitis seizures can alsooccurimmediate family members were told to take some kind of medicationto prevent them from being carriers yet they didnt haveany concerns about my wife and i coming to visit themit can live in the throat of carriers dont worry you wont get it from them especially if they took the medication gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re cant breathein article martijcuucp pjstijcuucp paul schmidt writesi think it is important to verify all procedures with proper studies toshow their worthiness and risk i just read an interesting tidbit that of the medical treatments are unproven and not based on scientific fact for example many treatments of prostate cancer are unproven andthe treatment may be more dangerous than the disease according to thearticle i readwhere did you read this i dont think this is true i think mostmedical treatments are based on science although it is difficultto prove anything with certitude it is true that there are somethings that have just been found to work but we have no goodexplanation for why but almost everything does have a scientificrationale the most common treatment for prostate cancer isprobably hormone therapy it has been proven to work so haveradiation and chemotherapy what treatments did the article sayare not proven gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from jerprefectccbellcorecom rathmannjanice esubject re sinus vs migraine was re sinus endoscopyi noticed several years ago that when i took analgesics fairly regularlymotrin at the time i seemed to get a lot of migraines but hadforgotten about that until i started reading some of the posts herei generally dont take nsaids or tylenol for headaches because ivefound them to be ineffective however i have two other pain sourcesthat force me to take nsaids currently naprosyn first is somepelvic pain that i get at the beginning of my period and then muchworse at midcycle i have had surgery for endometriosis in the past years ago so the drs tell me that my pain is probably dueto the endometriosis coming back ive tried synarel it reducedthe pain while i took it mos but the pain returned immediatelyafter i stopped three doctors have suggested hysterectomy as theonly real solution to my problem although i dont expect to haveany more children i dont like the idea of having my uterus andone remaining ovary removed the first ovary was removed when i hadthe surgery for endometriosis one of the drs that suggestedi get a hysterectomy is an expert in laser surgery but perhaps thinksthat type of procedure is only worthwhile on women who still planto have children so basically all im left with is toughing outthe pain this would be impossible without naprosyn or somethingsimilar but not aspirin that doesnt work and motrin gave mehorrible gastritis a few years ago so im through with it infact naprosyn works very well at eliminating the pain if i takeit regularly as i did when i had severe back pain and pain in both legs as ill discuss in a moment generally though i wait untili have the pain before i take the naprosyn but then it takesseveral hours for it reduce the pain its actually quite effectiveat reducing the pain it just takes quite a while in the meantimeim frequently in severe painthe other pain source i have is chronic lower back pain resulting inbilateral radiculopathy ive had mris xrays ct scan and emgsive had of them and dont intend to ever do that again withnerve conduction tests the tests have not been conclusive as towhat is causing my back and leg pain the mri reports both say i haveseveral bulging degeneratig disks and from the xrays and mri i thinkit is apparent that i have arthritis the reading on the ct scanwas that there are two herniations ll and ll but othershav looked at the films and concluded that there are no herniationsthe second emg and nerve conduction studies shows significant denervationcompared to the first emg oh yeah i had some other horrible testcalled something like somatic evoked response which showed that theinternal nerves are working fine anyway the bottom line is thati sometimes have severe pain in both legs and back pain the back painis there all the time but i can live with it when the leg pain is therei need some analgesicantiinflammatory medication to reduce the painto a level where i can work so i took naprosyn regulary for months every time i tried to stop the leg pain got worse so id always resume since last november i have taken it much less frequentlyand primarily for the pelvic pain i have been going to physicaltherapy for the last months times a week after the first monthor so my therapist put me on pelvic traction she had tried it earlierbut it had caused a lot of pain in my back this time she tried it ata lower weight after a month or two the pain in my legs began goingaway but the traction aways caused discomfort in my lower back whichcould be reduced with ultrasound and massage so now i dont havenearly as much pain in my legs in fact my therapist took me offtraction about weeks agogetting back to my original reason for this post even if i can avoidtaking analgesic for headaches i really cant avoid them entirely becausei have other pain sources that force me to use them oh i forgotto mention that it has been suggested to me that i have back surgerybut im avoiding that too i find the migraines difficult to deal withoccassionally i have to take off work but usually i can work but ata reduced capacity im a systems engineer and do a lot of readingand writing when the pelvic pain is bad i cant concentrate muchi usually end up jumping out of my chair every few minutes becausethe pain is so bothersome when the pain in my back is bad it cancause severe burning in both legs shooting pains in my legs electricshock type of pain in my feet and toes and basically when it gets badi cant really sit at all then i end up spending most of my time homeand in bed so even if the analgesics contribute to the migraines themigraines are more tolerable than the other pain sources i get a lotof migraines an average of to a month which last daysive taken cafergot the first time the caffiene really got to me soi reduced the dosage but i dont like the side effects if i takemore than two i get diahrea if i get a very bad headache i willeventually take the cafergot my neurologist wasnt very helpful wheni told him my problems with cafergot he said that when sumatriptanbecomes available i should try that ive tried several other medicationsfiornal midrin fiornal with codeine tegretol and inderal butthey either didnt work or i couldnt tolerate them so what can i domy doctors seem to be satisfied with me just trying to tolerate thepain which i agree with most of the time but not when i have a lot ofpain ive had some bad experiences with surgery my heart stoppedonce from the anesthesia i was told that it was likely thesuccinylcholine and ive already had surgery several timesanyway the point of what im saying is that even if analgesics can contributeto migraines some people need to take them to tolerate other painjanice rathmannfrom aldridgenetcomcom jacquelin aldridgesubject re teenage acnepchurchswellactrixgennz pat churchill writesmy yo son has the usual teenage spotty chin and greasy nose ibought him clearasil face wash and ointment i think that is probablyenough along with the usual good diet however he is on at me toget some product called dalacin t which used to be adoctorsprescription only treatment but is not available over thechemists counter i have asked a couple of pharmacists who sayeither his acne is not severe enough for dalacin t or that clearasilis ok i had the odd spots as a teenager nothing serious hisfather was the same so i dont figure his acne is going to escalateinto something disfiguring but i know kids are senstitive abouttheir appearance i am wary because a neighbours son had this wierdmalady that was eventually put down to an overdose of vitamin a fromacne treatment i want to help but with appropriate treatmentmy son also has some scaliness around the hairline on his scalp sortof teenage cradle cap any pointersadvice on this we have tried acouple of anti dandruff shampoos and some of these are inclined tomake the condition worse not bettershall i bury the kid till hes noi was one of the lucky ones very little acne as a teenager ididnt have any luck with clearasil even though my skin gets oily itreally only gets miserable pimples when its dry frequent lukewarm water rinses on the face might help getting the scalpthing under control might help that could be as simple as submerging underthe bathwater till its softened and washing it out taking a one a dayvitaminmineral might help ive heard iodine causes trouble and that it is used in fast food restaurants to sterilize equipment which might bewhere the belief that greasy foods cause acne came from i notice grease on my face not immediately removed will cause acne even from eatingmeatkeeping hair rinse mousse dip and spray off the face will help warmwater bath soaks or cloths on the face to soften the oil in the pores willhelp prevent blackheads body oil is hydrophilic loves water and itsoftens and washes off when it has a chance thats why hair goes limp withoilyness becoming convinced that the best thing to do witha whitehead is leave it alone will save him days of pimple misery anyprying of black or whiteheads can cause infections the red spots ofpimples usually a whitehead will break naturally in a day and there wontbe an infection afterwardstell him that its normal to have some pimples but the cosmetic industrymakes its money off of selling people on the idea that they are anincredible defect to be hidden at any cost even that of causing more pimples jackiefrom mark w dubinsubject re ringing earsjfareisswaterlooncrcom jim fare writesa friend of mine has a trouble with her ears ringing etca folks do we have an faq on tinnitus yetb as a loooong time sufferer of tinnitus and as a neuroscientistwho has looked over the literature carefully i believe the followingare reasonable conclusions millions of people suffer from chronic tinnitus the cause it not understood there is no accepted treatment that cures it some experimental treatments may have helped some people a bit butthere have be no reportseven anecdotalof massive good results withany of these experimental drugs some people with chronic loud tinnitus use noise blocking to get to sleep sudden onset loud tinnitus can be caused by injuries and sometimesabates or goes away after a few months aspirin is well known to exacerbate tinnitus in some people there is a national association of tinnitus sufferers in the us one usually gets used to it especially when concentrating onsomething else the tinnitus becomes unnoticed stress and lack of sleep make tinnitus more annoying sometimes im sure those of us who have it wish there was a cure but thereis notmark dubinthe ol professorfrom sasghmtheseusunxsascom gary merrillsubject re jiggersi may not be the worlds greatest expert on chiggers a type ofmite indigenous to the south but i certainly have spent a lotof time contemplating the little buggers over the past six yearssince we moved to nc here are some observations gained frompainful experience reactions to chiggers vary greatly from person to person some people get tiny red bites others like me are more sensitive and get fairly large swollen sorelike affairs chigger bites are the gift that keeps on giving i swear that these things will itch for months there is a lot of folklore about chiggers i think most of it is fiction i have tried to do research on the critters since they have such an effect on me the only book i could find on the subject was a single book in uncs special collections library i have not yet gone through what is required to get it based on my experience and that of my family members the old folk remedy of fingernail polish simply doesnt work i recall reading that the theory upon which it is based that the chiggers burrow into your skin and continue to party there is false i think it is more likely that the reaction is to toxins of some sort the little pests release but this is speculation the best approach is prevention a couple of things work well a good insect repellent deet such as deep woods off liberally applied to ankles waistband etc is a good start there is another preparation called chig away that is a combination of sulfur and some kind of cream cortisone that originally was prepared for the army and is not commercially available in the summer i put this on my ankles every morning when i get up on weekends since i literally cant go outside where we live in the country without serious consequences they apparently dont like sulfur much at all you can use sulfur as a dust on your body or clothing to repel them no amount of prevention will be completely successful forget the fingernail polish i have finally settled upon a treatment that involves topical application of a combination of cortisone creme reduces the inflamation and swelling and benzocaine relieves the itch i wont tell you all the things ive tried nor will i tell you some of the things my wife does since this counts as minor surgery and is best not mentioned i also think it gains nothing the swelling and itching can also be significantly relieved by the application of hot packs and this seems to speed recovery as welldoctors seem not to care much about chiggers the urban and suburbandoctors apparently dont encounter them much and the rural doctorsseem to regard them as a force of nature that one must endure isuspect that anyone who could come up with a good treatment for chiggerswould make a lot of money gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmfrom gebcspittedu gordon bankssubject re my new diet it works great in article marinmetcambinmetcom mazurbluefincambinmetcom beth mazur writesin article ovtoinnhhlynxunmedu bhjellecarinaunmedu writeson the other hand we do a good job of implying that the person whoweighs lbs is overeating when in fact the body probably doesntmake any moral judgements about its composition conceivably the body works just as hard maintaining its weight at as someone elsesdoes at undoubtedly it does to maintain such a weight and it does soprimarily by overeating if it didnt the weight would dropback to normal gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re blindsightin article wernertolmacsoeberkeleyedu wernersoeberkeleyedu john werner writesin article pittuucp gebcspittedu gordon banks wrote explain i thought there were types of cones equivalent to rgbyoure basically right but i think there are just types one issensitive to red and green and the other is sensitive to blue and yellow this is why the two most common kinds of colorblindness are redgreen andblueyellowyes i remember that now well in that case the cones are indeedcolor sensitive contrary to what the original respondent had claimed gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re sinus vs migraine was re sinus endoscopyin article laugerlaugermdccom laugerssdgwymdccom john lauger writesin article pittuucp gebcspittedu gordon banks wrotewhats the best approach to getting off the analgesics is there somethingtwo approaches that ive used tofranil mg qhs naproxen mg bidthe naproxen doesnt seem to be as bad as things like tylenol in promotingthe analgesic abuse headache dhe iv infusions for about days inhospital cold turkey is the only way i think tapering doesnthelp i wouldnt know how you can do this without your doctor i haventseen anyone successfully do it alone doesnt mean it cant be done gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re sinus vs migraine was re sinus endoscopyin article marnewsengconvexcom cashconvexcom peter cash writesby the way does the brain even have pain receptors i thought noti heardthat brain surgery can be performed while the patient is conscious forprecisely this reasonno no we arent talking about receptors for the brains sensory innervation but structures such as the thalamus that handle painfor the entire organism apples and oranges gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re tuberculosisin article marnewscolumbiaedu jhlcunixacccolumbiaedu jonathan h lin writesi was wondering what steps are being taken to prevent the spread ofmultidrug resistant tuberculosis ive heard that some places arethinking of incarcerating those with the disease doesnt this violatethe civil rights of these individuals are there any legal precedentsfor such actionwho knows in this legal climate but there is tremendous legal precendentfor forcibly quarantining tb patients in sanitariums yrs agoit was done all the time it has been done sporadically all alongin patients who wont take their medicine if you have tb youmay find yourself under surveilence of the public health departmentand you may find they have the legal power to insist you make yourclinic visits gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re blindsightin article marcsrochesteredu fulkcsrochesteredu mark fulk writesin article castleedacuk hrvojecastleedacuk h hecimovic writescompensation or are lesions localized to the sc too rare to be ableto tellextremely rare in humans usually so much else is involved youdjust have a mess to sort out birds do all vision in the tectumdont they gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re name of mds eyepiecein article cihmgswatsonibmcom clarkewatsonibmcom ed clarke writes its not an eyepiece it is called a head mirror all doctors nevera speculumthe speculum is the little cone that fits on the end of the otoscopethere are also vaginal specula that females and gynecologists areall too familiar with gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re patientphysician diplomacyin article maraoaaoautccom carlaoaaoautccom carl witthoft writeswhat is unacceptable about this is that hospitals and mds by lawhave no choice but to treat you if you show up sick or mangled froman accident if you arent rich and have no insurance who is goingto foot your bills do you actually intend to tell the ambulanceno let me die in the gutter because i cant afford the treatmentby law they would not be allowed to do that anyhow gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re exercise hypertensionin article rfmpsuvmpsuedu rfmpsuvmpsuedu writesi took a stress test a couple weeks back and results came back notingexercise hypertension fool that i am i didnt ask doc what this meantand she didnt explain and now im wondering can anyone out thereenlighten and i promise next time ill askprobably she meant that your blood pressure went up while you were onthe treadmill this is normal youll have to ask her if this iswhat she meant since no one else can answer for another person gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re striato nigral degenerationin article aawalrusmvhsedu ktoddwalrusmvhsedu ken todd writesi would like any information available on this rare disease i understandthat an operation referred to as pollidotomy may be in order does anyoneknow of a physician that performs this procedure all responses will beappreciated please respond via email to ktoddwalrusmvhseduit isnt that rare actually many cases that are called parkinsonsdisease turn out on autopsy to be snd it should be suspected in anycase of parkinsonism without tremor and which does not respond toldopa therapy i dont believe pallidotomy will do much for snd gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re morbus meniere is there a real remedyin article lindaecjglkfxmnetcomcom lindaenetcomcom writesmy biggest resentment is the doctor who makes it seem like mostpeople with dizziness can be cured thats definitely not thecase in most cases like i said above it is a long tediousprocess that may or may not end up in a partial cure be sure to say chronic dizziness not just dizziness mostpatients with acute or subacute dizziness will get betterthe vertiginous spells of menieres will also eventually goaway however the patient is left with a deaf earto anyone suffering with vertigo dizziness or any variationthereof my best advice to you as a fellowsufferer is thisjust keep searchingdont let the doctors tell you theresnothing that can be donedo your own researchand let yourthis may have helped you but im not sure it is good generaladvice the odds that you are going to find some miracle withyour own research that is secret or hidden from general knowledgefor this or any other disease are slim when good answers to theseproblems are found it is usually in all the newspapers untilthen spending a great deal of time and energy on the medicalproblem may divert that energy from more productive thingsin life a limited amount should be spent to assure yourselfthat your doctor gave you the correct story but after it becomesclear that you are dealing with a problem for which medicinehas no good solution perhaps the best strategy is to jointhe support group and keep abreast of new findings but not tomake a career out of it gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re donating organsin article marsbcssunysbedu mhollowaicsunysbedu michael holloway writesdr banks i dont know if you make a point of keeping up with liver transplantresearch but youre certainly in the right place for these questions has there been anything recent in transplant proceedings or somesuch on xenografts how about liver section transplants from living donors im sure the pittsburgh group has published the baboon work but idont know where in chicago they were doing lobe transplants fromliving donors and im sure theyve published i dont read thetransplant literature i just see the liver transplant patientswhen they get into neurologic trouble pretty frequent so thatand the newspapers and scuttlebutt is the way i keep up with whatthey are doing howard doyle works with them and can tell you more gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re update help was what is this is it lymesin article marequatorcom jodequatorcom john setel odonnell writesimho you have lyme disease i sent you in private email a summary of the treatment protocols putforth by the lyme disease foundation i respectfully suggest that yousave yourself a great deal of suffering by contacting them for alymeknowledgeable physician referral and seek treatment at onceyoull know in weeks if youre on the right course and the clock isticking on your weeks if you have it lymeif these folks are who i think they are lymeknowledgeable maymean a physician to whom everything that walks in the door islyme disease and you will be treated for lyme whether or notyou have it hope you have good insurance gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re use of codine in narcolepsyin article maraiojscnasagov stevelaiojscnasagov steve lancaster writes is there any way around the scheduled drug mess so that he can usejust the substance that works and not one adulterated with tylenol can the md perscribe a year long supply on one script his doctorbasically refused to prescribe it saying his clinic does not prescribecontroled substances its is company ruleshort of changes by the feds there is no way codeine alone is verydifficult to prescribe without a lot of hassles tylenol is thebest compromise that way he can get refills the amount of acetominophenhe is getting with his codeine wont hurt him any gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re migraines and estrogenin article fbbwwjupiterspkwaus pwagemanjupiterspkwaus peggy wageman writesi read that hormonal fluctuations can contribute to migraines could taking supplemental estrogen ert cause migraines any information im not sure it is the fluctuation so much as the estrogen leveltaking premarin can certainly cause migraines in some women gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re migraine and exercisein article ciozxwxworldstdcom rsilverworldstdcom richard silver writesi have two questions is there any obvious connection between theflushed appearance and the migraine was i foolish to play throughthe migraine aside from the visual disturbance affecting my playi just prefer to ignore it when possiblethe flushing is due to vascular dilation part of a migraine attacksome people event get puffy and swollen as long as you are carefulyou can see well enough to avoid getting hit in the face or eye bythe ball migraine will not hurt your health gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re new multiple sclerosis drugin article newsdukeedu admneurodukeedu alan magid writesdisclaimer i speak only for myselfso just what was it you wanted to say gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re need info on rsdin article marrmtccentralsuncom lrdrmtccentralsuncom writesi just started working for a rehabilitation hospital and have seen rsdcome up as a diagnosis several times what exactly is rsd and what isthe nature of it if there is a faq on this subject id reallyappreciate it if someone would mail it to me while any and allreflex sympathetic dystrophy im sure theres an faq as i havemade at least answers to questions on it in the last year or so gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from kmkybpghpaus ken mitchumsubject re tuberculosisin article marnewswesleyanedu rginzbergeaglewesleyanedu ruth ginzberg writes but ill be damned his rights to be sick to fail to treat his disease to spread it all over the place were indeed preserved happyseveral years ago i tried to commit a patient who was growing salmonella out of hisstool blood and an open ulcer for treatment the idea was that the guy was awalking public health risk and that forcing him to receive iv antibiotics fora few days was in the public interest i will make a long story short by sayingthat the judge laughed at my idea yelled at me for wasting his time and letthe guy goi found out that tuberculosis appears to be the only medical as oppsed to psychiatriccondition that one can be committed for and this is because very specific laws wereenacted many years ago regarding tb i am certain these vary from state to stateany legal experts out there to help us on thiskmfrom gebcspittedu gordon bankssubject re amitriptylinein article marjulianuwoca robertsgaulcsduwoca eric roberts writescould someone please tell me what effect an overdose mg ofamitriptyline would haveprobably would not be fatal in an adult at that dose but could killa child patient would be very somnolent with dilated pupils lowblood pressure possibly cardiac arrhythmias gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re medication for parkinsonsin article uupcbfactorycom jimzisfeinfactorycom jim zisfein writesif you want to throw around names drs donald calne terry elizanand jesse cedarbaum dont recommend selegiline not to mention drwilliam landaugosh jesse is that famous now he was my intern landau not likingit makes me like it out of spite just kidding bill gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re fingernail moonsin article aacalcomsocalcom danielprincefnzcalcomsocalcom daniel prince writesi only have lunulas on my thumbs is there any medical significance to that finding thank you in advance for all repliestry peeling the skin back at the base of your other fingernailsnot too hard now dont want to hurt yourself youll findnice little lunulas there if you can peel it back enough gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re health care reformin article lmcwrcwrgracecom custerwrcwrgracecom linda custer writesalso im not sure that physician fees at the very very highest levelsdont have to come down im not talking about the bulk of physiciansmaking good but not great salaries who have megaloans from medical schooldebts id also like to see some strong ethics with teeth for physiciansi agree that some specialties have gotten way out of line the mainproblem is the payment method for procedures rather than time distortsthe system i hope they will fix that but im afraid as usualthe local doc is going to take the brunt people grouse about paying to see their home doctor in his office but dont mind paying to have brain surgery they think their local doc is cheatingthem but worship the feet of the neurosurgeon who saved their lifewhat they dont realize is that we need more local docs and fewer gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re high prolactinin article jerpsuvmpsuedu jerpsuvmpsuedu john e rodway writesany comments on the use of the drug parlodel for high prolactin in the bloodit can suppress secretion of prolactin is useful in cases of galactorrheasome adenomas of the pituitary secret too much gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re toxoplasmosisin article isoitbbnhpcom sudeisoitbbnhpcom susanne denninger writes how dangerous is it from whom is it especially dangerous dangerous only to immune suppressed persons and fetuses to themit is extremely dangerous most of the rest of us have already hadit and it isnt dangerous at all how is it transmitted i read about raw meat and cats but id like to have more details cat feces are the worst pregnant women should never touch the litter box what can be done to prevent infection cook your meat watch it with pets what are the symptoms and longterm effects youll have to read up on it what treatments are availble there is an effective antibiotic that can keep it in checkof course it cant reverse damage already done such as ina fetus gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re my new diet it works great in article maromenuucp cafomenuucp chuck forsberg wakgx writessometime in the future diet evangelists may get off their ourdiet will work if only the obese would obey it mode and douseful research to allow prediction of which types of diet mightbe useful to a given individualdiet evangelist good term fits atkins to a t gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject should patients read package inserts pdrin article marnewswesleyanedu rginzbergeaglewesleyanedu ruth ginzberg writeshmmmm heres one place where i really think the patient ought to take moreresponsibility for him or herself there is absolutely no reason why youcant ask the pharmacist filling the prescription for the physicians packageinsert for the medication when you pick it up at the pharmacy make sure totell the pharmacist that you want the physicians package insert not theif people are going to do this i really wish they would tell me firstid be happy to go over the insert in the pdr with them and explaineverything all too many patients read the insert and panic and thenon the next visit sheepishly admit they were afraid to take the drugand we are starting over again at square one some of them probablydidnt even come back for followup because they didnt want to admitthey wouldnt take the drug or thought i was trying to kill them orsomething what people dont understand about the inserts is that theyreport every adverse side effect ever reported without substantiatingthat the drug was responsible the insert is a legal document to sloughliability from the manufacturer to the physician if something was tohappen if patients want to have the most useful and reliable informationon a drug they would be so much better off getting hold of one of theama drug evaluation books or something similar that is much more scientificthere are very few drugs that someone hasnt reported a death from takingpatients dont realize that and dont usually appreciate the risksto themselves properly im sure herman is going to go ballisticbut so be it another problem is that probably most drugs have beenreported to cause impotence half the males who read that will falsely assumeit could permanently cause them to lose sexual function and so willrefuse to take any drug like that this can be a real problem forpdr readers there needs to be some way of providing patients withtools geared to them that allow them to get the information they needi am involved in a research project to do that with migraine as thedomain it involves a computer system that will provide answers to questionsabout migraine as well as the therapy prescribed for the patientfor common illnesses such as migraine and hypertension this may helpquite a bit the patient could spend as much time as needed with thecomputer and this would then not burden the physician clearlyphysicians in large part fail to answer all the questions patients haveas is demonstrated over and over here on the net where we get askedthings that the patients should have found out from their physicianbut didnt why they didnt isnt always the physicians fault eithersometimes the patients are afraid to ask they wont be as afraid toask the system we hope gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re tuberculosisin article kybuucp kmkybpghpaus ken mitchum writesi found out that tuberculosis appears to be the only medical as oppsed to psychiatriccondition that one can be committed for and this is because very specific laws wereenacted many years ago regarding tb i am certain these vary from state to statei think in illinois venereal disease the old ones not aids was includedsyphillis was for sure gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re tuberculosisin article mariscsvaxuniedu klieriscsvaxuniedu writesmultiple drug resistance in tb is a relatively new phenomenon andone of the largest contributing factors is that people are no longeras scared of tb as they were before antibiotics it was roughly asfeared as hiv is nownot that new years ago we had drug addicts harboring active tbthat was resistant to everything in chicago the difference nowis that such strains have become virulent in the old days suchtb was weak it didnt spread to other people very easily and justinfected the one person in whom it developed because of noncompliancewith medications noncompliance and development of resistant strainshas been a problem for a very long time that is why we have like drugs against tb there is always a need to develop new ones due tosuch strains now however with a virulent resistant strain weare in more trouble and measures to assure compliance may be necessaryeven if they entail force gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re fungus epidemic in cain article stewardcupportalcom john joseph deltuvia writesthere was a story a few weeks ago on a network news show about some sortof fungus which supposedly attacks the bone structure and is somewhatwidespread in california anybody hear anything about this onethe only fungus i know of from california is coccidiomycosis ihadnt heard that it attacked bone it attacks lung and if youare especially unlucky the central nervous system nothing newabout it its been around for years they call it valleyfever since it is found in the inland valleys not on the coast gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re travel outside us bangladeshin article pciqinnthtamsuntamuedu covingceetamuedu just george writesi will be traveling to bangaldesh this summer and am wonderingif there are any immunizations i should get before goingyou can probably get this information by calling your public healthdepartment in your county in pittsburgh they give the shots freeas well there are bulletins in medical libraries that giverecommendations or you could call the infectious diseases sectionof the medicine department of your local medical school you alsowill probably want to talk about malaria prophylaxis you willneed your doctor to get the prescription gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re compartment syndrome general information references etcin article cfddboeingcom lrycfddboeingcom larry yeagley writesi have an acquaintance who has been diagnosed as having blood clots andcompartment syndrome i searched the latest edition of the columbia medicalencyclopedia and found nothing mosbys medical dictionary gives a very briefdescription which suggests its an arterial condition can someone point me ancompartment syndrome occurs when swelling happens in a compartmentbounded by fascia the pressure rises in the compartment and bloodsupply and nerves are compromised the treatment is to open thecompartment surgically the most common places for compartmentsyndromes are the forearm and calf it is an emergency sinceif the pressure is not relieved stuff will die gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re xraysin article marlelandstanfordedu iceskatelelandstanfordedu lin writesfirst question how bad is xray ive heard that its nothing compared to the amount of time spent under the sun and ive also heard that itis very harmful second question is there anyway out of this yearly test formethe yearly chest xray provides a minute amount of radiation it isa drop in the bucket as far as increased risk is concerned who cantell you whether you can get out of it or not no one here controlsthat it may well be a matter of the law in which case write yourlegislator but dont hold your breath gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from wrightducahicom david wrightsubject re name of mds eyepiecein article pittuucp gebcspittedu gordon banks writesin article cihmgswatsonibmcom clarkewatsonibmcom ed clarke writes its not an eyepiece it is called a head mirror all doctors nevera speculumthe speculum is the little cone that fits on the end of the otoscopethere are also vaginal specula that females and gynecologists areall too familiar within fairness we should note that if you look up speculum in thedictionary which i did when this question first surfaced the firstdefinition is a mirror or polished metal plate used as a reflector inoptical instrumentswhich doesnt mean the name fits in this context but its not as faroff as you might think david wright hitachi computer products america inc waltham ma wrighthicombhicom these are my opinions not necessarily hitachis though they are the opinions of all rightthinking peoplefrom ritleyuimrlmrluiucedu subject mystery illness with spotsi attended high school in the san jose california area in the early sand i remember a smallish outbreak of a strange illness in whichpeople developed measleslike spots on their bodies this conditionseemed to last only a few days and i dont recall anyone reporting any othersymptoms i seem to recall reading somewhere that this was believed to havebeen viral in nature but i dont know for surehowever i have been curious since then about thisanyone have any ideas about what this might have beenfrom walkupcswashingtonedu elizabeth walkupsubject re menangitis questionin article pittuucp gebcspittedu gordon banks writes the neiseria meningococcus is one of the most commonforms of meningitis its the one that sometimes sweepsschools or boot camp it is contagious and kills by attackingthe covering of the brain causing the blood vessels to thromboseand the brain to swell upit can live in the throat of carriers dont worry you wont get it from them especially if they took the medicationassuming one has been cultured as having a throat laden withneiseria meningococcus and given and taken a course of eryc without the culture becoming negative should one worry aboutbeing a carrier elizabeth walkupcswashingtonedufrom nscruxcitcornelledu nathan otto siemerssubject re analgesics with diuretics on tue apr gmt dyerspdcccom steve dyer said in article ofklvewbavuktoandrewcmuedu lawrence curcio lcbandrewcmuedu writesi sometimes see otc preparations for muscle achesback aches thatcombine aspirin with a diuretic you certainly do not see otc preparations advertised as such the only such ridiculous concoctions are nostrums for premenstrual syndrome ostensibly to treat headache and bloating simultaneously theyre worthlessthe idea seems to be to reduceinflammation by getting rid of fluid does this actually work thats not the idea and no they dont worki believe there is a known synergism between certainanalgesics and caffiene for treating pain not inflammationnow that i am an ibuprofen convert i havent taken it for sometime but excedrin really works grinnathan steve dyer dyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyer bbnathanchemrestncornelledu bbbbb p pfrom ebworldstdcom edwin barkdollsubject re blindsightin article pittuucp gebcspittedu gordon banks writesin article wernertolmacsoeberkeleyedu wernersoeberkeleyedu john werner writesin article pittuucp gebcspittedu gordon banks wrote explain i thought there were types of cones equivalent to rgbyoure basically right but i think there are just types one issensitive to red and green and the other is sensitive to blue and yellow this is why the two most common kinds of colorblindness are redgreen andblueyellowyes i remember that now well in that case the cones are indeedcolor sensitive contrary to what the original respondent had claimedim not sure who the original respondent was but toreiterate cones respond to particular portions of the spectrum justas rods respond to certain parts of the visible spectrum bluegreenin our case reddish in certain amphibia just as the hoseshoe crablimulus polyphemus photoreceptors respond to a certain portion ofthe spectrum etc it is a common misconception to confound wavelengthspecificity with being color sensitive however the two are notsynonymousso in sum and to beat a dead horse when the outputs of a cone are matched for number ofabsorbed photons irrespective of the absorbed photons wavelengththe cone outputs are indistinguishable cones are simply detectors with different spectralsensitivities and are not any more color sensitive than are rodsommatidia or other photoreceptors color vision arises because outputs of receptors whichsample different parts of the spectrum cones in this case areprocessed centrally the handwave is intentionalive worked and published research on rods and cones for over years so the adherence to the belief that cones can detect coloris frustrating but dont take my word for it im reposting a fewexcellent articles together with two rather good but oldish colorvision textsthe textsrobert boynton human color vision holt rhiehart and winstonleo m hurvich color vision sinauer associatesthe original articlesbaylor and hodgkin detection and resolution of visual stimuli byturtle phoreceptors j physiol ppbaylor lamb and yau reponses of retinal rods to single photonsj physiol ppschnapf et al visual transduction in cones of the monkeymacaca fascicularis j physiol pp edwin barkdollbarkdolllepomispsychupenneduebworldstdcom edwin barkdollebworldstdcomfrom doylepittedu howard r doylesubject re donating organsin article pittuucp gebcspittedu gordon banks writesin article marsbcssunysbedu mhollowaicsunysbedu michael holloway writesthere been anything recent in transplant proceedings or somesuch on xenografts how about liver section transplants from living donors im sure the pittsburgh group has published the baboon work but idont know where in chicago they were doing lobe transplants fromliving donors and im sure theyve published the case report of the first xenotransplant was published in lancet i can send you a reprint if you are interestedthere was another paper sort of a tour of the horizon written by starzl andpublished in the residents edition of the annals of surgery vol october its in the surgical residents newsletter section so you wont find it in the regularissue of the annals i dont have any reprints of that onea paper has been accepted for publication by immunology today though im not surewhen its coming out describing our experience with the two xenografts done to dateas for segmental liver transplants from living related donors i must confess to a totalignorance of that literature we are philosophically opposed to those and i dont keep up with that particular fieldhoward doyledoylepittedufrom mcelwrecnsvaxuwecedusubject natural anticanceraids remedies the biggest reason why the cost of medical care is so extremely high andincreasing is that natural methods of treatment and even diagnosis are stillbeing systematically ignored and suppressed by the moneygrubbing and powermongering medical establishment some examples of very low cost natural anticancer remedies are listed inthe following article natural anticancer remedies a rd opinion some of these remedies also work against aids disclaimer this list was compiled from unorthodox sources that have shown themselves to be reliable the compiler of this list is not a doctor of any kind but is exercising his first amendment constitutional right of free speech on the subjects of his choice most of these remedies can be found in any grocery store most of the rest of them can be found in any health food store what is important is how they are used and what else is excluded during their use the day fast st day eat as much fresh fruit as you want one kind at a time preferably grapes nd day eat all the vegetables you want at least half raw including garlic also whole kernel corn to help scrape clean the intestinal linings rd day drink all the fresh fruit and vegetable juice you want preferably start with to ounces of prune juice with pulp followed by a gallon of pure not from concentrate apple juice then grape juice stay close to your home bathroom th day eat all the unsalted nuts no peanuts and dried fruit you want preferably raisins and almonds almonds contain laetrile th day one gallon of lemonade squeeze the juice from two lemons into a gallon of water preferably distilled and add to tablespoons of locallymade honey no sugar drink one glass per hour everyone including healthy people should do this one day every week preceded by a large glass of prune juice with pulp th day same as th day th day same as th day all days eat only the foods listed above for each day along with your usual vitamin and mineral supplements plus as much distilled water as you want the grape diet eat to ounces of fresh grapes every hours am to pm every day for six days eat nothing else during the six days but drink as much distilled water as you want apple cider vinegar mix a teaspoon of pure apple cider vinegar not apple cider flavored vinegar regular vinegar is harmful in a glass of water preferably distilled and drink all of it do this or times per day for weeks then stop for a week repeat if desired do this along with a normal healthy diet of natural foods this remedy is especially effective against those types of cancer that resemble a fungus as well as against other kinds of fungus infections the seasalt soda bath please keep an open mind fill a bathtub with moderately warm water so the level comes up almost to the overflow drain when you get in immerse yourself in it for a minute and then completely dissolve in the bath water pound of sunevaporated seasalt regular salt wont work and pound of fresh bakingsoda soak in this bath for to minutes while exercising your fingers toes and limbs turning sideways and onto your stomach dunking your head sitting up and laying back down chomping your teeth together etc among other things the seasalt soda bath neutralizes the accumulated effects of xrays etc as described in the book born to be magnetic vol by frances nixon precautions only the one person using each bath should prepare it and drain it for at least minutes after taking the bath stay away from and even out of sight of other people your greatly expanded aura energyfield during that time could disrupt other peoples fields two hours after the bath eat at least ounces of yogurt containing active yogurt cultures the bath may kill friendly bacteria also better yet take a billionbacteria acidophilus capsule which is also an excellent daily remedy against the effects of aids because it kills all kinds of harmful bacteria in the digestive tract taking a big load off the remaining immune system because this external bath can kill internal bacteria it may also be a cure for lyme disease do not take this bath within a few hundred miles of a thunder storm within days of a full moon nor during major or minor periods as listed in the solunar tables published bimonthly in field stream magazine because of the measurable disruptive ambient environmental energyfields present at those times do not take this bath more than four times per year miscellaneous natural anticancer remedies for skin cancer apply stabilized aloe vera jel to the affected skin twice daily and take to tablespoons per day of stabilized aloe vera juice internally for about months dmso dimethyl sulfoxide causes cancer cells to perform normal cell functions almonds unblanched unroasted contain laetrile to help prevent cancer eat several almonds every day to help cure cancer eat several ounces of almonds per day never take large concentrated doses of laetrile orally it will kill you take it intravenously only cancer cells contain a certain enzyme which converts laetrile into cyanide which then kills the cell this enzyme is also present in the digestive system antioxidants are freeradical scavengers and include vitamin e selenium mcg per day is safe for most people chromium up to mcg per day vitamin a iu per day is safe for most people superoxide dismutase up to units per day vitamin c up to mg per day and bht butylated hydroxy toluene to capsules of bht every night at bedtime will also make one immune against herpes both types suppress herpes symptoms if one already has herpes prevent spreading herpes to other people but will not cure herpes bht might also do these things against aids which is really a form of cancer similar to leukemia see the book life extension by durk pearson and sandy shaw hydrogenperoxide dilute twelve drops of hydrogenperoxide in a glass of pure water preferably distilled and drink it do this once or twice per day hours before or after eating or drinking anything else apply hydrogenperoxide directly to skin cancers several times per day use hydrogenperoxide only if you are taking a good daily dose of some of the various antioxidants described above vitamin mineral supplements are more effective and much less expensive when combined together in mega doses into single tablets made from natural sources cancer cells can not live in a strong maxwell north magnetic field especially if it is pulsating on and off a strong south magnetic field is an aphrodisiac in my opinion all types of ionizing radiation treatments for cancer should be replaced with daily minute doses of pulsating maxwell north magnetic fields properly made and operated radionicspsionics machines can both diagnose and cure all forms of cancer as well as most other medical problems some radionicspsionics machines can even take crosssectional xraylike photos of cancer tumors etc without xrays interferon tablets taheebo tea lapacho homeopathy can cure cancer and many other medical problems even drug addiction mg per day of chelated zinc can help prevent or cure prostate trouble this list is not exhaustive the above natural remedies can cure both diagnosed and un diagnosed cancers as well as prevent them and also prevent and cure many other medical problems including heart diseases they are not too simple and inexpensive to work effectively besides acting on a person biologically and chemically these remedies especially the day fast and the grape diet send a strong message to ones subconscious mind programming it to cure the cancer in my opinion if a person finds out that she has cancer then she should promptly try at least the first remedies described above in sequence starting with the day fast before resorting to the unnatural and expensive mutilations and agonies poison burn and mutilate of orthodox cancer treatment organiedcrime disclaimer this list was compiled from unorthodox sources that have shown themselves to be reliable the compiler of this list is not a doctor of any kind but is exercising his first amendment constitutional right of free speech on the subjects of his choice for more information contact cancer control society n berendo st los angeles ca andor other organiza tions listed in the alternative medicine and holistic medicine portions of the health and medical organizations section section of the latest edition of the encyclope dia of associations reference book in your local public or university library unaltered reproduction and dissemination of this important information is encouraged robert e mcelwaine from bhjellecarinaunmedu subject re fungus epidemic in cain article pittuucp gebcspittedu gordon banks writesin article stewardcupportalcom john joseph deltuvia writesthere was a story a few weeks ago on a network news show about some sortof fungus which supposedly attacks the bone structure and is somewhatwidespread in california anybody hear anything about this onethe only fungus i know of from california is coccidiomycosis ihadnt heard that it attacked bone it attacks lung and if youare especially unlucky the central nervous system nothing newabout it its been around for years they call it valleyfever since it is found in the inland valleys not on the coastthere is a miniepidemic of coccidiodes that is occurring ini believe the owens valley bishop area east of the sierrasi dont believe there has been any great insight into theincreased incidence in that area there is a lowlevelof endemic infection in that region many people withevidence of past exposure to the organism did not haveserious diseasebrianfrom bshelleyucsindianaedu subject xanaxplease provide infoi am currently doing a group research project on the drug xanax i wouldbe exponentially gracious to receive any and all information you couldprovideme regarding its usage history mechanism of reaction side effects andother pertinent information i dont care how long or how short your response isthanks in advancebrent e shelleyfrom lindaenetcomcomsubject re morbus meniere is there a real remedyin article pittuucp gebcspittedu gordon banks writesin article lindaecjglkfxmnetcomcom lindaenetcomcom writesmy biggest resentment is the doctor who makes it seem like mostpeople with dizziness can be cured thats definitely not thecase in most cases like i said above it is a long tediousprocess that may or may not end up in a partial cure be sure to say chronic dizziness not just dizziness mostpatients with acute or subacute dizziness will get betterthe vertiginous spells of menieres will also eventually goaway however the patient is left with a deaf earall true and all good pointsto anyone suffering with vertigo dizziness or any variationthereof my best advice to you as a fellowsufferer is thisjust keep searchingdont let the doctors tell you theresnothing that can be donedo your own researchand let yourthis may have helped you but im not sure it is good generaladvice the odds that you are going to find some miracle withyour own research that is secret or hidden from general knowledgefor this or any other disease are slim when good answers to thesethen spending a great deal of time and energy on the medicalproblem may divert that energy from more productive thingsin life a limited amount should be spent to assure yourselfthat your doctor gave you the correct story but after it becomesclear that you are dealing with a problem for which medicinehas no good solution perhaps the best strategy is to jointhe support group and keep abreast of new findings but not tomake a career out of itwell making a career out of it is a bit strong i still believethat doing your own research is very very necessary i wouldnot have progressed as much as i have today unless i had spentthe many hours in stanfords med library as i have doneand years ago it was clear that there was no medicine that would help me so should i have stopped searching thankgoodness i didnt now i found that there is indeed medicinethat helps me i think that what youve said is kind of idealistic that youwould go to one doctor get a diagnosis maybe get a secondopinion and then move on with your lifejust as an example having seen of the top specialists in this field in the country i have received different diagnosesthese are the top names the ones that people come to from all overthe country i have had to sort all of this out myself goingto a support group and in fact heading that support group was helpful for a while but after a point i found it veryunproductive it was much more productive to do library researchmake phone calls and put together the pieces of the puzzle myselfa recent movie lorenzos oil offers a perfect example of whatim talking about if you havent seen it you should its nota put down of doctors and neither is what im saying doctors areonly human and can only do so much but there are those of usout here who are intelligent and able to sometimes find a missingpiece of the puzzle that might have otherwise gone unnoticedi guess im biased because dizziness is one of those weird thingsthat is still so unknown if i had a broken arm or a weak heartor failing kidneys i might not have the same opinion thats because those things are much more tangible and have much more concise definitions and treatments with dizziness you just have todecide to live with it or decide to live with it while trying tofind your way out of iti have chosen the latterlindalindaenetcomnetcomcom gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from dan wallach dwallachcsberkeleyedusubject faq typing injuries keyboard alternatives monthly postingarchivename typinginjuryfaqkeyboardsversion revision date answers to frequently asked questions about keyboard alternativesthe alternative keyboard faqcopyright by dan wallach dwallachcsberkeleyeduthe opinions in here are my own unless otherwise mentioned and do notrepresent the opinions of any organization or vendorcurrent distribution scimedoccupational scimed comphumanfactors newsscicompanswers and email to chealthiubvmucsindianaedu sorehandvmucsfedu and cstglvtvmccvteduchanges since previously distributed versions are marked with change bars to the right of the text as is this paragraph information in this faq has been pieced together from phone conversationsemail and product literature while i hope its useful the informationin here is neither comprehensive nor error free if you find somethingwrong or missing please mail me and ill update my list thanksall phone numbers unless otherwise mentioned are usa phone numbersall monetary figures unless otherwise mentioned are usa dollarsproducts covered in this faq using a pcs keyboard on your workstation compatibility issues apple computer inc key tronic flexpro dragon systems the bat datahand comfort keyboard system kinesis ergonomic keyboard maltron the tony ergonomic keysystem the vertical the mikey the wave the minimal motion computer access system twiddler halfqwerty microwriter braille n speak octima accukeygif pictures of many of these products are available via anonymous ftpfrom sodaberkeleyedupubtypinginjury i highlyrecommend getting the pictures they tell much more than i can fitinto this fileif you cant ftp send me mail and ill uuencode and mail them to youtheyre pretty bigusing a pcs keyboard on your workstation compatibility issues mini outline spoofing a keyboard over the serial port x terminals next silicon graphics ibm rs other stuff spoofing a keyboard over the serial portif youve got a proprietary computer which uses its own keyboardsun hp dec etc then youre going to have a hard time findinga vendor to sell you a compatible keyboard if your workstationruns the x window system youre in luck you can buy a cheap usedpc hook your expensive keyboard up to it and run a serial cableto your workstation then run a program on the workstation to readthe serial port and generate fake x keyboard eventsthe two main programs ive found to do this are kt and axax is a sophisticated program capable of controlling the mouse andeven moving among widgets on the screen it requires a serverextension xtest decxtrap or xtestextension to find out if yourserver can do this run xdpyinfo and see if any of these stringsappear in the extensions list if your server doesnt have thisyou may want to investigate compiling xr patchlevel or lateror bugging your vendorkt is a simpler program which should work with unextended x serversanother program called xsendevent also exists but i havent seen itboth ax and kt are available via anonymous ftp from sodaberkeleyedu x terminalsalso a number of x terminals ncd tektronics to name a few usepccompatible keyboards if you have an x terminal you may be allset try it out with a normal pc keyboard before you go through thetrouble of buying an alternative keyboard also some x terminals addextra buttons you may need to keep your original keyboard aroundfor the onceinabluemoon that you have to hit the setup key nextnext had announced that new next machines will use the apple desktopbus meaning any mac keyboard will work then they announced theywere cancelling their hardware production if you want any kind ofupgrade for an older next do it now silicon graphicssilicon graphics has announced that their newer machines indigo andbeyond will use standard pccompatible keyboards and mice i dontbelieve this also applies to the power series machines its notpossible to upgrade an older sgi to use pc keyboards except byupgrading the entire machine contact your sgi sales rep for moredetails ibm rsibm rs keyboards are actually similar to normal pc keyboards unfortunately you cant just plug one in you need two things a cable converter to go from the large pc keyboard connector to the smaller ps style din and a new device driver for aix believe it or not ibm wrote this device driver recently i used it and it works however they dont want me to redistribute it ive been told judy hume is a potential contact if you learn anything new please send me email other stuffsome vendors here notably health care keyboard co and accucorpsupport some odd keyboard types and may be responsive to yourqueries regarding supporting your own weird computer if you canget sufficient documention about how your keyboard works eitherfrom the vendor or with a storage oscilloscope you may be inluck contact the companies for more detailsapple adjustable keyboard apple computer inc sales offices all over the place availability february price supports mac only apple has recently announced their new splitdesign keyboard the keyboard has one section for each hand and the sections rotate backward on a hinge the sections do not tilt upward the keys are arranged in a normal qwerty fashion the main foldable keyboard resembles a normal apple keyboard a separate keypad contains all the extended key functions the keyboard also comes with matching wrist rests which are not directly attachable to the keyboard as soon as soda comes back up ill have a detailed blurb from tidbits available thereflexpro keyboard key tronic phone possible contact denise razzeto sold by many clone vendors and pc shops availability spring price supports pc only highly likely keytronic apparently showed a prototype keyboard at comdex its another splitdesign one thumbwheel controls the tilt of both the left and righthand sides of the main alphanumeric section the arrow keys and keypad resemble a normal key pc keyboard keytronic makes standard pc keyboards also so this product will probably be sold through their standard distribution channelsdragondictatek and numerous other dragon products dragon systems inc nevada street newton ma phone talktyp or fax shipping now price dragondictatek end user system dragonwriter end userdeveloper system various other prices for service contracts site licenses etc compatibility or higher pc only rd party support for macfree software support for x windows is also available yourpc with dragon hardware talks to your workstation over aserial cable or network the program is called ax and isavailable via anonymous ftpsodaberkeleyedupubtypinginjuryaxtarzexportlcsmiteducontribaxtarz most currentif you want to use your dragon product with x windows you may wantto ask for peter cohen an salesman at dragon who knows more aboutthis sort of thing dragon systems sells a number of voice recognition products most if not all of them seem to run on pcs and compatibles including pss and other microchannel boxes they sell you a hardware board and software which sits in front of a number of popular word processors and spreadsheets each user trains the system to their voice and there are provisions to correct the system when it makes mistakes on the fly multiple people can use it but you have to load a different personality file for each person you still get the use of your normal keyboard too on the dragondictatek you need to pause th sec between words dragon claims typical input speeds of words per minute i dont have specs on the dragonwriter the dragondictatek can recognize words at a time the dragonwriter can recognize you guessed it words at a time dragons technology is also part of the following products about which i have no other infomicrosoft windows sound system voice pilotibm voicetypevoice navigator ii by articulate systems for macintoshemstation by lanier voice products emergency medical workstationthe bat old phone number current phone number infogrip inc north blvd baton rouge louisiana usa ward bond main contact david vicknair did the unix software shipping now supports mac ibm pc serial port native keyboard port version coming very soon no other workstations supported but serial support for unix with x windows has been written pc and mac are getting all the real attention from the company a chording system one hand is sufficient to type everything the second hand is for redundancy and increased speed price dual set each one is a complete keyboard by itself singlecheaper prices were offered at macworld expo as a showspecialdatahand industrial innovations inc north th street scottsdale arizona usa mark roggenbuck contact supports pc and mac shipping in beta big backlog could take months price unit unit pods new price each hand has its own pod each of the four main fingers has five switches each forward back left right and down the thumbs have a number of switches despite appearances the key layout resembles qwerty and is reported to be no big deal to adapt to the idea is that your hands never have to move to use the keyboard the whole pod tilts in its base to act as a mouse see also the detailed review written by cliff lasser calthinkcom available via anonymous ftp from sodaberkeleyeducomfort keyboard system fax health care keyboard company n w appleton ave menomonee falls wisconsin usa jeffrey szmanda vice president contact shipping now supports pc and mac planned future supportibm key layout style i believesun sparcdecision dataunisys utssilicon graphicsothers to be supported later the hardware design is relativelyeasy for the company to reconfigure price including one system personality module the idea is that one keyboard works with everything you purchase compatibility modules a new cord and possibly new keycaps and then you can move your one keyboard around among different machines its a threepiece folding keyboard the layout resembles the standard key keyboard except sliced into three sections each section is on a custom telescoping universal mount each section independently adjusts to an infinite number of positions allowing each individual to type in a natural posture you can rearrange the three sections too have the keypad in the middle if you want each section is otherwise normalshaped ie you put all three sections flat and you have what looks like a normal key keyboardkinesis ergonomic keyboard fax kinesis corporation pacific highway south seattle washington usa shirley lunde vp marketing contact shipping now supports pc mac and sun sparc in the works price volume discounts available the includes one footpedal one set of adhesive wrist pads and a typingtutor programan additional foot pedal and other accessories are extra the layout has a large blank space in the middle even though the keyboard is about the size of a normal pc keyboard slightly smaller each hand has its own set of keys laid out to minimize finger travel thumb buttons handle many major functions enter backspace etc you can remap the keyboard in firmware very nice when software wont allow the reconfig foot pedals are also available and can be mapped to any key on the keyboard shift control whatevermaltron united kingdom pcd maltron limited orchard lane east molesey surrey kt obn england pamela and stephen hobday contacts us distributorjim barrettapplied learning corp glen hardie roadwayne pa phone supports pcs amstrad bbc b bbc master mac apparently now also available price pounds shipped in the usa basically converted price shipping the cost is less for bbc computers and they have a number of accessories including carrying cases switch boxes to use both your normal keyboard and the maltron an articulated arm that clamps on to your table and training courses to help you learn to type on your maltron you can also rent a keyboard for poundsweek taxes us price month and then off purchase if you want it shipping now in your choice of colors black or grey maltron has four main products a twohanded keyboard two onehanded keyboards and a keyboard designed for handicapped people to control with a mouthstick the layout allocates more buttons to the thumbs and is curved to bring keys closer to the fingers a separate keypad is in the middleaccukey accucorp inc po box christiansburg va usa pete rosenquist sales larry langley president shipping now supports pc mac ibm sun sparc and televideo and cost shipping doesnt use conventional pushkeys soft rubber keys which rock forward and backward each key has three states make chords for typing keys learning time is estimated to be hours for getting started and maybe two weeks to get used to it currently the thumbs dont do anything although a thumbtrackball is in the works the company claims it takes about a week of work to support a new computer they will be happy to adapt their keyboard to your computer if possibletwiddler or handykey mt sinai ave mt sinai ny chris george president shipping now price supports pc only mac and x windows in the works the twiddler is both a keyboard and a mouse and it fits in one hand you type via finger chords shift control etc are thumb buttons when in mouse mode tilting the twiddler moves the mouse and mouse buttons are on your fingers the cabling leaves your normal keyboard available also most applications work and windows works fine desqview has trouble geoworks also has trouble mouse works keyboard doesntbraille n speak blazie engineering mill green rd street md usa information provided by doug martin martinnoscmil the braille n speak uses any of several braille codes for entering information grade i grade ii or computer braille basically letters aj are combinations of dots and letters kt are the same combinations as aj with dot added letters u v x y and z are like ae with dots and added w is unique because louis braille didnt have a w in the french alphabetthe tony ergonomic keysystem tony hodges the tony corporation thompson court mountain view ca usa supports mac pc ibm sun and dec shipping price you commit now and then youre in line to buy the keyboard when it ships if its cheaper you pay the cheaper price if its more expensive you still pay the tony should allow separate positioning of every key to allow the keyboard to be personally customized a thumboperated mouse will also be availablethe vertical contact jeffrey spencer or stephen albert po box la jolla ca usa supports no info available probably pcs available summer price the vertical keyboard is split in two halves each pointing straight up the user can adjust the width of the device but not the tilt of each section sideview mirrors are installed to allow users to see their fingers on the keysthe mikey dr alan grant woodhollow drive chevy chase maryland usa shipping as of july should be available in one year supports pc mac maybe price estimated the keyboard is at a fixed angle and incorporates a builtin mouse operated by the thumbs function keys are arranged in a circle at the keyboards leftthe wavewas fax iocomm international technology yukon avenue hawthorne california usa robin hunter contact in sales cost for a set of cables supports pc only shipping now iocomm also manufactures ordinary key keyboard pcat and key keyboard pcxt so make sure you get the right one the onepiece keyboard has a builtin wristrest it looks exactly like a normal key pc keyboard with two inches of builtin wrist rest the key switch feel is reported to be greatly improved the minimal motion computer access system fax equal access computer technology dr michael weinreigh oneida rd acton ma usa price infogripcompatible a few hundred dollars a onehanded bat for their own system dos software a few hundred dollars shipping these are custommade so an occupational therapist would make mouldsdo whatever to make it for you you can buy one now supports pc only although the infogripcompatible version might work with a mac in a onehanded version there is exactly one button per finger in a twohanded version you get four buttons per finger and the thumbs dont do anything you can also get onehanded versions with three thumb buttons compatible with the infogrip bat basically get it any way you want they also have a software tutorial to help you learn the chording works on a pc under dos not windows planning on macintosh and pcwindows support no work has been done on a unix version yethalfqwertycanada the matias corporation thistledown boulevard rexdale ontario canada mv k email ematiasdgptorontoedu supports mac and pc but not windows demo for anonymous ftp explorerdgptorontoedupubhalfqwerty price higher in canada quantity discounts available shipping now this thing is purely software no hardware at all the software will mirror the keyboard when you hold down the space bar allowing you type onehandedoctimaisrael fax ergoplic keyboards ltd po box kiryat ono israel info from mandy jaffekatz rxhfunhaifauvmbitnet a onehanded keyboardmicrowriter agenda uk fax microwriter systems plc msa house albany court albany park frimley surrey gu xa united kingdom info from carroll morgan carrollmorganprgoxfordacuk the agenda is a personal desktop assistant pda style machine you can carry it along with you it has chording input you can also hook it up to your pc or even program it it costs just under pounds with k memorythanks go to chris bekins asccbforsythestanfordedu for providingthe basis for this informationthanks to the numerous contributorsdoug martin martinnoscmilcarroll morgan carrollmorganprgoxfordacukmandy jaffekatz rxhfunhaifauvmbitnetwes hunter wesleyhunteratlantagancrcompaul schwartz pschwrtzcswashingtoneduhj woltring woltringnicikunnldan sorenson vikingiastateeduchris vanharen vanharenmiteduravi pandya ravixanaducomleonard h tower jr toweraimitedudan jacobson danjacobsonattcomjim cheetham jimoasisiclcoukcliff lasser calthinkcomrichard donkin richarddhoskynscoukpaul rubin phrnapatelebitcomdavid erb erbfullfeedcombob scheifler rwsexpolcsmiteduchris grant chrisgrantumccumicheduscott mandell sempostofficemailcornelleduand everybody else who ive probably managed to forgetthe opinions in here are my own unless otherwise mentioned and do notrepresent the opinions of any organization or vendor dan wallach one of the most attractive features of a connectiondwallachcsberkeleyedu machine is the array of blinking lights on the facesoffice of its cabinet cm paris ref manual v pfrom dan wallach dwallachcsberkeleyedusubject faq typing injuries software monitoring tools monthly postingarchivename typinginjuryfaqsoftwareversion th december this faq is actually maintained by richard donkin richarddhoskynscouki post it along with the other faq stuff if you have questions you wantto send mail to richard not me dan software tools to help with rsi this file describes tools primarily software to help prevent or manage rsithis version now includes information on such diverse tools as calendarprograms and digital watches please let me know if you know any other tools or if you have informationor opinions on these ones and i will update this faqi am especially interested in getting reviews of these products from peoplewho have evaluated them or are using them richard donkin internet mail richarddhoskynscouk tel directfax changes in this version added information on stressfree another typing management tool for windowstyping management tools these aim to help you manage your keyboard useby warning you to take a break every so often the better ones also includeadvice on exercises posture and workstation setup some use sound hardware to warn of a break others use beeps or screen messagesoften rsi appears only after many years of typing and the pain hasa delayed action in the short term too frequently you can be typingall day with little problem and the pain gets worse in the eveningthese tools act as an early warning system by listening to theirwarnings and taking breaks with exercises you dont have to wait for your body to give you a more serious and painful warning that is getting rsi tool at your service commercial software available frombright startel platforms mac system windows descriptionprovides calendar keyboard watch email watch and system info warns when to take a break configurable has a few recommendationson posture and exercises soundoriented will probably work best with sound card pc or with microphone mac should be possibleto record your own messages to warn of break tool audioport sound card and software available frommedia visiontel platforms pc descriptiona sound card to plug into your pc parallel portincludes at your service tool computer health break commercial software available fromescape ergonomics inc w el camino realsuite mailstop sunnyvale catel platforms dos descriptionaimed at preventing rsi this program warns you to takebreaks after a configurable interval based on clock time orafter a set number of keystrokes whichever is earlierit gives you exercises to do each time randomly selected froma set of exercises are apparently tuned to the type of workyou do data entry word processing information processingexercises are illustrated and include quite a lot of text onhow to do the exercise and on what exactly the exercise doeschb includes hypertext information on rsi that you can use to learn more about rsi and how to prevent it other informationon nonrsi topics can be plugged into this hypertext viewera full glossary of medical terms and jargon is includedchb can be run in a dos box under windows but does not thenwarn you when to take a break it does not therefore appearuseful when used with windowscost quantity discounts site licenses commentsthe keystrokecounting approach looks good it seems betterto measure the activity that is causing you problems than tomeasure clock time or even typing time the marketing stuffis very good and includes some summaries of research papersas well as lots of arguments you can use to get your company to pay up for rsi management tools tool eyercise commercial software available fromran enterprisesone woodland park drhaverhill ma ustel us only platforms windows os pm not dos descriptionaimed at preventing rsi and eye strain this program warns you to takebreaks after a configurable interval or at fixed times optionallydisplays descriptions and pictures of exercises pictures areanimated and program beeps you to help you do exercises at thecorrect rate includes stretches and visual training exercises can configure which are included and how many repetitionsyou do breaks last from to minutes also includes online help on workplace ergonomics quote from their literatureeyercise is a windows program that breaks up your day with periodicsets of stretches and visual training exercises the stretches workall parts of your body relieving tension and helping to preventrepetitive strain injury the visual training exercises will improveyour peripheral vision and help to relieve eye strain together thesehelp you to become more relaxed and productive the package includes the book computers visual stress by edward cgodnig od and john s hacunda which describes the ergonomic setupfor a computer workstation and provides procedures and exercises topromote healthy and efficient computer use cost including shipping and handling quantity discountsfor resellers free demo outside us commentsi have a copy of this and it works as advertised i would sayit is better for rsi prevention than rsi management because itdoes not allow breaks at periods less than minutes also itinterrupts you based on clock time rather than typing time whichis not so helpful unless you use the keyboard all day worked ok onwindows though it did occasionally crash with a uae not surewhy also refused to work with the space bar on one pc and hasone window without window controls very usable though and does notrequire any sound hardware tool lifeguard commercial software available fromvisionary softwarepo box portland or ustel platforms mac dos windows version underway descriptionaimed at preventing rsi warns you to take a breakwith dialog box and sound includes a list of exercisesto do during breaks and information on configuring yourworkstation in an ergonomic manner price quantity discounts and site licenses the dos product isbought in from another company apparently not sure howequivalent this is to the mac versionthe mac version got a good review in desktop publisher magazine feb good marketing stuff with useful page summaries of rsi problems and solutions with references tool stressfree commercial software free usable demo available fromlifetime softwarepo box houstontexas ustel us onlyfax mail compuservecomdemo working program but reduced functions available from compuserve windows advanced forum new uploads section or health and fitness forum issues at work section anon ftp ftpcicaindianaedu and mirroring sites platforms windows mac and dos versions underway descriptionaimed at preventing rsi this program warns you to takebreaks after a configurable interval or at fixed times displays descriptions and pictures of exercises pictures areanimated and program paces you to help you do exercises at thecorrect rate quite a few exercises can configure which onesare included to some extent online helpversion is out soon mac and dos versions will be basedon thiscost if support via compuserve or internet otherwise site license for or more copies is each note prices may have gone up for v commentsi have had a play with this and it works ok its user interfacedesign is much better in though still a bit unusualexpensive tool around and it does the job it is also the onlytool with a redistributable demo so if you do get the demo post iton your local bulletin boards ftp servers and bitnet serversdoes not include general info on rsi and ergonomics but it does have the ability to step backward in the exercise sequencewhich is good for repeating the most helpful exercises tool typewatch freeware version october available fromemail to richarddhoskynscoukanonymous ftp sodaberkeleyedupubtypinginjurytypewatchshar platforms unix tested on sco sunos mach character and x window mode descriptionthis is a shell script that runs in the background and warns youto stop typing based on how long you have been continuouslytyping it does not provide exercises but it does checkthat you really do take a break and tells you when youcan start typing again typewatch now tells you how many minutes you have been typingtoday each time it warns you which is useful so youknow how much you really type it also logs informationto a file that you can analyse or simply print out the warning message appears on your screen in character modein a popup window for x windows or as a zephyr messagefor those with athena stuff tim freeman tsfcscmuedu has put in a lot of bug fixes extra features and support for x zephyr and machnot formally supported but email richarddhoskynscoukfor sco sunos character mode or tsfcscmuedu for machx window mode zephyr if you have problems or want to give feedback tool various calendar batch queue programs available fromvarious sources platforms various descriptionany calendarreminder program that warns you of an upcomingappointment can be turned into an ad hoc rsi management toolor any batch queue submission program that lets you submita program to run at a specific time to display a message tothe screenusing windows as an example create a calendar file andinclude this filename in your wininis load line soyou get it on every startup of windows suppose youwant to have breaks every minutes starting from ampress f special time to enter an appointment enter hit enter and type some text in saying what the breakis for then press f to set an alarm on this entry and repeat for the next appointmentby using windows recorder you can record the keystrokesthat set up breaks throughout a day in a rec file put thisfile on your run line as above and you will then witha single keypress be able to set up your daily appointmentswith rsi exercisesthe above method should be adaptable to most calendar programs an example using batch jobs would be to submit a simple jobthat runs at am and warns you to take a break this willdepend a lot on your operating systemwhile these approaches are not ideal they are a good way of forcing yourself to take a break if you cant get hold of a suitable rsi management tool if you are techie enough you might want towrite a version of typewatch see above for your operatingsystem using batch jobs or whatever fits best tool digital watches with countdown timers available fromvarious sources eg casio bp descriptionmany digital watches have timers that count down from a settablenumber of minutes they usually reset easily to that number eithermanually or automatically while these are a very basic tool they are very useful if youare writing reading driving or doing anything away froma computer which can still cause or aggravate rsi the greatadvantage is that they remind you to break from whatever youare doing commentsmy own experience was that cutting down a lot on my typing led tomy writing a lot more and still reading as much as ever whichactually aggravated the rsi in my right arm though the leftarm improved getting a countdown timer watch has beenvery useful on some occasions where i write a lot in a dayi have tried an old fashioned hourglass type egg timer butthese are not much good because they do not give an audiblewarning of the end of the time periodkeyboard remapping tools these enable you to change your keyboard mappingso you can type onehandedly or with a different twohanded layout onehanded typing tools may help but be very careful about how you use them if you keep the same overall typing workload youare simply doubling your hand use for the hand that you use for typingand may therefore make matters worse tool hsh public domain available fromanonymous ftp sodaberkeleyedupubtypinginjuryhshshar platforms unix dont know which ones descriptionallows onehanded typing and other general keyboard remappingsonly works through ttys so you can use it with a terminal oran xterm but not most x programs tool dvorak keyboard tools various available fromanonymous ftp sodaberkeleyedupubtypinginjuryxdvorakcalso built into windows x descriptionthe dvorak keyboard apparently uses a more rational layoutthat involves more balanced hand use it may help preventrsi a bit but you can also use it if you have rsi since it will slow down your typing a lot dan wallach one of the most attractive features of a connectiondwallachcsberkeleyedu machine is the array of blinking lights on the facesoffice of its cabinet cm paris ref manual v pfrom ladyuhunixuhcchawaiiedu lee ladysubject re science and methodology was homeopathy traditionin article lsjgninnlcsaltillocsutexasedu turpincsutexasedu russell turpin writesi wrote or to use a phrasing that i think is more accurate science is the investigation of phenomena that avoids methods and reasoning that are known to be erroneous from past foulups in article ciuhbnbunyipccuqozau bdpsychpsyuqozau writes i can agree with this if you are talking about the less fundamental aspects of scientific method in fact i dont see the alternative as i dont think that the fundamentals are capable of experimental investigation in saying this i am agreeing with the work of people like kuhn feyerabend and lakatos while methodology cannot be subject to the same kind of experimentalinvestigation as that to which it is applied it can be criticallyappraised methodologies can be compared to each other sometimes bythe conflicting results they produce this kind of critical appraisaland comparison together with the inappropriateness of existingmethodologies for new fields of study is what drives the evolution ofmethodologies and how we think about them as usual you are missing the whole point russell because you are notwilling to even consider questionning your basic article of faith whichis that science is merely a matter of methodology and that the highestpurpose of science is to avoid making mistakes this is like saying that the most important aspect of business managementis accurate bookkeeping if science were no more than methodology and not making mistakes itwould be a poor thing indeed what was the methodology of darwin whatwas the methodology of einstein what was for that matter themethodology of jenner and pasteur in an earlier article russell turpin writes none of the foregoing should be read as meaning that we shouldopen the door to practitioners of quackery and psuedosciencemodern advocates of homeopathy chiropracty and traditionalchinese medicine receive little respect because for the mostpart they use methods and reasoning that the kind of researchlee lady recommends has shown to be terribly faulty this doesnot imply that all their treatments are ineffective it doesimply that those who rely on faulty methodology and reasoning areincapable of discovering which treatments are effective andwhich are notfirst of all i think you are arguing against a straw man because idont think that anyone here is arguing that quackery pseudosciencehomeopathy chiropracty and traditional chinese medicine should beaccepted as science i in particular think the basic ideas ofhomeopathy and chiropracty seem extremely flaky what some of us do believe however is that some of these thingsincluding some of the flaky ideas are deserving of serious scientificattention if in fact it were true as you have stated above that those who do notuse the currently fashionable methodology can have no idea what iseffective and what is not then science today would not exist for allof current science is based on the past work of scientists whosemethodology by current standards was seriously flawed it is certainly true that as methodology improves we need to reexaminethose results derived in the past using less perfect methodologies it isalso true that the results obtained by people today who still rely on those early methodologies needs to be reexamined in a more rigorous fashion by those qualified to do so credibly but to say that nobody who fails to do elaborate doubleblind studies iscapable of knowing their ass from a hole in the ground and to say that noideas that come from outside the scientific establishment could possiblybe worthy of serious investigation this truly marks ones attitude asdoctrinaire cultist this attitude is not compatible with a belief inreason in the arguments between behaviorists and cognitivists psychology seems less like a science than a collection of competing religious sects ladyuhunixuhcchawaiiedu ladyuhunixbitnetfrom dan wallach dwallachcsberkeleyedusubject faq typing injuries changes since last month monthly postingarchivename typinginjuryfaqchangesversion revision date this file details changes to the sodaberkeleyedu archive and summarizeswhats new in the various faq frequently asked questions documentsthis will be posted monthly along with the full faq to the various netgroups the various mailing lists will either receive the full faqevery month or every third month but will always get this file onceper month phewchanges to the typing injuries faq and sodaberkeleyedu archive this montha few new files on the sodaberkeleyedu archive the tidbits caring for your wrists document rsi network advice about adverse mechanical tension more details about the new apple keyboard more info about carpal tunnel syndrome carpalexplained more general info about rsi rsidetails rsiphysical marketing info on the vertical macweek article the batnew details on hooking a normal pc keyboard to an rsupdated pricing info on the datahand and comforthalfqwerty now available for anonymous ftp on explorerdgptorontoedunew gif picutures the apple adjustable keyboard the key tronic flexpro another picture of the kinesis the vertical the tonyif youd like to receive a copy of the faq and you didnt find it in thesame place you found this document you can either send email to dwallachcsberkeleyedu or you can anonymous ftp to sodaberkeleyedu and look in the pubtypinginjury directoryenjoy dan wallach one of the most attractive features of a connectiondwallachcsberkeleyedu machine is the array of blinking lights on the facesoffice of its cabinet cm paris ref manual v pfrom dan wallach dwallachcsberkeleyedusubject faq typing injuries general info monthly postingarchivename typinginjuryfaqgeneralversion revision date answers to frequently asked questions about typing injuriesthe typing injury faq sources of information for people with typinginjuries repetitive stress injuries carpal tunnel syndrome etccopyright by dan wallach dwallachcsberkeleyedumany faqs including this one are available on the archive sitepitmanagermitedu alias rtfmmitedu in the directorypubusenetnewsanswers the name under which a faq is archived appearsin the archivename line at the top of the article this faq is archivedas typinginjuryfaqgeneralztheres a mail server also just email mailserverpitmanagermiteduwith the word help on a line by itself in the bodythe opinions in here are my own unless otherwise mentioned and do notrepresent the opinions of any organization or vendor im not a medicaldoctor so my advice should be taken with many grains of saltcurrent distribution scimedoccupational scimed comphumanfactors newsscicompanswers and email to chealthiubvmucsindianaedu sorehandvmucsfedu and cstglvtvmccvteduchanges since previously distributed versions are marked with change bars to the right of the text as is this paragraph table of contents mailing lists newsgroups etc the sodaberkeleyedu archive general info on injuries typing posture ergonomics prevention treatment requests for more info references mailing lists newsgroups etcusenet newscomphumanfactors occasionally has discussion about alternative input devicescomprisks has an occasional posting relevant to injuries via computersscimed and mischandicap also tend to have relevant traffictheres a brand new newsgroup scimedoccupational chartered specificallyto discuss these things this would be the recommended place to postmailing liststhe rsi network available both on paper and via email this publication covers issues relevant to those with repetitive stress injuries for a sample issue and subscription information send a stamped self addressed business envelope to caroline rose paradise way palo alto ca email to croseapplelinkapplecom donation requested all rsi network newsletters are available via anonymous ftp from sodaberkeleyedu see below for detailschealth and sorehand are both ibm listserv things for those familiar with listserv heres the quick info chealth subscribe to listserviubvmucsindianaedupost to chealthiubvmucsindianaedu sorehand subscribe to listservvmucsfedupost to sorehandvmucsfeduquick tutorial on subscribing to a listserv mail listservvmucsfedu subject total listserv mania subscribe sorehand j random hacker info thats all there is to it youll get bunches of mail back from the listservincluding a list of other possible commands you can mail cool huh whatllthose bitnet people think of next the sodaberkeleyedu archiveive started an archive site for info related to typing injuries justanonymous ftp to sodaberkeleyedupubtypinginjury currently youll findinformative files typinginjuryfaq general information about typing injuries keyboards products to replace your keyboard software software to watch your keyboard usagechanges changes since last months edition new keyboardcommentary dans opinions on the keyboard replacements amtadvice about adverse mechanical tension caringforwristssithqx pagemaker document about your wrists caringforwristsps postscript converted version of above carpalinfo info on carpal tunnel syndrome carpalexplained very detailed information about cts carpalsurgery jama article on cts surgery carpaltidbits tidbits article on cts tendonitisinfo info on tendonitis rsibiblio bibliography of rsirelated publications rsinetwork archive of the rsi network newsletter currently containing issues through rsidetails long detailed information about rsi rsiphysical study showing rsi isnt just psychological various product literature applepress press release on the apple adjustable keyboard appletidbits extensive info about apples adjustable keybd batinfo macweek review on the bat comfort marketing info on the comfort keyboard datahandreview detailed opinions of the datahand datahandreview followup to above datahanddesc description of the datahands appearance kinesisreview one users personal opinions maltron marketing info on various maltron products maltronreview one users personal opinions verticalinfo marketing info on the vertical new programs with the exception of accpakexe everything here is distributed as source to be compiled with a unix system some programs take advantage of the x window system also hshshar a program for onehanded usage of normal keyboards typewatchshar tells you when to take a break xdvorakc turns your qwerty keyboard into dvorak xidleshar keeps track of how long youve been typing restremindersh yet another idle watcher kttar generates fake x keyboard events from the serial port use a pc keyboard on anything new improved version accpakexe a serial port keyboard spoofer for ms windows note axtar and rktar are both from exportlcsmiteducontrib so they may have a more current version than soda axtar a more sophisticated x keyboardmouse spoofing program supports dragondictate note a new version is now available rktar the reactive keyboard predicts what youll type next saves typingpictures in the gifs subdirectory howtositgif picture of good sitting posture the caringforwrists document is better for this accukeygif fuzzy picture accukeygif fuzzy picture with somebody using it applegif the apple adjustable keyboard batgif the infogrip bat comfortgif the health care comfort keyboard datahandgif fuzzy picture datahandgif key layout schematic datahandgif a much better picture of the datahand flexprogif the key tronic flexpro keyboard kinesisgif the kinesis ergonomic keyboard kinesisgif multiple views of the kinesis maltrongif several pictures of maltron products mikeygif the mikey mikeygif schematic picture of the mikey tonygif the tony ergonomic keysystem twiddlergif front view twiddlergif side view verticalgif the vertical keyboard wavegif the iocomm wave keyboardmany files are compressed have a z ending if you cant uncompress a filelocally soda will do it just ask for the file without the z extensionif youre unable to ftp to soda send me email and well see what wecan arrange general info on injuriesfirst and foremost of importance if you experience pain at all thenyou absolutely need to go see a doctor as soon as you possibly can thedifference of a day or two can mean the difference between a short recoveryand a long drawnout ordeal go see a doctor now your gardenvarietydoctor may not necessarily be familiar with this sort of injury generallyany hospital with an occupational therapy clinic will offer specialists inthese kinds of problems dont wait though go see a doctorthe remainder of this information is paraphrased without permission froma wonderful report by new zealands department of labour occupationalsafety and health service occupational overuse syndrome treatment andrehabilitation a practitioners guidefirst a glossary or fancy names for how you shouldnt have your handsnote youre likely to hear these terms from doctors and keyboard vendors rsi repetitive strain injury a general term for many kinds of injuries oos occupational overuse syndrome synonym for rsi ctd cumulative trauma disorder another synonym for rsi wruld workrelated upper limb disorders yet another synonym for rsi cts carpal tunnel syndrome see below hyperextension marked bending at a joint pronation turning the palm down wrist extension bending the wrist up supination turning the palm up wrist flexion bending the wrist down pinch grip the grip used for a pencil ulnar deviation bending the wrist towards the little finger power grip the grip used for a hammer radial deviation bending the wrist toward the thumb abduction moving away from the body overspanning opening the fingers out widenow then problems come in two main types local conditions and diffuseconditions local problems are what youd expect specific musclestendons tendon sheaths nerves etc being inflamed or otherwise hurtdiffuse conditions often mistaken for local problems can involve musclediscomfort pain burning andor tingling with identifiable areas oftenderness in muscles although theyre not necessarily the problem why does occupational overuse syndrome occur heres the theorynormally your muscles and tendons get blood through capillaries whichpass among the muscle fibers when you tense a muscle you restrictthe blood flow by the time youre exerting of your full poweryoure completely restricting your blood flowwithout fresh blood your muscles use stored energy until they run outthen they switch to anaerobic without oxygen metabolism which generatesnasty byproducts like lactic acid which cause painonce one muscle hurts all its neighbors tense up perhaps to relieve theload this makes sense for your normal sort of injury but it only makesthings worse with repetitive motion more tension means less blood flowand the cycle continuesanother byproduct of the lack of blood flow is tingling and numbness fromyour nerves they need blood tooanyway when youre typing too much youre never really giving a changefor the blood to get back where it belongs because your muscles neverrelax enough to let the blood through stress poor posture and poorergonomics only make things worse specific injuries you may have heard ofnote most injuries come in two flavors acute and chronic acuteinjuries are severely painful and noticable chronic conditions haveless pronounced symptoms but are every bit as realtenosynovitis an inflamation of the tendon sheath chronic tenosynovitisoccurs when the repetitive activity is mild or intermittent not enough tocause acute inflamation but enough to exceed the tendon sheaths abilityto lubricate the tendon as a result the tendon sheath thickens getsinflamed and youve got your problemtendonitis an inflammation of a tendon repeated tensing of a tendoncan cause inflamation eventually the fibers of the tendon start separatingand can even break leaving behind debris which induces more friction moreswelling and more pain subacute tendonitis is more common which entailsa dull ache over the wrist and forearm some tenderness and it gets worsewith repetitive activitycarpal tunnel syndrome the nerves that run through your wrist into yourfingers get trapped by the inflamed muscles around them symptoms includefeeling pins and needles tingling numbness and even loss of sensationcts is often confused for a diffuse conditionadverse mechanical tension also known as neural tension this is wherethe nerves running down to your arm have become contracted and possiblycompressed as a result of muscle spasms in the shoulders and elsewhereamt can often misdiagnosed as or associated with one of the other oos disorders it is largely reversible and can be treated with physiotherapy brachial plexus stretches and trigger point therapyothers for just about every part of your body theres a fancy name fora way to injure it by now you should be getting an idea of how oosconditions occur and why just be careful many inexperienced doctorsmisdiagnose problems as carpal tunnel syndrome when in reality youmay have a completely different problem always get a second opinionbefore somebody does something drastic to you like surgery typing posture ergonomics prevention treatmentthe most important element of both prevention and recovery is to reducetension in the muscles and tendons this requires learning how to relaxif youre under a load of stress this is doubly important tune outthe world and breath deep and regular relaxing should become a guidingprinciple in your work every three minutes take a three second breakevery three minutes take a three second break really do it everythree minutes its also helpful to work in comfortable surroundingscalm down and relaxif you cant sleep you really need to focus on this rest sleep andrelaxation are really a big dealthere are all kinds of other treatments of course drugs can reduceinflamation and pain custommolded splints can forcefully prevent badposture surgery can fix some problems exercise can help strengthenyour muscles regular stretching can help prevent injury good postureand a good ergonomic workspace promote reduced tension ice or hotcoldcontrast baths also reduce swelling only your doctor can say whats bestfor you posture here are some basic guidelines i so liked the way this waswritten in the new zealand book that im lifting it almost verbatim fromappendix dwallach let your shoulders relax let your elbows swing free keep your wrists straight pull your chin in to look down dont flop your head forward keep the hollow in the base of your spine try leaning back in the chair dont slouch or slump forward alter your posture from time to time every minutes get up and bend your spine backwardset the seat height first your feet should be flat on the floor there should be no undue pressure on the underside of your thighs near the kneesand your thighs should not slope too muchnow draw yourself up to your desk and see that its height is comfortableto work at if you are short this may be impossible the beest remedyis to raise the seat height and prevent your legs from dangling by using afootrestnow adjust the backrest height so that your buttocks fit into the spacebetween the backrest and the seat pan the backrest should support you inthe hollow of your back so adjust its tilt to give firm support in thisareaif you operate a keyboard you will be able to spend more time leaningback so experiment with a chair with a taller backrest if availablenow i diverge a little from the texta good chair makes a big difference if you dont like your chair gofind a better one you really want adjustments for height back angleback height and maybe even seat tilt most arm rests seem to get inthe way although some more expensive chairs have height adjustable armrests which you can also rotate out of the way you should find a goodstore and play with all these chairs pick one thats right for youin the san francisco bay area i highly recommend just chairs thename says it all keyboard drawers wrist pads and keyboard replacementsthere is a fair amount of controvery on how to get this right for somepeople wrist pads seem to work wonders however with good posture youshouldnt be resting your wrists on anything you would prefer yourkeyboard to be right there if you drop your arms at your side and thenlift your hands up at the elbow you want your keyboard under your handswhen your elbows are at about degrees of course you want to avoidpronation wrist extension and ulnar deviation at all costs wrist padsmay or may not help at this you should get somebody else to come andlook at how you work how you sit how you type and how you relax itsoften easier for somebody else to notice your hunched shoulders ordeviated handssome argue that the normal flat keyboard is antiquated and poorlydesigned a number of replacements are available on the market todaycheck out the accompanying typinginjuryfaqkeyboards for much detail requests for more infoclearly the above information is incomplete the typinginjury archiveis incomplete theres always more information out there if youd liketo submit something please send me mail and ill gladly throw it inif youd like to maintain a list of products or vendors that would bewonderful id love somebody to make a list of chairdesk vendors idlove somebody to make a list of doctors id love somebody to edit theabove sections looking for places where ive obviously goofed referencesi completely rewrote the information section here using a wonderfulguide produced in new zealand by their occupational safety healthservice a service of their department of labour special thanksto the authors wigley turner blake darby mcinnes and hardingsemibibliographic reference occupational overuse syndrome treatment and rehabilitation a practitioners guide published by the occupational safety and health service department of labour wellington new zealand first edition june isbn price new zealand s of coursethanks to richard donkin richarddhoskynscouk for reviewing this posting dan wallach one of the most attractive features of a connectiondwallachcsberkeleyedu machine is the array of blinking lights on the facesoffice of its cabinet cm paris ref manual v pfrom ladyuhunixuhcchawaiiedu lee ladysubject re science and methodologyin article aprsbcssunysbedu mhollowaicsunysbedu michael holloway writesin article cjvggbnewshawaiiedu ladyuhunixuhcchawaiiedu lee lady writesi would also like to point out that most of the arguments about sciencein scimed scipsychology etc are not about cases where people arerejecting scientific argumentevidenceproof they are about cases whereno adequate scientific research has been done in some cases there isquite a bit of evidence but it isnt in a format to fit doctrinaireconceptions of what science is here it is again this indicates confusion between proof and the processof doing science you are making precisely one of the points i wanted to makei fully agree with you that there is a big distinction between theprocess of science and the end result as an end result of science one wants to get results that areobjectively verifiable but there is nothing objective about theprocess of science if good empirical research were done and showed that there is some meritto homeopathic remedies this would certainly be valuable informationbut it would still not mean that homeopathy qualifies as a science thisis where you and i disagree with turpin in order to have science onemust have a theoretical structure that makes sense not a merecollection of empirically validated random hypothesesexperiment and empirical studies are an important part of science butthey are merely the culmination of scientific research the mostimportant part of true scientific methodology is scientific thinking without this one does not have any hypotheses worth testing nohypotheses do not just leap out at you after you look at enough datanor do they simply come to you in a flash one day while youre shaving orlooking out the window at least not unless youve done a lot of reallygood thinking beforehand the difference between a nobel prize level scientist and a mediocrescientist does not lie in the quality of their empirical methodology it depends on the quality of their thinking it really bothers me that so many graduate students seem to believe thatthey are doing science merely because they are conducting empiricalstudies and it bothers me even more that there are many fields such ascertain parts of psychology where there seems to be no thinking at all but mere studies testing ad hoc hypotheses and im especially offended by russell turpins repeated assertion thatscience amounts to nothing more than avoiding mistakes simply avoidingmistakes doesnt get you anywhere in the arguments between behaviorists and cognitivists psychology seems less like a science than a collection of competing religious sects ladyuhunixuhcchawaiiedu ladyuhunixbitnetfrom wrightducahicom david wrightsubject re natural anticanceraids remediesin article pittuucp gebcspittedu gordon banks writesin article aprcnsvaxuwecedu mcelwrecnsvaxuwecedu writes the biggest reason why the cost of medical care is so extremely high andincreasing is that natural methods of treatment and even diagnosis are stillbeing systematically ignored and suppressed by the moneygrubbing and powermongering medical establishmentthats not the half of it did you realize that all medical doctors havenow been replaced by aliensyup by the way what planet are you from and once you got here didyou encounter those prejudices against foreign medical graduates david wright hitachi computer products america inc waltham ma wrighthicombhicom these are my opinions not necessarily hitachis though they are the opinions of all rightthinking peoplefrom jchenwindbellcorecom jason chensubject re is msg sensitivity superstitionin article qihinnroroundupcrhcuiucedu maryuicslcsluiucedu mary e allison writes two different tuesdays two weeks apart we used the same day of the week just for consistancies sake we ordered food from the local chinese take out same exact food except one of the days we had them hold the msg i did not know which time the food was ordered without the msg but one time i had the reaction and one time i did not now you can try to tell me that it wasnt scientific enough and that i have not proven beyond the shadow of a doubt that i have a reaction to msg but it was proof enough for me and ill have you know that i do not wish to get sick from eating food thank you very much if you could not tell which one had msg why restaurants bother touse it at all if you can taste the difference psychological reaction might play a rolethe fact is msg is part of natural substance everyone i mean everyoneconsumes certain amount of msg every day through regular diet withoutthe synthesized msg additivechinese and many other asians japanese koreans etc have usedmsg as flavor enhancer for two thousand years do you believe thatthey knew how to make msg from chemical processes not they justextracted it from natural food such sea food and meat brothbaring msg is just like baring sugar which many people react tojason chenfrom cdmpmafireinelgov dale cooksubject re morbus meniere is there a real remedyin article pittuucp gebcspittedu gordon banks writesa recent movie lorenzos oil offers a perfect example of whatim talking about if you havent seen it you should its noti saw it it is almost a unique case in history first aldis a rare but fatal disease their accomplishment was significant of course it was overplayedin the movie for dramatic effect the oil is not curative and doesnt evenprevent progression only slows it theres a pretty good article in the the march new scientist titledpouring cold water on lorenzos oil the article states that researchhas shown that the oil has no discernable effect on the progression of thedisease in patients in which demyelination has begun in patients withamn a less acute form of the same disease there is some improvementseen in the ability of nerve fibres to conduct impulses in ald patientswho have not yet begun demyelination the jury is still outdale cookfrom lsalbnyvmsbitnet larry silverbergsubject podiatry school infohelloi am planning on attending podiatry school next yeari have narrowed my choices to the pennsylvania college of podiatricmedicine in philadelphia or the california college of podiatricmedicine in san francisco if anyone has any information or oppinions about these two schools pleasetell me i am having a hard time deciding which one to attend and mustmake a decision very soon thank you larrylive from new york its saturday nighttonights special guestlawrence silverberg from the state university of new york albanyakalsgeminialbanyedufrom paulsontablarcnasagov sharon paulsonsubject foodrelated seizuresi am posting to this group in hopes of finding someone out there innetwork newsland who has heard of something similar to what i am goingto describe here i have a fourteen year old daugter who experienceda seizure on november at am after eating kellogs frostedflakes she is perfectly healthy had never experienced anything likethis before and there is no history of seizures in either side of thefamily all the tests eeg mri ekg came out negative so the decisionwas made to do nothing and just wait to see if it happened againwell we were going along fine and the other morning april she hada bowl of another kellogs frosted kind of cereal fruit loops i amembarrassed to admit that i even bought that junk but every oncein a while so i pour it in her bowl and think oh oh this is thesame kind of junk she was eating when she had that seizure ten minutes later she had a full blown seizures this was her first exposureto a sugar coated cereal since the last seizurewhen i mentioned what she ate the first time as a possible reason forthe seizure the neurologist basically negated that as an idea nowafter this second episode so similar in nature to the first evenhe is scratching his head once again her eeg looks normal which iunderstand can happen even when a person has a seizureonce again we are waiting i have been thinking that it would be goodto get to as large a group as possible to see if anyone has anyexperience with this kind of thing i know that members of the medicalcommunity are sometimes loathe to admit the importance that diet andfoods play in our general health and wellbeing anyway as you canguess i am worried sick about this and would appreciate any ideasanyone out there has sorry to be so wordy but i wanted to really getacross what is going on herethankssharon paulson sspaulsonlarcnasagovnasa langley research centerbldg d mailstop work hampton virginia home from rogerscalamarihicom andrew rogerssubject re is msg sensitivity superstitionin article aprwalterbellcorecom jchencttbellcorecom writeschinese and many other asians japanese koreans etc have usedmsg as flavor enhancer for two thousand years do you believe thatthey knew how to make msg from chemical processes not they justextracted it from natural food such sea food and meat brothand to add further fuel to the flame war i read about years ago thatthe natural msg extracted from the sources you mention above does notcause the reported aftereffects its only that nasty artificial msg extracted from coal tar or whatever that causes chinese restaurantsyndrome i find this pretty hard to believe has anyone else heard itandrewfrom fulkcsrochesteredu mark fulksubject re science and methodology was homeopathy traditionin article aprecsvaxuncecsedu ccreeganecsvaxuncecsedu charles l creegan writeswhat about kekules infamous derivation of the idea of benzene ringsfrom a daydream of snakes in the fire biting their tails is thisspecific enough to count certainly it turns up repeatedly in basicphil of sci texts as an example of the inventive component ofhypothesizing and has been rather thoroughly demolished as myth by robert scott rootbernstein see his book discovering ring structures for benzenehad been proposed before kekule after him and at the same time as himthe current models do not resemble kekules many of the predecessorsof kekules structure resemble the modern model morei dont think extrascientific is a very useful phrase in a discussionof the boundaries of science except as a proposed definiens extrarationalis a better phrase in fact there are quite a number of wellknown casesof extrarational considerations driving science in a useful directionfor example pasteur discovered that racemic acid was a mixture ofenantiomers the origin of stereochemistry partly because he liked afriends crank theory of chemical action the friend was wrong butpasteurs discovery stood a prior investigator mitscherlich lookingat the same phenomenon had missed a crucial detail presumably because helacked pasteurs motivation to find something that distinguished racemicacid from tartaric now we say dtartaric acidagain pasteur discovered the differential fermentation of enantiomerstartaric acid again not because of some rational conviction but becausehe was trying to produce yeast that lived on ltartaric acid his notebookscontained fantasies of becoming the newton of mirrorimage life whichhe never admitted publicallyperhaps the best example is the discovery that dna carries genes averystarted this work because of one of his students and ardent anglophileand francophobe canadian defended fred griffiths discoveries in micemost of griffiths critics were french which decided the issue for thestudent avery told him to replicate griffiths work in vitro which thestudent eventually did whereupon avery was convinced and started theresearch program which in or so years produced the famous discoveryavery macleod and mccarty jem mark a fulkuniversity of rochestercomputer science departmentfulkcsrochesteredufrom gebcspittedu gordon bankssubject re update help was what is this is it lymesin article aprlamontldgocolumbiaedu brennerldgocolumbiaedu carl brenner writes see the ulterior motive here it is easy for me to see it the those physicians who call everything lyme and treat everything there is a lot of money involvedyou keep bringing this up but i dont understand whats in itfinancially for the physician to go ahead and treat unless the physicianhas an investment in or is involved in some kickback scheme with thehome infusion company where is the financial gain for the doctorwell let me put it this way based on my own experience ageneral practitioner with no training in infectious diseasesby establishing links to the lyme community treating patientswho come to him wondering about lyme or having decided theyhave lyme as if they did saying that diseases such as msare probably spirochetal if not lyme giving talks at meetingsof users groups validating the feelings of even delusionalpatients etc this gp can go from being a runofthemillkyr gp to someone with lots of patients in the hospitaland getting expensive infusions that need monitoring in hisoffice and making lots of bread also getting the adulationof many who believe his is their only hope if not of curethen of control and seeing his name in publications put outby support groups etc this is a definite temptation gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from ndallenrnodehuborg nigel allensubject water supplies vulnerable to milwaukeetype disease outbreakhere is a press release from the natural resources defense council new data show about major us water supplies vulnerable tomilwaukeetype disease outbreak to national desk environment writer contact erik olson or sarah silver both of the natural resources defense council washington april internal epa data releasedtoday by the natural resources defense council reveals that about large water systems serving cities from boston to sanfrancisco do not filter to remove diseasecarrying organismsleaving those communities potentially vulnerable to a diseaseoutbreak similar to the one affecting milwaukee the epa list is attached these internal epa documents reveal that the safety of watersupplies in many american cities is threatened by inadequatepollution controls or filtration said erik olson a seniorattorney with nrdc water contamination isnt just a problem inbangladesh its also a problem in bozeman and boston as of june about large surface water systems onepas list probably will be breaking the law the safedrinking water act requires all surface water systems to eitherfilter their water or fully protect the rivers or lakes they usefrom pollution olson continued some systems are movingtowards eventually implementing filtration systems but areexpected to miss the laws deadline olson pointed out that the threat of contamination is alreadya reality in other cities a survey of us surfacewater systems by water utility scientists found that percentof raw water samples contained the milwaukee organismcryptosporidium and percent contained a similar parasitecalled giardia adding to the level of concern a general accounting officestudy released today by house health and environment subcommitteechairman henry waxman indicates serious deficiencies in thenations system for conducting and following through on sanitarysurveys of water systems this new information raises a huge warning sign that millionsof americans can no longer simply turn on their taps and beassured that their water is safe to drink we must immediatelyput into place programs to protect water sources fromcontamination and where this is not assured filtration equipmentmust be installed to protect the public olson noted the timehas come for many of the nations water utilities to stopdragging their feet and to aggressively protect their water fromcontamination consumers are prepared to pay the modest costsneeded to assure their water is safe to drink nrdc is a national nonprofit environmental advocacy organization systems epa indicates require filtration and do not adequatelyprotect watersheds connecticut bridgeport bridgeport hydraulic co massachusetts boston ho resource author mwra medford mwramedford water dept melrose mwramelrose water dept hilton mwrahilton water dept needham mwraneedham water division newtoncenter mwranewton water dept marblehead mwramarblehead water dept quincy mwraquincy water dept norwood mwranorwood water dept framingham mwraframingham water div cambridge mwracambridge water dept canton mwracanton water divdpw chelsea mwrachelsea water dept everett mwraeverett water dept lexington mwra bedford puo wrks lynn mwralynn water sewer co malden mwramalden water division revere mwrarevere water dept woburn mwrawoburn water dept swampscott mwraswampscott water dept saugus mwrasaugus water dept somerville mwrasomerville water dept stoneman mwrastoneman water dept brookline mwrabrookline water dept wakefield mwrasame as above waltham mwrawaltham water division watertown mwrawatertown water division weston mwraweston water dept dedham mwradedhamwestwood district winchester mwrawinchester water sewer winthrop mwrawinthrop water dept boston mwraboston water sewer co s hadley mwrasouth hadley fire dist arlington mwraarlington water dept belmont mwrabelmont water dept clinton mwraclinton water dept attleboro attleboro water dept fitchburg fitchburg water dept northampton northampton water dept north adams north adams water dept amherst amherst water division dpw gardner gardner water dept worcester worcester dpw water oper westboro westboro water dept southbridge southbridge water supply co newburyport newburyport water dept hingham hingham water co brockton brockton water dept maine rockland camden rockland water co bath bath water district new hampshire keene city of keene salem salem water dept vermont barre city barre city water system rutland city rutland city water dept new york glens falls glens falls city yorktown hts yorktown water storage dist rochester rochester city henrietta henrietta wd rochester mcwa upland system rochester greece consolidated new york nycaquaduct sys croton chappaqua new castlestanwood wd beacon beacon city mamaronek westchester joint water works pennsylvania bethlehem bethlehem public water sys johnstown greater johnstown water auth lock haven city of lock havenwater dept shamokin roaring creek water comp harrisburg harrisburg city hazleton hazleton city water dept wind gap blue mt consolidated apollo westmoreland auth fayettville guilford water auth humlock creek pgwceasetown reservoir springbrook pgwwaters reservoir wilkes barre pgwgardners creek wilkes barre pgwhill creek wilkes barre pgwplymouth relief altoona altoona city auth tamaqua tamaqua municipal water waynesboro waynesboro borough auth pottsville schuykill co mun auth virginia covington city of covington fishersville south river sa distacsa south carolina greenville greenville water sys michigan sault ste marie sault ste marie marquette marquette montana butte butte water co bozeman bozeman city california san francisco city county of san fran nevada reno westpac idaho twin falls twin falls city washington aberdeen aberdeen water dept centralia centralia water dept nigel allen toronto ontario canada ndallenrnodehuborgfrom turpincsutexasedu russell turpinsubject re science and methodology was homeopathy traditionin article aprecsvaxuncecsedu ccreeganecsvaxuncecsedu charles l creegan writes what about kekules infamous derivation of the idea of benzene rings from a daydream of snakes in the fire biting their tails is this specific enough to count certainly it turns up repeatedly in basic phil of sci texts as an example of the inventive component of hypothesizing i think the question is what is extrascientific about this it has been a long time since anyone has proposed restrictions onwhere one comes up with ideas in order for them to be consideredlegitimate hypotheses the point in short is this hypotheses andspeculation in science may come from wild flights of fancy daydreams ancient traditions modern quackery or anywhere elserussellfrom janetntmtvcom janet jakstyssubject exercise and migrainewe were talking about migraine and exercise im the one who cantfathom the thought of exercise during migraine anyway turningthe thread around the other day i played tennis during my lunchhour im out of tennis shape so it was very intense exercise igot overheated and dehydrated afterwards i noticed a tinglingsensation all over my head then about hours later i could feela migraine start i continued to drink water in the afternooni took cafergot but it didnt help and the pain started althoughit wasnt as intense as it usually is and about pm that night thepain subsidedthis isnt the first time that ive had a migraine occur after exerciseim wondering if anyone else has had the same experience and i wonderwhat triggers the migraine in this situation heat buildup dehydrationim not giving up tennis so is there anything i can do besides get into shape and dont play at high noon to prevent thisthanks janet jakstys uucpamesmcdcupntmtvjanetnorthern telecom internetjanetntmtvcommtn view cafrom wsunjeevesucsdedu fibermansubject erythromycinis erythromycin effective in treating pneumoniafmfrom colbyoahucsuclaedu kenneth colbysubject re chronic sinus and antibiotics if the nose culture shows staph then ceftin or even ceclor are better suprax does not kill staph treating bacterial infections involves a lot of tryandfail because the infections often involve multiple organisms with many resistant strains some of hemophilus influenza strains are now resistant what works for me and my organisms may not work for you and yours keep experimenting ken colbyfrom sppzabriskieberkeleyedu steve popesubject re is msg sensitivity superstition article qjcfinngapcaltechedu carlsolgpscaltechedu writes now if instead of using the msg as a food additive you put the msg in gelatin capsules or whatever there may not be a reaction becasue the sensoryresponse might be a necessary element in the creation of the msg reaction ill bet the bogus medical researchers never even thought about that obvious fact gee he means placebo effect sorry but the researchers do know about thiscarl it is not placebo effect if as hypothesised the sensory response to msgs effect on flavor is responsiblefor the msg reactionstevefrom bhjellecarinaunmedu subject re my new diet it works great gordon banksa lot to keep from going back to morbid obesity i think allof us cycle ones success depends on how large the fluctuationsin the cycle are some people can cycle only pounds unfortunatelyim not one of themthis certainly describes my situation perfectly for me there isa constant dynamic between my tendency to eat which appears tobe totally limitless and the purely conscious desire to notput on too much weight when i get too fat i just dietexercisemore with varying degrees of success to take off theextra weight usually i cycle within a lb range butsmaller and larger cycles occur as well im always afraidthat this method will stop working someday but usuallyi seem to be able to hold the weight gain in checkthis is one reason i have a hard time accepting the notionof some metabolic derangement associated with cycle dietingthat results in longterm weight gain i have been cycledieting for at least years without seeing such a changei think a vigorous exercise program can go a long way towardkeeping the cycles smaller and the baseline weight lowbrianfrom gebcspittedu gordon bankssubject re eugenicsprobably within years a new type of eugenics will be possiblemaybe even sooner we are now mapping the human genome we willthen start to work on manipulation of that genome using geneticengineering we will be able to insert whatever genes we wantno breeding no hybrids etc the ethical question is shouldwe do this should we make a race of diseasefree longlivedarnold schwartzeneggermuscled supermen even if we can gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from dmpukcacuk dmprocidasubject re homeopathy a respectable medical traditionin article pittuucp gebcspittedu gordon banks writesaccepted by whom not by scientists there are peoplein every country who waste time and money on quackeryin britain and scandanavia where i have worked it was not paid forwhat are most of these countries i dont believe youi am told by the person who i care a lot about and who i am worriedis going to start putting his health and money into homeopathy withoutreally knowing what he is getting into and who is the reason i postedin the first place about homeopathy that in britain homeopathy isavailable on the national health service and that there are about gps who use homeopathic practices true false whathave there been any important and documented investigations intohomeopathic principlesi was reading a book on homeopathy over the weekend i turned to thesection on the principles behind homeopathic medicine and twoparagraphs informed me that homeopaths dont feel obliged to provideany sort of explanation the author stated this with pride as thoughit were some sort of virtue why am i sceptical about homeopathy isit because i am a narrowminded bigot or is it because homeopathyreally looks more like witchdoctory than anything elsedanielefrom tomcamicrosoftcom tom b careysubject re science and methodology was homeopathy traditionsasghmtheseusunxsascom gary merrill writestedmarvindgbtdocca ted grusec writes gary by extrascientific i did not mean to imply that hypothesis generation was not in most cases extremely closely tied to the state of knowledge within a scientific area i meant was that there was no scientific logic involved in the process it is inductive not deductive i am further puzzled by the proposed distinction between scientificlogic and inductive logic at this point i dont have a cluewhat you mean by extrascientific unless you mean that at sometimes someone seems to come up with an idea that we cant trace toprior theories concepts knowledge etc this is a fairly commonobservation but just for grins id like to see some genuine examplesok just for grins kekule hypothesized a resonant structure for the aromatic benzenering after waking from a dream in which a snake was swallowing his tail archimedes formalized the principle of buoyancy while meditating inhis bathin neither case was there no connection to prior theories concepts etcas you stipulated above what there was was an intuitive leap beyondthe current way of thinking to develop ideas which subsequently provedto have predictive power eg they stood the test of experimentalverificationpardon my kibbutzingtomfrom sasghmtheseusunxsascom gary merrillsubject re science and methodology was homeopathy traditionin article qkqqinngvsimucsutexasedu turpincsutexasedu russell turpin writes in article aprecsvaxuncecsedu ccreeganecsvaxuncecsedu charles l creegan writes what about kekules infamous derivation of the idea of benzene rings from a daydream of snakes in the fire biting their tails is this specific enough to count certainly it turns up repeatedly in basic phil of sci texts as an example of the inventive component of hypothesizing i think the question is what is extrascientific about this it has been a long time since anyone has proposed restrictions on where one comes up with ideas in order for them to be considered legitimate hypotheses the point in short is this hypotheses and speculation in science may come from wild flights of fancy daydreams ancient traditions modern quackery or anywhere else russell yes but typically they dont not every wild flight of fancy servesor can serve in the appropriate relation to a hypothesis it issomewhat interesting that when anyone is challanged to provide anexample of this sort the only one they come up with is the one aboutkekule surely there must be others but apparently this is regardedas an extreme example of a nonrational process in science wherebya successful hypothesis was proposed but how nonrational is itof course we cant hope currently at least to explain how or whykekule had the daydream of snakes in the fire biting their tailssurely it wasnt the only daydream he had what was special aboutthis one could it have had something to do with a perceivedanalogy between the geometry of the snakes and problems concerninggeometry of molecules is such analogical reasoning extrascientificor is it rather at the very heart of science perices notion of abductionthe use of models within and across disciplines upon close examinationis there a nonrational mystical leap taking place or is it perhapscloser to a formal though often incomplete analogy or model gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmfrom mmatusevradfordvakededu melissa n matusevichsubject re emphysema questionthanks for all your assistance ill see if he can try adifferent brand of patches although hes tried two brandsalready are there more than twomelissa mmatusevradfordvakededuafter a time you may find that having is not so pleasing a thingafter all as wanting it is not logical but it is often truespock to stonnfrom turpincsutexasedu russell turpinsubject re science and methodologyin article cibocgnewshawaiiedu ladyuhunixuhcchawaiiedu lee lady writes the difference between a nobel prize level scientist and a mediocre scientist does not lie in the quality of their empirical methodology it depends on the quality of their thinking it really bothers me that so many graduate students seem to believe that they are doing science merely because they are conducting empirical studies and im especially offended by russell turpins repeated assertion that science amounts to nothing more than avoiding mistakes simply avoiding mistakes doesnt get you anywhere i think that lee lady and i are talking at cross purposesabove lady seems concerned with the contrast between greatscience that makes big advances in our knowledge and mediocrescience that makes smaller steps in most of this thread i havebeen concerned with the difference between what is science andwhat is not lee lady is correct when she asserts that the difference betweeneinstein and the average postdoc physicist is the quality oftheir thought but what is the difference between einstein and agenius who would be a great scientist but whose great thoughtsare scientifically screwy some would give velikovsky orkorzybski as examples if you dont like these choose yourown i say it is the same as the difference between the mediocrephysicist and the mediocre proponent of qi both einstein andthe mediocre physcists have disciplined their work from thecumulative knowledge of how previous researchers went wrongboth velikovsky and the mediocre proponent of qi have failed todo this let me approach this from a second direction when one is askedto review a paper for a journal or conference there are manykinds of criticism that one can make one kind of criticism isthat the work is just wrong or misinformed another kind ofcriticism is that the work while technically correct is eithernot important or not interesting the first difference is theone that i have been pointing to the second difference is theone that lee lady seems to be discussing if good empirical research were done and showed that there is some merit to homeopathic remedies this would certainly be valuable information but it would still not mean that homeopathy qualifies as a science this is where you and i disagree with turpin i have often pointed out that for homeopathy to be considered scientific what is needed is a test of its theoretical claimsnot just of some of its proposed remedies similarly i suspectthat traditional chinese medicine has many remedies that workwhat it lacks as one example is any experiment that tests thepresence of qi in order to have science one must have a theoretical structure that makes sense not a mere collection of empirically validated random hypothesescertainly a theoretical structure that makes sense is the goalin areas where we do not yet have this i see nothing wrong withforming and testing smaller hypotheses lets face it we cannotalways wait for an einstein to come along and make everythingclear for us sometimes those of us who are not einstein have toplug along and make small amounts of progress as best we can russellfrom sasghmtheseusunxsascom gary merrillsubject re science and methodology was homeopathy traditionin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes i dont think extrascientific is a very useful phrase in a discussion of the boundaries of science except as a proposed definiens extrarational is a better phrase in fact there are quite a number of wellknown cases of extrarational considerations driving science in a useful directionyeah but the problem with holding up the extrarational examples asexemplars or as refutations of well founded methodology is that yourun smack up against such unuseful directions as lysenko such extrarational cases are curiosities not guides to methodology gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmfrom georgecengumdedu george b clarksubject re chronic sinus and antibioticsyou can also swab the inside of your nose with bacitracin using aq tip bacitracin is an antibiotic that can be bought otc as anointment in a tube the doctor i listen to on the radio says to applyit for days while you are taking other antibiotics by mouthfrom dougbcommmotcom doug banksubject re is msg sensitivity superstitionin article aprtmsmicroticom davidtmsmicroticom david thomas writes cnavarrocymbalcalpolyedu claire writes is there such a thing as msg monosodium glutamate sensitivity i saw in the ny times sunday that scientists have testified before an fda advisory panel that complaints about msg sensitivity are superstition anybody here have experience to the contrary im old enough to remember that the issue has come up at least a couple of times since the s then it was called the chinese restaurant syndrome because chinese cuisine has always used it so far ive seen about a dozen posts of anecdotal evidence but no facts i suspect there is a strong psychological effect at work here does anyone have results from a scientific study using doubleblind trials here is another anecdotal story i am a picky eater and never wanted to try chinese food however i finally tried some in order to please agirl i was seeing at the time i had never heard of chinese restaurantsyndrome a group of us went to the restaurant and all shared differentdishes it didnt taste great but i decided it wasnt so bad we wenthome and went to bed early i woke up at am and puked my guts outsi threw up for so long that im not kidding i pulled a muscle inmy tongue dry heaves and everything no one else got sick and imnot allergic to anything that i know of suffice to say that i wont go into a chinese restaurant unless i am physically threatened the smell of the food makes me ill and that isa psycholgical reaction when i have been dragged in to sufferthrough beef and broccoli without any sauces i insist on no msg i havent gotten sick yet doug bank private systems divisiondougbecscommmotcom motorola communications sectordougbnwuedu schaumburg illinoisdougbcasbahacnsnwuedu from vilokbmerhbnrca vilok kusumakarsubject future of methanoli hope this is the correct newsgroup for thiswhat is the scoop on methanol and its future as an alternative fuel forvehicles how does it compare to ethanol there was some news about health risks involved anybody know aboutthat how does the us clean air act impact the use of methanol by theyear i think its methyl tertiary butyl ether which the future industries willuse as a substitute for conventional fuelsthere is company methanex which produces of the worlds supply ofmethanol does anybody know about it please reply by email as i do not read these newsgroupsthanks in advancevilok kusumakar osi protocols for tomorrowvilokbnrca bellnorthern research ltdphone po box station c fax ottawa ontario ky hfrom sasghmtheseusunxsascom gary merrillsubject re science and methodology was homeopathy traditionin article aprmicrosoftcom tomcamicrosoftcom tom b carey writes ok just for grins kekule hypothesized a resonant structure for the aromatic benzene ring after waking from a dream in which a snake was swallowing his tail archimedes formalized the principle of buoyancy while meditating in his bathwell certainly in archimedes case the description while observing thephenomena in his bath seems more accurate than while meditating inhis bath it was after all a rather buoyancy intense environment gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmfrom jchenwindbellcorecom jason chensubject re is msg sensitivity superstitionin article aprlmpsbbscommmotcom dougbcommmotcom doug bank writes i woke up at am and puked my guts outs i threw up for so long that im not kidding i pulled a muscle in my tongue dry heaves and everything no one else got sick and im not allergic to anything that i know of the funny thing is the personaly stories about reactions to msg vary sogreatly some said that their heart beat speeded up with flush face someclaim their heart skipped beats once in a while some reacted withheadache some stomach ache some had watery eyes or running nose somehad itchy skin or rashes more serious accusations include respiration difficulty and brain damage now here is a new one vomiting my guess is that msg becomes the number onesuspect of any problem in this case it might be just food poisoning butif you heard things about msg you may think it must be itjason chenfrom mossmanceaberkeleyedu amy mossmansubject re is msg sensitivity superstitionin article aprlmpsbbscommmotcom dougbcommmotcom doug bank writes here is another anecdotal story i am a picky eater and never wanted to try chinese food however i finally tried some in order to please a girl i was seeing at the time i had never heard of chinese restaurant syndrome a group of us went to the restaurant and all shared different dishes it didnt taste great but i decided it wasnt so bad we went home and went to bed early i woke up at am and puked my guts outs i threw up for so long that im not kidding i pulled a muscle in my tongue dry heaves and everything no one else got sick and im not allergic to anything that i know of suffice to say that i wont go into a chinese restaurant unless i am physically threatened the smell of the food makes me ill and that is a psycholgical reaction when i have been dragged in to suffer through beef and broccoli without any sauces i insist on no msg i havent gotten sick yet i had a similar reaction to chinese food but came to a completly differentconclusion ive eaten chinese food for ages and never had problems i wentwith some chinese malaysian friends to a swanky chinses rest and they orderedlots of stuff i had never seen before the only thing i can remember of thatmeal was the first course scallops served in the shell with a soytype saucei thought well ive only had scallops once and i was sick after but thatcould have been a coincidence that night as i sat on the bathroom floorsweating and emptying my stomach the hard way i decided i would never touchanother scallop i may not be allergic but i dont want to take the chanceamy mossmanfrom snicholsadobecom sherri nicholssubject re exercise and migrainein article aprntmtv janetntmtvcom janet jakstys writesthis isnt the first time that ive had a migraine occur after exerciseim wondering if anyone else has had the same experience and i wonderwhat triggers the migraine in this situation heat buildup dehydrationim not giving up tennis so is there anything i can do besides get into shape and dont play at high noon to prevent thisive gotten migraines after exercise though for me it seems to be relatedto exercising without having eaten recently sherri nicholssnicholsadobecomfrom hrubinpopstatpurdueedu herman rubinsubject re science and methodologyin article qklinnlimucsutexasedu turpincsutexasedu russell turpin writesin article cibocgnewshawaiiedu ladyuhunixuhcchawaiiedu lee lady writes the difference between a nobel prize level scientist and a mediocre scientist does not lie in the quality of their empirical methodology it depends on the quality of their thinking lee lady is correct when she asserts that the difference betweeneinstein and the average postdoc physicist is the quality oftheir thought but what is the difference between einstein and agenius who would be a great scientist but whose great thoughtsare scientifically screwythis example is probably wrong there is the case of one famousphysicist telling another that he was probably wrong as i recallthe quoteyour ideas are crazy to be sure but they are not crazyenough to be rightthe typical screwball is only somewhat screwy herman rubin dept of statistics purdue univ west lafayette inphone hrubinsnapstatpurdueedu internet bitnet purduepureesnapstathrubinuucpfrom fulkcsrochesteredu mark fulksubject re science and methodology was homeopathy traditionin article cjekrlunxsascom sasghmtheseusunxsascom gary merrill writesin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes i dont think extrascientific is a very useful phrase in a discussion of the boundaries of science except as a proposed definiens extrarational is a better phrase in fact there are quite a number of wellknown cases of extrarational considerations driving science in a useful directionyeah but the problem with holding up the extrarational examples asexemplars or as refutations of well founded methodology is that yourun smack up against such unuseful directions as lysenko such extrarational cases are curiosities not guides to methodologyas has been noted before there is the distinction between motivationand method no experimental result should be accepted unless it isdescribed in sufficient detail to be replicated and the replicationsdo indeed reproduce the result no theoretical argument should beaccepted unless it is presented in sufficient detail to be followed andreasonable knowlegeable people agree with the force of the logicbut people try experiments and pursue arguments for all sorts of crazyreasons irrational motivations are not just curiousities they are alarge part of the history of sciencethere are a couple of negative points to make here a theory of qi could conceivably become accepted without directverification of the existence of qi for example quarks are an acceptedpart of the standard model of physics with no direct verification whatwould be needed would be a theory based on qi that predicted medicalreality better than the alternatives the central theoretical claim couldlie forever beyond experiment as long as there was a sufficient body ofexperimental data that the qi theory predicted better than any otheri wouldnt hold my breath waiting for the triumph of qi thoughi dont think that there is even a coherent theory based on it much lessa theory that explains anything at all better than modern biology and itis hard to imagine a qi theory that would not predict some way of ratherdirectly verifying the existence of qi science has not historically progressed in any sort of rationalexperimentdatatheory sequence most experiments are carried out andinterpreted in preexisting theoretical frameworks the theoreticalcontroversies of the day determine which experiments get done overallthere is a huge messy affair of personal jealousies crazy motivationspetty hatreds and the like that determines which experiments and whichcomputations get done what keeps it going forward is the criticalfunction of science results dont count unless they can be replicatedthe whole system is a sort of mechanism for generateandtest the generatepart can be totally irrational as long as the test part works properlypasteur could believe whatever he liked about chemical activity and crystalsbut even mitscherlich had to agree that racemic acid crystals were handedthat when you separate them by handedness you get two chemicals that rotatepolarized light in opposite directions and the rightrotating version wasindistinguishable from tartaric acid pasteurs irrational motivation hadled to a replicable and important resultthis is where lysenko creationists etc fail they have usually noteven produced coherent theories that predict much of anything when theirtheories do predict and are contradicted by experiment they do notconcede the point and modify their theories rather they try to suppressthe results lysenko or try to divert attention to other evidence theythink supports their position creationists mark a fulkuniversity of rochestercomputer science departmentfulkcsrochesteredufrom uabdpodpouabedugila steve hollandsubject re crohns diseasein article aprwestminsteracuk kxaecsunpclacukdavid watters wrote dear all i am a crohns disease sufferer and im interested if anyone knows of any current research that is going on into the subject ive done some investigation myself so you dont need to spare me any details ive had the fistulas the ileostomy etc is a cure on the horizon i am not in the medical profession so if you do reply i would appreciate plain speak id prefer to be mailed direct as i dont always get a chance to read the news thank you in advance davethe best group to keep you informed is the crohns and colitis foundationof america i do not know if the uk has a similar organization theaddress ofthe ccfa is ccfa park avenue southth floornew york ny usathey have a lot of information available and have a number of newsletters good luckstevefrom suenetcomcom sue millersubject re eugenicsin article pittuucp gebcspittedu gordon banks writeswe do this should we make a race of diseasefree longlivedarnold schwartzeneggermuscled supermen even if we cansure as long as theyll make one for mefrom lehraustinibmcom ted lehrsubject re science and methodology was homeopathy traditiongary merrill writes not every wild flight of fancy serves or can serve in the appropriate relation to a hypothesis it is somewhat interesting that when anyone is challanged to provide an example of this sort the only one they come up with is the one about kekule surely there must be others but apparently this is regarded as an extreme example of a nonrational process in science whereby a successful hypothesis was proposed but how nonrational is itindeed an extreme example it came out of nowhere the connectionkekule saw between it and his problem is fortunate but not extraordinaryi for example often receiveconjure solutions hypotheses for solutions to my everyday problems at moments when i appear to myself to be occupied with activities quite removed algorithms for that new software feature comewhen i trample the meadow on my occasional runs alternative better ways to instruct and rear my sons arrive while i weed the garden ill swear i am not thinking about any of it when ideas come these ideas are not the stuff of great discoveries of course but myconnecting them to particular problems is fraught with deliberation andoccasional fits of rationality surely it wasnt the only daydream kekule had what was special about this one could it have had something to do with a perceived analogy between the geometry of the snakes and problems concerning geometry of molecules yes and he was lucky to have such a colorful vivid image i alas willnever figure out why returning worms to the loose soil of my garden brought have him count objects instead of merely count to mind regarding my yearolds fledging arithmetic skills upon close examination is there a nonrational mystical leap taking place or is it perhaps closer to a formal though often incomplete analogy or modelthe latter worms wiggling around in the dirt fascinate my sonregardsted ted lehr my thoughts opinions and questionsfuture systems technology group aws ibm internet lehrfutservaustinibmcomaustin tx from ladyuhunixuhcchawaiiedu lee ladysubject re science and methodology was homeopathy traditionavoiding mistakes is certainly highly desirable however it is also widely acknowledged that perfectionism is inimicable to creativity and in ordinary life perfectionism carried beyond a certain point is indicative of a psychological disorder in the extreme case a perfectionist becomes so paralyzed by all the possible mistakes he might make that he is unable to even leave the house in science we want to discover as much truth about the world as possible and we also want to have as much certainty as possible about these discoveries usually there is some tradeoff between these two desiderata the search for scope and the search for certainty if th century mathematicians had demanded total rigor from newton and leibniz then there would probably be no calculus today because neither of the two could explain calculus in a way that really made sense since they lacked the concept of a limit and in fact because of the lack of a rigorous foundation they made a number of errors in their use of calculus it was only a hundred years later that weistrass was able to give a solid grounding for the ideas of newton and leibniz nonetheless what newton and leibniz did was undoubtedly science and mathematics gained a great deal more from the application of their important ideas than it lost through the mistakes they made in article aprkestreledu kingreasoningcom dick king writes somebody writes i doubt if einstein used any formal methodology he also proposed numerous experiments which if performed would distinguish auniverse in which special relativity holds from one in which it does not einstein played by the rules which demand that hypotheses only be put outthere if there exists a specific experiment that could disprove themthese are not the rules according to many who post to scimed andscipsychology according to these posters if its not supported bycarefully designed controlled studies then its not sciencetaken to the extreme i believe that the attitude that empirical studies are everything and ideas are nothing results in a complete stultification of science for one thing an insistence on an elaborate and expensive methodology results in a sort of scientific tradeunionism where those outside the establishment and lacking institutional or corporate support have no chance to obtain a hearing i dont in the least believe that this is the intention of the arbiters of scientific methodology nonetheless it is one of the results and although institutional science has certainly produced many wonderful results i think it is a foolish arrogance for scientists to believe that no one outside the establishment and using less than perfect empirical methodology will ever come with anything worthwhile furthermore the big bucks approach to science promotes what i think isone of the most significant errors in science choosing to investigatequestions because they can be readily handled by the currentlyfashionable methodology or because one can readily get institutionalor corporate sponsorship for them instead of directing attention tothose questions which seem to have fundamental significancefor instance certain questions cannot be easily investigated withstatistical methods because the relevant factors are not quantitativeone could argue that this is the case for almost all questions in manyareas of psychology in my opinion a perusal of many of the papersresulting from the attempt by psychologists to force these questionsinto a statistical framework gives the lie to russell turpinsassertion that current scientific methods avoid all known errorsi think that asking the wrong question is probably the most fundamental error in science ignoring potentially valuable ideas is one of the others and i think that scientific journals are full of all too many studies done with impeccable empirical methods but which are worthless because the wrong question was asked in the first place in the arguments between behaviorists and cognitivists psychology seems less like a science than a collection of competing religious sects ladyuhunixuhcchawaiiedu ladyuhunixbitnetfrom johnfhqileafcom john finlaysonsubject re exercise and migrainein article aprntmtv janetntmtvcom janet jakstys writes the other day i played tennis during my lunchhour im out of tennis shape so it was very intense exercise igot overheated and dehydrated afterwards i noticed a tinglingsensation all over my head then about hours later i could feela migraine start i continued to drink water in the afternooni took cafergot but it didnt help and the pain started althoughit wasnt as intense as it usually is and about pm that night thepain subsidedthis isnt the first time that ive had a migraine occur after exerciseim wondering if anyone else has had the same experience and i wonderwhat triggers the migraine in this situation heat buildup dehydrationim not giving up tennis so is there anything i can do besides get into shape and dont play at high noon to prevent thishi janetsounds exactly like mine same circumstance same onset symptoms same cafergot uselessness same duration in fact of all the peoplei know who have migraines none have been so similar there is sucha wide variation between people with respect to what causes theirheadaches that i generally dont bother sharing what ive learnedabout mine but since ours seem to be alike here are my observationsi dont think its heat per se ive had more in winter than summerdehydration could conceivably figure though try tanking up beforeplaying rather than afterbeing in shape doesnt seem to help me much eitherive identified four factors that do make a difference listed in descending order of importance heavy exercise sleep deprivation fastingeg skipped breakfast physical traumaeg head bonkheavy exercise has preceded all of my postadolescent migraines but i dont get migraines after every heavy exercise session one or more of the other factors must be present usually since i discovered this ive been nearly migrainefree relapsing only once every two or three years when i get cocky its been so long maybe i just dont get them anymore and stop being carefulhope this is helpfuljohnfrom kxgstpittedu kenneth gilbertsubject re erythromycinin article sdccucsdedu wsunjeevesucsdedu fiberman writesis erythromycin effective in treating pneumoniafmnot only is it effective it is in fact the drug of choice foruncomplicated cases of communityacquired penumonia kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from kxgstpittedu kenneth gilbertsubject re emphysema questionin article aprradfordvakededu mmatusevradfordvakededu melissa n matusevich writesthanks for all your assistance ill see if he can try adifferent brand of patches although hes tried two brandsalready are there more than twothe brands i can come up with off the top of my head are nicotrolnicoderm and habitrol there may be a fourth as well kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from dmpfigcitibcom donna m painosubject psoriatic arthritis info needed pleasea friend of mine has been diagnosed with psoriatic arthritis as a result oftrauma sustained in a car accident several years ago the psoriasis is undercontrol but the arthritis part of the illness is notansaid nonsteroidal antiinflammatory worked pretty well for three years butisnt helping much now my friend is now taking meclomen another nsaid butthis isnt helping control the pain at all in the past two months my friendhas also started taking azulfadine along with the nsaid medicines but theeffects of the combined drugs arent supposed to be realized for several monthsas a result of the pain my friend is having problems sleeping staying inone position too long is an ordeal another major contributor to pain is thattendonitis has now developed left thumb and hand with numbness at the base ofthe palm bottom of feet shoulders and outer thighs the tendonitis isquite painful yet my friends doctor has not recommended any form of treatmentto relieve itthe latest twist is that the doctor has dropped the antiinflammatories and isnow recommending prednisone the hope is that the prednisone will relieve someof the pain from the tendonitismy friend is a year old male who feels like hes his words not mineif anyone is aware of any new treatments for psoriatic arthritis alternativecourses of action support groups or literature on it i would be extremelygrateful if you could email to me if anyone is interested ill post asummary to this newsgroupthanks in advancedonnadmpfigcitibcomfrom rindenterprisebihharvardedu david rindsubject re erythromycinin article sdccucsdedu wsunjeevesucsdedu fiberman writesis erythromycin effective in treating pneumoniait depends on the cause of the pneumonia for treating bacterialpneumonia in young otherwisehealthy nonsmokers erythromycinis usually considered the antibiotic of choice since it coversthe two mostcommon pathogens strep pneumoniae and mycoplasmapneumoniae david rindrindenterprisebihharvardedufrom slyxccusuedusubject re is msg sensitivity superstitionin article aprwalterbellcorecom jchenwindbellcorecom jason chen writes in article aprlmpsbbscommmotcom dougbcommmotcom doug bank writes i woke up at am and puked my guts outs i threw up for so long that im not kidding i pulled a muscle in my tongue dry heaves and everything no one else got sick and im not allergic to anything that i know of the funny thing is the personaly stories about reactions to msg vary so greatly some said that their heart beat speeded up with flush face some claim their heart skipped beats once in a while some reacted with headache some stomach ache some had watery eyes or running nose some had itchy skin or rashes more serious accusations include respiration difficulty and brain damage now here is a new one vomiting my guess is that msg becomes the number one suspect of any problem in this case it might be just food poisoning but if you heard things about msg you may think it must be itsurprise surprise different people react differently to different things oneslightly off the subject case in point my brother got stung by a bee i knowhe is allergic to bee stings but that his reaction is severe localizedswelling not anaphylactic shock i could not convince the doctors of thathowever because thats not written in their little rule booki would not be surprised in the least to find out the some people have badreactions to msg including headaches stomachaches and even vomiting not thatthe stuff is bad or poison and needs to be banned but people need to be awarethat it can have a bad effect on some peoplelone wolf happy are they who dream dreamsed philips and pay the price to see them come trueslyxccusuedu unknown from milshnmrzmghharvardedu alex milshteynsubject re is msg sensitivity superstitionin article chzvcrdnnscrdgecom meltsnercrdgecom writesi wouldnt call it a doubleblind but one local restaurants soupprovokes an impressive migraine headache for my wife that onetakeout and no other nothing unisualquotechinese restaurant syndrome crsa transient syndrome associated with arterial dilatation due to ingestionof monosodium glutamate which is used liberally in seasoning chinesefood it is characterized by throbbing of the head lightheadednesstightness of the jaw neck and shoulders and bachacheend quotesource dorlands illustrated medical dictionary th edition wb saunders p this was known long ago brain produces and uses some msg naturallybut not in doses it is served at some chinese places having said that i might add that in mho msg does not enhanceflavor enoughf for me to miss it when i go to chinese placesi order food without msg goos places will do it for youa prerequisite for such a service would be a waiter capable ofunderstanding what you wantgood luckam alexander m milshteyn md milshciprservermghharvardeducipr mgh in boston ma vox faxfrom nealcmptrclonestarorg neal howardsubject re science and methodology was homeopathy traditionin article aprecsvaxuncecsedu ccreeganecsvaxuncecsedu charles l creegan writeswhat about kekules infamous derivation of the idea of benzene ringsfrom a daydream of snakes in the fire biting their tails is thisspecific enough to count certainly it turns up repeatedly in basicphil of sci texts as an example of the inventive component ofhypothesizing i sometimes wonder if kekules dream wasnt just a wee bit influenced byaromatic solvent vapors heh heh neal howard xlh dod computrac inc richardson tx doh o nealcmptrclonestarorg std disclaimer my opinions are mine not computracs let us learn to dream gentlemen and then perhaps we shall learn the truth august kekule from dwebbunledu dale webbsubject re the back machine update i have a back machine and have had one since january while i have not found it to be a panacea for my back pain i think it has helped somewhat it mainly acts to stretch muscles in the back and prevent spasms associatedwith pain i am taking less pain medication than i was previously the folks at back technologies are very reluctant to honor their return policy they extended my warranty period rather than allow me to return the machine when after the first month or so i was not thrilled with it they encouraged me to continue to use it abeit less vigourously like i said i cant say it is a cureall but it keeps me stretched outand i am in less paindale m webb dvm phd of the body is water theveterinary diagnostic center other keeps you from drowninguniversity of nebraska lincoln from rjflzsclincroftnjncrcom efwrobert feddelermttsubject re centrifugemr blue caraccessdigexcom wrote could somebody explain to me what a centrifuge is and what it is used for i vaguely remembre it being something that spins test tubes around really fast but i cant remember why youd want to do thatpurely recreational they get bored sitting in thatrack all the timebob i only smile when i lieyou can learn more in a bar and ill tell you whythan you can in a lawyers office were these more than just my opinions they would have cost a bit morefrom cafomenuucp chuck forsberg wakgxsubject re my new diet it works great in article qkvinnrmlynxunmedu bhjellecarinaunmedu writesgordon banksa lot to keep from going back to morbid obesity i think allof us cycle ones success depends on how large the fluctuationsin the cycle are some people can cycle only pounds unfortunatelyim not one of themthis certainly describes my situation perfectly for me there isa constant dynamic between my tendency to eat which appears tobe totally limitless and the purely conscious desire to notput on too much weight when i get too fat i just dietexercisemore with varying degrees of success to take off theextra weight usually i cycle within a lb range butsmaller and larger cycles occur as well im always afraidthat this method will stop working someday but usuallyi seem to be able to hold the weight gain in checkthis is one reason i have a hard time accepting the notionof some metabolic derangement associated with cycle dietingthat results in longterm weight gain i have been cycledieting for at least years without seeing such a changeas mentioned in adiposity only some experience weightrebound the fact that you dont doesnt prove it doesnthappen to others chuck forsberg wakgx tektronixreedomencaf author of ymodem zmodem professionalyam zcomm and dsz omen technology inc the high reliability softwarev nw sauvie is rd portland or from smithmcmentorccpurdueedu lost boysubject re can men get yeast infectionsin article noringcfnxvnetcomcom noringnetcomcom jon noring writesin article tammyvandenboomlaunchpaduncedu tammy vandenboom writesheres a potentially stupid question to possibly the wrong news group but can men get yeast infections spread them what kind of symptomssimilar as womens i have a yeast infection and my husband who is anatural paranoid on a good day is sure hes gonna catch it and keepsasking me what its like im not sure what his symptoms would be the answer is yes and no im sure others on scimed can expand on thisjoni know from personal experience that men can get yeast infections i get rather nasty ones from time to time mostly in the area of thescrotum and the base of the penis theyre nowhere near as dangerousfor me as for many women but goddamn does it hurt in the summertimeeven in the wintertime when i sweat i get really uncomfy down there thebest thing i can do to keep it under control is keep my weight down andkeep cool down there shorts in degree weather that kind of thing andof course some occasional sun lost boyfrom blacksybasecom chris blacksubject cystic breast diseasemy mom has just been diagnosed with cystic breast disease a bigrelief as it was a lump that could have been cancer her doctor saysshe should go off caffeine and chocolate for months as well asstopping the estrogen shes been taking for menopauserelated reasonsshes not thrilled with this i think especially because she just gaveup cigarettes soon she wont have any pleasures left now i thoughtid heard that cystic breasts were common and not really a health riskis this accurate if so why is she being told to make varioussacrifices to treat something thats not that big of a dealthanks for any information chris blacksybasecomnote my mailer tends to garble subject lines from naomirockconcertnet naomi t courtersubject endometriosiscan anyone give me more information regarding endometriosis i heardits a very common disease among women and if anyone can provide namesof a specialistsurgeon in the north carolina research triangle parkarea raleighdurhamchapel hill who is familiar with the conditioni would really appreciate itthanks naomi naomi lt courternetwork services specialistmcnc center for communicationsconcert network from nyedacnsvaxuwecedu david nyesubject re migraines and scansreply to gebcspittedu gordon banks if you can get away without ever ordering imaging for a patient withan obviously benign headache syndrome id like to hear what your magicis i certainly cant always avoid it unless i want to be rude i suppose i made a decision a while back that i will not be bullied into gettingstudies like a ct or mri when i dont think they are indicated if thepatient wont accept my explanation of why i think the study would be awaste of time and money i suggest a second opinion david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom jimzisfeinfactorycom jim zisfein subject klonopin and pregnancya from adwrightiastateedu a a woman i know is tapering off klonopin i believe that is one of thea benzodiazopines she is taking a very minimal dose right now half a tableta a day she is also pregnant my question is are there any known cases wherea klonopin or similar drug has caused harmful effects to the fetusa how about cases where the mother took klonopin or similar substance and hada normal baby any information is appreciated she wants to get a feel fora what sort of risk she is taking she is in her first month of pregnancyklonopin according to the pdr physicians desk reference is not aproven teratogen there are isolated case reports of malformationsbut it is impossible to establish causeeffect relationships theoverwhelming majority of women that take klonopin while pregnant havenormal babies slmr email jimzisfeinfactorycom jim zisfein from cmizzoumissouriedu matthew q keeler de la manchasubject infant immune development questionas an animal science student i know that a number of animals transferimmunoglobin to thier young through thier milk in fact a calf musthave a sufficient amount of colostrum early milk within hours toeffectively develop the immune system since for the first less than hours the intestines are open to the ig passage my question isdoes this apply to human infants to any degree thanks for your time respondingmatthew keelercmizzoumissouriedufrom carlsolgpscaltechedu carl j lydicksubject re is msg sensitivity superstitionin article aprccusuedu slyxccusuedu writessurprise surprise different people react differently to different things oneslightly off the subject case in point my brother got stung by a bee i knowhe is allergic to bee stings but that his reaction is severe localizedswelling not anaphylactic shock i could not convince the doctors of thathowever because thats not written in their little rule bookof course bee venom isnt a single chemical could be your brother isreacting to a different component than the one that causes anaphylactic shockin other peoplesimilarly chinese food isnt just msg there are a lot of other ingredientsin it why when someone eats something with lots of ingredients they dontnormally consume one of which happens to be msg do they immediately concludethat any negative reaction is to the msgi would not be surprised in the least to find out the some people have badreactions to msg including headaches stomachaches and even vomitingid be surprised if some of these reactions werent due to other ingredientscarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itfrom texxossicom robert texx woodworthsubject re can men get yeast infectionsnoringnetcomcom jon noring writesin article tammyvandenboomlaunchpaduncedu tammy vandenboom writesheres a potentially stupid question to possibly the wrong news group but can men get yeast infections spread them what kind of symptomssimilar as womens i have a yeast infection and my husband who is anatural paranoid on a good day is sure hes gonna catch it and keepsasking me what its like im not sure what his symptoms would be the answer is yes and no im sure others on scimed can expand on thisrecently someone posted an account of thisunfortunately it was posted to alttasteless so the gross details were emphasizedinstead of th e actual scientific factsfrom dfittscarsonuwashingtonedu douglas fittssubject re ra treatment questioneulenbrgcarsonuwashingtonedu julia eulenberg writesim assuming that you mean rheumatoid arthritis ra ive never heard of the cold treatment you mentioned i cant imagine how it would work since most of us who have rharthrra seem to have more problemsin cold weather than in warm weather would be interested to hear morezzno obviously talking about research assistants i favor a high proteinlow fat diet barely adequate salary on a fixed time schedule four hoursof sleep a night continuous infusion of latte unpredictable praise mixed randomly with anxietyprovoking everpresent glances with lowered eyebrows unrealistic promises of rapid publication and every three months a dinner consisting of nothing but microbrewery aleand free pretzels actually mine hails from san diego and indeed has more problems in seattle in cold weather than in warmdoug fittsdfittsuwashingtonedufrom dfieldflutecalpolyedu infospunj dan fieldsubject cant wear contacts after rkprki love the faq the comment about contact lenses not being an option for any remainingcorrection after rk and possibly after prk is interresting why isthis does anyone know for sure whether this applies to prk as wellalso why is it possible to get a correction in prk with involvement ofonly about of the corneal depth while rk is done to a depth of up to why such a difference i thought the proceedures were simmilarwith the exception of a laser being the cutting tool in prk i must notbe understanding all of the differencesin the faq the vision was considered less clear after the surgery thanwith glasses alone if this is completly attributable to theintentional slight undercorrection then it can be compensated for whennecessary with glasses or contacts if they can be worn afterall itis important to know if that is not the case however and some otherconsequence of the surgery would often interfere with clear vision thefirst thing that came to my mind was a fogging of the lense whichglasses couldnt help would not help daniel r field aka infospunj im just a lowly phlebe dfieldoboecalpolyedu biochemistry biotechnology im at the phlebottom california polytechnic state u of the medical totem pole from ghilardiurzunibaschsubject left side painshello to everybodyi write here because i am kind of desperate for about six weeks ive beensuffering on pains in my left head side the left leg and sometimes the left arm i made many tests eg computer tomography negative lyme borreliosisnegative all electrolytes in the blood in their correct range theyreall ok so i should be healthy as a matter of fact i am not feeling soi was also at a neurologists too he considered me healthy toothe blood tests have shown that i have little too much of hemoglobin common range is to i unfortunately do not know about the unitscould these hemisided pains be the result of this or of a also possibleblock of the neck muscles i have no fever and i am not feeling entirely sick but neither entirely healthy please answer by direct email on ghilardiurzunibaschthanks for every hintnicofrom nigeldatamandemoncouk nigel ballardsubject re sarchoidosis hellodoes anybody know if sarchoidosis is a mortem desease ie if someone who tooke this desease can be killbye this one people have died from sarcoid but usually it is notfatal and is treatablegordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon hi thereim suffering from sarcoidosis at present although its shown as achronic rare tissue disorder it is thankfully not life threateningthe very worsed thing that can happen to a nontreated sufferer isglaucoma my specialists are bombarding me with prednisolone ec acorticosteriod and after four months at mg a day its totally doneaway with my enlarged lymph glands so somethings happening for thegoodcheers nigel nigel ballard int nigeldatamandemoncouk mexican food bournemouth cis radioghoi guinness on tap united kingdom amazing and all down two wires tall skinny women two penguins are walking along an iceberg the first penguin turns to the second penguin and says it looks like you are wearing a tuxedo the second penguin turns to the first penguin and says maybe i am from kensugrauucp kenneth ngsubject re is msg sensitivity superstitionin article szikopoucunews szikopousuperiorcarletonca steven zikopoulos writesin aprnewscsbrandeisedu reynoldbinahccbrandeisedu susan reynold wout the s writesi think the scientists are biased towards the food industry or somethingwas the article long would anyone be interested in posting ita neuroscientist told me that msg is used as a neurotoxinthatsrightsome labs use it to kill neurons in mice and ratsvitamin a and i think vitamin d in strong enough amounts can kill the keywords are dosage and exposure mechanism kenneth ngplease reply to kenbluenjitedu for nowall this might be an elaborate simulation running in a little device sittingon someones table jl picard sttngfrom backonvmshujiacilsubject re pointer for info long shotin article zonkeraprsplintercoenortheasternedu regis m donovan zonkersilverlcsmitedu writes this is something of a long shot but what the hell the net is full of people with strange knowledge im looking for suggestions as to what could be causing health problems one of my relatives is having one of my cousins has had health problems for much of her life around the age of she had some gynecological problems now shes in her earlymid twenties and she is going blind her eyes are not producing enough if any moisture shes been going to mass eye and ear and the doctors there have no clue what the actual cause is they have apparently tried eyedrops and such she is just about completely blind in one eye and the other is massively deterioratedsjogrens syndrome has been known to induce dryness in vaginal tissue as wellas induce primary biliary cirrhosis otherwise the abdominal swelling could bedue to a complication of sjogrens known as pseudolymphoma which can producea splenomegaly enlarged spleen she should definitely see a rheumatologistsince you dont mention skin disorder anemia or joint pain youd probablyrule out erythema nodosum or sclerodermajoshbackonvmshujiacil also and this may or may not be related she is having some changes in her abdomen her stomach has swelled im not sure if this is stomach the organ or stomach teh area of the body i guess the step theyre going to take next is to do a whole battery of tests to check all the other internal systmes besides just the eyes but just because the net is a source of large amounts of bizarre knowledge im going to ask has anyone ever heard of anything like this suggestions of things to ask about since much of my knowledge about her state comes second or third hand thanks regis zonkersilverlcsmitedufrom sasghmtheseusunxsascom gary merrillsubject re science and methodology was homeopathy traditionin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes science has not historically progressed in any sort of rational experimentdatatheory sequence most experiments are carried out and interpreted in preexisting theoretical frameworks the theoretical controversies of the day determine which experiments get done overall there is a huge messy affair of personal jealousies crazy motivations petty hatreds and the like that determines which experiments and which computations get done what keeps it going forward is the critical function of science results dont count unless they can be replicated the whole system is a sort of mechanism for generateandtest the generate part can be totally irrational as long as the test part works properlyi think we agree on much however the paragraphs above seem to repeatuncritically the standard kuhnlakatosfeyerabend view of progress andrationality in science since ive addressed these issues in thisnewsgroup in the not too distant past i wont go into them again nowwhat is wrong with the above observation is that it explicitly gives theimpression and you may not in fact hold this view that the common perhapseven the correct approach for a scientist to follow is to sit aroundhaving flights of fancy and scheming on the basis of his jealousies andpetty hatreds it further at least implicitly advances the position thatsciences goes forward and it is not clear what this means given thecontext in which it occurs by generating in a completely nonrationaland even random way a plethora of hypotheses and theories that are thenweeded out via the critical function of science though why this criticalfunction should be less subject to the nonrational forces is a mysteryif experimental design hypotheses creation and theory construction aresubject to jealousies and petty hatreds then this must be equally trueof the application of any critical function concerning replicationthis is what leads one ala feyerabend to an anything goes viewtrue the generation part can be totally irrational but typically it isnot anecdotes concerning instances where a hypothesis seems to haveresulted in some way from a dream or from ones political views simplydo not generalize well to the actual history of science gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmfrom donald mackie donaldmackiemedumichedusubject re seeking adviceexperience with back problemin article cfiryzcbnewskcbattcom janetmcooperjmcoopercbnewskcbattcom writesthe mother of a friend of mine is experiencing a disabling backpain after mris ct scans and doctors visits she has beenpresentedwith alternatives live with the painor undergo a somewhatrisky operation which may leave her paralyzed she also has a since her symptoms are only pain she would do weel to seek theadvice of a good multidisciplinary pain clinic it is distressingto think that people are stll being told they have to live with thepain when many options for pain management rather than treatingmri findings are available a good pain clinic will accept thatthis ladys problem is her pain and set about finding ways ofrelieveing thatdon mackie his opinionsum anesthesiology will disavowfrom donald mackie donaldmackiemedumichedusubject re options before back surgery for protruding disc at llsubject options before back surgery for protruding disc at llfrom alex miller amilleralmadenibmcomdate apr gmtin article coyoteuucp alex miller amilleralmadenibmcomwritesafter two weeks of limping around with an acute pain in my low backand right leg my osteopath sent me to get an mri which revealeda protruding and extruded disc at ll i went to a neurosurgeonwho prescribed prednisole a steroidal antiinflamitory and bedrestfor several days its been nearly a week and overall i feel slightly worse i take darvocet three times a day so i candeal with daily activities like preparing food and help meget to sleep ill see the neurosurgeon tomorrow and of course ill be askingwhether or not this rest is helpful or if surgery is the next step what are my nonsurgical options if my goal is to resumefull activity including competitive cycling i should add thiscondition is in my opinion the result of commulative wear andtear ive had chronic lowback pain for years but i managedyou dont say whether or not you have any symptoms other than painif you have numbness weakness or bladder problems for examplethese would suggest a need for surgery if pain is your only symptomyou might do well to find a reputable multidisciplinary painclinic in your area chronic low back pain generally doesnt do wellwith surgery acute on chronic pain as only symptom doesnt faremuch bettere correlation between mri findings and symptoms is controversialdon mackie his opinionsum will disavowfrom rcjcbnewsdcbattcom raycjendersubject looking for a doctori was kind of half watching street stories last nightand one of the segments was about this doctor insf who provides a service of investigating treatmentfor various diseases im pretty sure his name isdr mark renniger sp or close to that did anyone else watch this id like to get hiscorrect name and addressphone number if possiblethanksfrom dbcwelkingsfcnasagov david considinesubject re is msg sensitivity superstitionin article aprnmrzmghharvardedu milshnmrzmghharvardedu alex milshteyn writesthis was known long ago brain produces and uses some msg naturallybut not in doses it is served at some chinese places having said that i might add that in mho msg does not enhanceflavor enoughf for me to miss it when i go to chinese placesi order food without msg goos places will do it for you i just wanted to point out that some of the food particularlythe soups are prepared in a big batch so the restaurantwont be able to take the msg out of it sometimes itspretty hard to find out if this is the case or notalexander m milshteyn md milshciprservermghharvardeducipr mgh in boston ma vox faxdavid b considinedbcwelkingsfcnasagovfrom debbiecsdcsduwmedu debbie forestsubject re can men get yeast infectionsin article aprgalileoccrochesteredu jkisltduhuraccrochesteredu da beave writeswell folks i currently have a yeast infection i am male your best bet or at least your husbandsis to treat and cure your infection before any intercourse if you must usea condom also consider other forms of sexual release ie handjobs untilyou are cured though i cant imagine wanting to have intercourse during a fullblownyeast infection chances of it being transmitted to the male are quitelow especially if hes circumcised but it can happen at one point i was getting recurrent yeast infections and the dr suspectedmy boyfriend might have gotten it from me and be reinfecting me theprescription was interesting for each day of the medication a week i was to insert the medication then to have intercourse the resulting action would help the medicine be spread around in me better and would simultaneously treat him from sdbsdcislabspittedu stephen d brenersubject intensive japanese at pittin article ckxixctcbnewsdcbattcom rcjcbnewsdcbattcom raycjender writesi was kind of half watching street stories last nightand one of the segments was about this doctor insf who provides a service of investigating treatmentfor various diseases im pretty sure his name isdr mark renniger sp or close to that did anyone else watch this id like to get hiscorrect name and addressphone number if possiblethanks intensive japanese at the university of pittsburgh this summer the university of pittsburgh is offering two intensive japanese languagecourses this summer both courses intensive elementary japanese and intensive intermediate japanese are ten week ten credit courses each equivalent to one full year of japanese language study they begin june and end august the courses meet five days per week five hours per day there is a flat rate tuition charge of per course fellowships available for science and engineering students contact steven brener program manager of the japanese science and technologymanagement program at the university of pittsburgh at the number oraddress below all interested individuals are encouraged to apply this is not limited to university students new program announcement japanese science and technology management programthe japanese science and technology management program jstmp is a newprogram jointly developed by the university of pittsbugh and carnegie mellon university students and professionals in the engineering and scientific communitites are encouraged to apply for classes commencing in june and january program objectivesthe program intends to promote technology transfer between japan and the united states it is also designed to let scientists engineers and managersexperience how the japanese proceed with technological development this is facilitated by extended internships in japanese research facilities andlaboratories that provide participants with the opportunity to developlongterm professional relationships with their japanese counterpartsprogram designto fulfill the objectives of the program participants will be required to develop advanced language capability and a deep understanding of japan andits culture correspondingly jstmp consists of three major components training in the japanese languageseveral japanese language courses will be offered including intensive coursesdesigned to expedite language preparation for scientists and engineers in arelatively short time education in japanese business and social culturea particular enphasis is placed on attaining a deep understanding of thecultural and educational basis of japanese management approaches in manufacturing and information technology courses will be available in a variety of departments throughout both universities including anthropologysociology history and political science moreover seminars and colloquiumswill be conducted further a field trip to japanese manufacturing or research facilities in the united states will be scheduled an internship or a study mission in japanupon completion of their language and cultural training at pitt and cmu participants will have the opportunity to go to japan and observeand participate in the management of technology internships in japanwill generally run for one year however shorter ones are possiblefellowships covering tuition for language and culture courses as well asstipends for living expenses are available for more information and application materials contactsteven brenersusie brownjstmpcarnegie mellon university gsiauniversity of pittsburghpittsburgh pa e forbes quadrangletelephone pittsburgh pa fax telephone fax interested individuals companies and institutions should respond by phone ormail please do not inquire via emailplease note that this is directed at grads and professionals however advancedundergrads will be considered further funding is resticted to us citizensand permanent residents of the ussteve brenerfrom anelloadcsfnalgov anthony anellosubject hypoglycemiacan anyone tell me if a bloodcount of when diagnosed as hypoglycemic isdangerous ie indicates a possible pancreatic problem one dr says no theother not his specialty says the first is negligent and that another bloodtest should be done also what is a good diet what has worked for a hypoglycemic tiaanthony anellofermilabbatavia illinois from wcsbeaualfredcarletonca opirgsubject re is msg sensitivity superstitionin article aprtmsmicroticom davidtmsmicroticom david thomas writesin article aprdelphigsfcnasagov packerdelphigsfcnasagov charles packer writesis there such a thing as msg monosodium glutamate sensitivityi saw in the ny times sunday that scientists have testified before an fda advisory panel that complaints about msg sensitivity aresuperstition anybody here have experience to the contrary im old enough to remember that the issue has come up at leasta couple of times since the s then it was called thechinese restaurant syndrome because chinese cuisine hasalways used itso far ive seen about a dozen posts of anecdotal evidence butno facts i suspect there is a strong psychological effect at work here does anyone have results from a scientific studyusing doubleblind trials check out just some posts before your own maybe you missedit amidst the flurry of responses yet again the use of thisnewsgroup is hampered by people not restricting their posts to mattersthey have substantial knowledge offor cites on msg look up almost anything by john w olney atoxicologist who has studied the effects of msg on the brain and ondevelopment it is undisputed in the literature that msg is anexcitotoxic food additive and that its major constituent glutamateis essentially the premierie neurotransmitter in the mammalian brainhumans included too much in the diet and the system gets thrownoff glutamate and aspartate also an excitotoxin are necessary insmall amounts and are freely available in many foods but the amountsadded by industry are far above the amounts that would normally beencountered in a ny single food by eating lots of junk foodpackaged soups and diet soft drinks it is possible to jack yourblood levels so high that anyone with a sensitivity to thesecompounds will suffer numerous real physilogical effects read olneys review paper in prog brain res and check hissources they are impecable there is no dispute dianne murray wcsbeauccscarletoncafrom fulkcsrochesteredu mark fulksubject re science and methodology was homeopathy traditionin article ckvpjmunxsascom sasghmtheseusunxsascom gary merrill writesin article aprcsrochesteredu fulkcsrochesteredu mark fulk writeswhat is wrong with the above observation is that it explicitly gives theimpression and you may not in fact hold this view that the common perhapseven the correct approach for a scientist to follow is to sit aroundhaving flights of fancy and scheming on the basis of his jealousies andpetty hatredsflights of fancy and other irrational approaches are common the crucialthing is not to sit around just having fantasies they arent of any useunless they make you do some experiments ive known a lot of scientistswhose fantasies lead them on to creative work usually they wont admitout loud what the fantasy was prior to the consumption of a few beerssimple example warren jelinek noticed an extremely heavy band on a dnaelectrophoresis gel of human alu fragments he got very excited hoping thathed seen some essential part of the control mechanism for eukaryoticgenes this fantasy led him to sequence samples of the band and carry outbinding assays the result was a wellconserved or so bp sequencethat occurs about times in the human genome unfortunately forwarrens fantasy it turns out to be a transposon that is present inso many copies because it replicates itself and copies itself back intothe genome on the other hand the characteristics of transposons weremuch elucidated the necessity of a cellular reverse transcriptase wasrecognized and the standard method of recognizing human dna was createdother species have different sets of transposons fortunately for mewarren and i used to eat dinner at tgi fridays all the timeit further at least implicitly advances the position thatsciences goes forward and it is not clear what this means given thecontext in which it occurs by generating in a completely nonrationaland even random way a plethora of hypotheses and theories that are thenweeded out via the critical function of scienceim not sure that its random but there is no known rational mechanismfor generating a rich set of interesting hypotheses if you are reallyworking in an unknown area it is unlikely that you will have much senseof what might or might not be true under those circumstances the bestthing to do is just follow whatever instincts you have if they are wrongyou will find out soon enough but at least you will find out somethingif you try to do experiments at random with no prior conceptions at allin mind you will probably get nowherethough why this criticalfunction should be less subject to the nonrational forces is a mysteryunfortunately the critical function does sometimes become hostage tononrational forces then we get varieties of pathological sciencelysenko mirskys opposition to dnaasgene cold fusion and so forthif experimental design hypotheses creation and theory construction aresubject to jealousies and petty hatreds then this must be equally trueof the application of any critical function concerning replicationthis is what leads one ala feyerabend to an anything goes viewi dont agree that this follows in fact this is exactly the point atwhich i disagree with feyerabend it is a most important part of theculture of science that one keeps ones jealousies out of the refereeingprocess failures there are aplenty but on the whole things work outanother point there are a couple of senses of the phrase experimentaldesign id say that the less rational part is in experimental choicenot design alexander fleming proc royal soc chose to look forbacteriophage in his own mucus for strange reasons phage had previouslybeen found in locust diarrhea fleming probably thought runny bottom runnynose what the hell its worth a try but his method of looking for phagewas welldesigned to detect anything phagelike in fact he found lysozymetrue the generation part can be totally irrational but typically it isnot anecdotes concerning instances where a hypothesis seems to haveresulted in some way from a dream or from ones political views simplydo not generalize well to the actual history of scienceit is not clear to me what you mean by rational vs irrational perhapsyou can give a few examples of surprising experiments that were tried outfor perfectly rational reasons or interesting new theories that were firstadvanced from logical grounds the main examples i can think of are frommodern highenergy physics which is not typical of science as a whole mark a fulkuniversity of rochestercomputer science departmentfulkcsrochesteredufrom cabcolhpcom chris bestsubject re is msg sensitivity superstitionjason chen writes now here is a new one vomiting my guess is that msg becomes the number one suspect of any problem in this case it might be just food poisoning but if you heard things about msg you may think it must be ityeah it might if you only read the part you quoted you somehow left out the part about we all ate the same thing changes things a bit ehyou complain that people blame msg automatically since its an unknown andtherefore must be the cause it is equally if not more unreasonable todefend it automatically assuming that it cant be the culpritpepper makes me sneeze if it doesnt affect you the same way finejust dont tell me im wrong for saying sothese people arent condemning chinese food mr chen just one of its optional ingredients try not to take it so personallyfrom francisircamfr joseph francissubject re cant wear contacts after rkprkin article aprzeuscalpolyedu dfieldflutecalpolyedu infospunj dan field writesi love the faq the comment about contact lenses not being an option for any remainingcorrection after rk and possibly after prk is interresting why isthis does anyone know for sure whether this applies to prk as wellive had prki would suggest asking a doctor about contacts mine said yes tocontacts i think the scars from rk would preclude contactsalso why is it possible to get a correction in prk with involvement ofonly about of the corneal depth while rk is done to a depth of up to why such a difference i thought the proceedures were simmilarwith the exception of a laser being the cutting tool in prk i must notbe understanding all of the differencesno rk makes radial cuts around the circumference of the cornea up to i think and these change the curvature of the cornea through stresschages prk vaporizes burns away a thin layer from the front of thecornea making the optical axis of the eye shorter the laser doesntcut in prk it vaporizes in rk the eye is cut intoin the faq the vision was considered less clear after the surgery thanwith glasses alone if this is completly attributable to theintentional slight undercorrection then it can be compensated for whennecessary with glasses or contacts if they can be worn afterall itis important to know if that is not the case however and some otherconsequence of the surgery would often interfere with clear vision thefirst thing that came to my mind was a fogging of the lense whichglasses couldnt help would not helpi find my vision is more clear for some things and less clear forothers only at night i notice a definite haloing at night in thedarkness when i look at automobile headlamps though this is notsomething i spend inordinate amounts of time doing for ordinarythings my vision in particular having a fullyoperating peripheralvision is clearer than with glasses or contacts le jojo fresh n clean speaking out to the way you want to live today american all american doing a bit so and even more sofrom fulkcsrochesteredu mark fulksubject re science and methodology was homeopathy traditionin article cjduokunxsascom sasghmtheseusunxsascom gary merrill writesof course we cant hope currently at least to explain how or whykekule had the daydream of snakes in the fire biting their tailssurely it wasnt the only daydream he had what was special aboutthis one could it have had something to do with a perceivedanalogy between the geometry of the snakes and problems concerninggeometry of molecules is such analogical reasoning extrascientificor is it rather at the very heart of science perices notion of abductionthe use of models within and across disciplines upon close examinationis there a nonrational mystical leap taking place or is it perhapscloser to a formal though often incomplete analogy or modeli feel the need to repeat myself kekules dream is a rather bad exampleof much of anything read rootbernsteins book on the history of thebenzene ring mark a fulkuniversity of rochestercomputer science departmentfulkcsrochesteredufrom turnerreededu havok impersonatedsubject re is msg sensitivity superstitionin article qlgdrinnbgapcaltechedu carlsolgpscaltechedu writesin article aprccusuedu slyxccusuedu writessurprise surprise different people react differently to different things oneslightly off the subject case in point my brother got stung by a bee i knowhe is allergic to bee stings but that his reaction is severe localizedswelling not anaphylactic shock i could not convince the doctors of thathowever because thats not written in their little rule bookof course bee venom isnt a single chemical could be your brother isreacting to a different component than the one that causes anaphylactic shockin other peoplehmmm the last time i got stung by a bee i experienced the same reactionthe first posters brother did we went off to the doctor to see if ishould worry about the fact that my foot was now about times its normalsize and itched ow he basically said i shouldnt this time butthat bee sting allergy was not something you tended to get aclimatized tobut were something that each time got progressively worse generally and thatnext time could be the time i go into anaphylactic shock admittedly thiswas many years ago when i was young since then i just make sure i dontget stung i also should carry a bee sting kit with me but i dont this isnt scientific or proof but this would lead me to believe its not adifferent reaction just a different degree of reaction allergies workthat way people have various reactions sort of like diabetes somepeople can get by with just monitoring their diet others have to monitortheir diet and use insulin sometimes while others have to watch their dietlike a hawk and use insulin regularly i think msg is probably similarsome people have allergic reactions toit some people are allergic to fermented things and cant use soysaucebut the chinese have been using it for centuries that doesntnecessarily mean that its safe for everyone johannaturnerreededufrom dehpcalvinedu phil de haansubject re chronic sinus and antibioticsin article qkinnamojoengumdedu georgecengumdedu george b clark writesyou can also swab the inside of your nose with bacitracin using aq tip bacitracin is an antibiotic that can be bought otc as anointment in a tube the doctor i listen to on the radio says to applyit for days while you are taking other antibiotics by mouthi have a new doctor who gave me a prescription today for something called septra ds he said it may cause gi problems and i have a sensitive stomach to begin with anybody ever taken this antibiotic any good suggestions for avoiding an upset stomach other tips phil de haan dod why yes that is my honda cl thats the nature of being an executive in america you have to rely on other people to do something you used to do yourself donald fehr executive director major league baseball players associationfrom maryuicslcsluiucedu mary e allisonsubject re is msg sensitivity superstitioncarlsolgpscaltechedu carl j lydick writesof course bee venom isnt a single chemical could be your brother isreacting to a different component than the one that causes anaphylactic shockin other peoplesimilarly chinese food isnt just msg there are a lot of otheringredients in it why when someone eats something with lots ofingredients they dont normally consume one of which happens to bemsg do they immediately conclude that any negative reaction is tothe msg arghhhhhhhhhhread the memosi said that i personally had other people order the exact same food attwo different times from the same restaurant and the people thatordered the food for me did not tell me which time the msg was in thefood and which time it was not in the foodone time i had a reactionone time i did notthe reaction came the time the msg was in the foodthat was the only differencesame restaurant same ingredientswhy when someone eats something with lots of ingredients they dontnormally consume one of which happens to be msg do they immediatelyconclude that any negative reaction is to the msg i eat lots of chinese food i love chinese food ive just learnedthe followingif i get food at one of the restaurants that does not use msg orif i prepare the food myself without msg or if i order the food from a restaurant that will hold the msg and inever get soup unless its from a restaurant that cooks without themsgi do not get a reactionokaydo you understandi get a reaction from msgi do not get a reaction when there is no msgif youre having trouble understand this please tell me which of thewords you do not understand and ill look them up in the dictionaryfor youthe great secret of successful marriage is to treat all disastersas incidents and none of the incidents as disasters harold nicholson mary allison maryuicslcsluiucedu urbana illinoisfrom jchenwindbellcorecom jason chensubject re is msg sensitivity superstitionin article qmlgainnjabhpcolcolhpcom cabcolhpcom chris best writes jason chen writes now here is a new one vomiting my guess is that msg becomes the number one suspect of any problem in this case it might be just food poisoning but if you heard things about msg you may think it must be it yeah it might if you only read the part you quoted you somehow left out the part about we all ate the same thing changes things a bit ehfood poisoning is only one of the many possible causes yes even other peopleshare the food you complain that people blame msg automatically since its an unknown and therefore must be the cause it is equally if not more unreasonable to defend it automatically assuming that it cant be the culpritboy you computer people only know s and s but not much about logic no i did not said msg was not the culprit what i argued was that thatthere was enough reasonable doubt to convict msg if you want to convict msg show me the evidence not quilty by suspicion pepper makes me sneeze if it doesnt affect you the same way fine just dont tell me im wrong for saying sonobody is forcing you to change what you believe but i certainly dontwant to see somebody preach to ban pepper because that makes himhersneeze that is exactly what some antimsg activitiests are doing these people arent condemning chinese food mr chen just one of its optional ingredients try not to take it so personallylook people with a last chen dont necessarily own a chinese restauranti am not interested if you enjoy chinese food or not exploiting my lastname to discredit me on the issue is hitting below the beltwhat i am interested in is the truth let me give you an excert froma recent fda hearing there is no evidence orally consumed glutamate has any effecton the brain said dr richard wurtman of massachusetts instituteof technology the anecdotal experiences of individuals issuperstition not science he said i dont think glutamatehas made them sickand dr robert kenney of george washington university conducted an doubleblind test in showing that the people who reacted to msg alsohad similar reaction when they thought they had msg but actually notalthough there are many contradicting personal stories told in this groupsome of them might have been due to other causes but because the anti msgemotion runs so high that some blame it for anything and everything my purpose is to present a balance view on the issue although i am probably outnumberedjason chenfrom kingreasoningcom dick kingsubject re cant wear contacts after rkprkin article aprzeuscalpolyedu dfieldflutecalpolyedu infospunj dan field writesi love the faq the comment about contact lenses not being an option for any remainingcorrection after rk and possibly after prk is interresting why isthis does anyone know for sure whether this applies to prk as wellalso why is it possible to get a correction in prk with involvement ofonly about of the corneal depth while rk is done to a depth of up to why such a differencein myopia the cornea is too curved there is too much of a bulge in thecenterin prk the laser removes a small amount of material from the centerin rk the surgeon cuts incisions near the edge they heal and the scarringreshapes the corneaentirely different mechanisms and the action is in a different placedkfrom carlsolgpscaltechedu carl j lydicksubject re is msg sensitivity superstitionin article qmlgainnjabhpcolcolhpcom cabcolhpcom chris best writesjason chen writes now here is a new one vomiting my guess is that msg becomes the number one suspect of any problem in this case it might be just food poisoning but if you heard things about msg you may think it must be ityeah it might if you only read the part you quoted you somehow left out the part about we all ate the same thing changes things a bit ehperhaps now just what leads you to believe that it was msg and not someother ingredient in the food that made you illthese people arent condemning chinese food mr chen just one of its optional ingredients try not to take it so personallyand youre condemning one particular ingredient without any evidence thatthats the ingredient to which you reactedcarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itsubject prozacfrom agilmeteiscalstateedu adriana gilmetecan anyone help me find any information on the drug prozac i am writinga report on the inventors eli lilly and co and the product i need asmuch help as i can get thanks a lot adriana gilmetefrom libmanhscuscedu marlena libmansubject need advice with doctorpatient relationship problemi need advice with a situation which occurred between me and a physicanwhich upset me i saw this doctor for a problem with recurring painhe suggested medication and a course of treatment and told me that ineed to call him days after i begin the medication so that he maymonitor its effectiveness as well as my general healthi did exactly as he asked and made the call reaching his secretaryi explained to her that i was following up at the doctors requestand that i was worried because the pain episodes were becoming morefrequent and the medication did not seem effectivethe doctor called me back and his first words were whatever you wantyoud better make it quick im very busy and dont have time to chitchat with you i told him i was simply following his instructions tocall on the th day to status him and that i was feeling worse i then asked if perhaps there was a better time for us to talk when hehad more time he responded just spit it out now because no time isa good time said in a raised voice i started to feel upset andtried to explain quickly what was going on with my condition but mynervousness interfered with my choice of words and i kind of stutteredand then said well never mind and he said hell talk to variouscolleagues about other medications and hell call me some other timethis doctor called me that evening and said because i didnt expressmyself well he was confused about what i wanted at this point iwas pretty upset and i told him in an amazingly polite voice consideringhow angry i felt that his earlier manner had hurt my feelings he toldme that he just doesnt have time to rap with patients and thoughtthat was what i wanted i told him that to assume i was calling torap was insulting and said again that i was just following throughon his orders he responded that he resented the implication that he felt i was making that he was not interested in learning about what hispatients have to say about their condition status he then gave methis apology i am sorry that there was a miscommunication and youmistakenly thought i was insulting i am not trying to insult youbut i am not that knowledgeable about pain and i dont have a lot oftime to deal with that he then told me to call him the next dayfor further instructions on how do deal with my pain and medicationi am still upset and have not yet calledmy questions should i continue to have this doctor manage my care since i am in pain off and on i realize that this may cause me tobe more anxietous so am i perhaps overreacting or overly sensitiveif this doctor refers me to his colleague who knows more about the typeof pain i have he still wants me to status him on my condition butnow i am afraid to call himmarlenafrom pajukcogecmrc paul johnsonsubject re sore throatin article sdccucsdedu wsunjeevesucsdedu fiberman writesi have had a sore throat for almost a week when i look intothe mirror with the aid of a flash light i see white plaques inthe very back of my throat on the sides i went to a healthcenter to have a throat culture taken they said that i do nothave strep throat could a viral infection cause white plaqueson the sides of my throatfirst i am not a doctor i know about this because i have beenthrough itit sounds like tonsilitis lit swollen tonsils feel under your jawhinge for a swelling on each side if you find them its tonsilitisive had this a couple of times in the past the doctor prescribed aweeks course of penicillin and that cleared it upin my case it was associated with glandular fever which is a viralinfection which from my point of view resembled flu and tonsilitisthat kept coming back for a year or so there is a blood test forthisin conclusion see a doctor if you have not done so alreadypaul paul johnson pajgecmrccouk tel ext these ideas and others like them can be had gecmarconi research is notfor each from any reputable idealist responsible for my opinionsfrom rindenterprisebihharvardedu david rindsubject re centrifugein article cjsmhrslznjlincroftnjncrcom rjflzsclincroftnjncrcom efwrobert feddelermtt writes could somebody explain to me what a centrifuge is and what it is used for i vaguely remembre it being something that spins test tubes around really fast but i cant remember why youd want to do thatpurely recreational they get bored sitting in thatrack all the timeno this is wrong the purpose is to preserve the substances inthe tubes longer by creating relativistic speeds and thustime dilatation of course by slowing the subjective time ofthe test tubes they get less bored which is probably what youwere thinking of david rindrindenterprisebihharvardedufrom mcovingtaisunaiugaedu michael covingtonsubject re need advice with doctorpatient relationship problemsounds as though his hearts in the right place but he is not adept atexpressing it what you received was meant to be a profound apologyapologies delivered by overworked shy people often come out like that michael a covington associate research scientist artificial intelligence programs mcovingtaiugaedu the university of georgia phone athens georgia usa amateur radio ntmi from jimjcontractorebaysuncom jim jonessubject postfever rashes i get em every timethe subjectline says it every time i run a fever i get an amazingrosy rash over my torso and arms fortunately it doesnt itchthe rash always comes on the day after thefever breaks and no matter what the illness was cold flu whateverit started happening about four years ago after i moved to my currenttown although i dont know if that has anything to do with anythingseverity and persistance of the rash seems to vary with the fevera severe or longlasting fever brings a longlasting rash a mild feverseems to bring rashes that go away faster anybody know what might be causing this its no more than an embarassment but id be curious to know whats going on am i carryingsome kind of feverresistant bug that goes wild when fever knocks outits competitionjim jonesfrom panpandastanfordedu doug pansubject re is msg sensitivity superstitionin article qkdpkkagateberkeleyedu mossmanceaberkeleyedu amy mossman writes i had a similar reaction to chinese food but came to a completly different conclusion ive eaten chinese food for ages and never had problems i went with some chinese malaysian friends to a swanky chinses rest and they ordered lots of stuff i had never seen before the only thing i can remember of that meal was the first course scallops served in the shell with a soytype sauce i thought well ive only had scallops once and i was sick after but that could have been a coincidence that night as i sat on the bathroom floor sweating and emptying my stomach the hard way i decided i would never touch another scallop i may not be allergic but i dont want to take the chancei dont react to scallops but did have discomforts with clam juiceserved at american waterfront seafood bars i dont know whetherthe juice is homemade or from cansthe following is my first encounter with the chinese restaurantsyndrome ten years ago about an hour after having won ton soup icollapsed in a chair with my face feeling puffed up my scalptingling my feet too weak to stand up the symptoms lasted for about minutes determined to find out the cause of my first reaction iwent back to the chinese restuarant and ordered the same dish thesame thing happened a quick look inside the kitchen revealed nothingout of the ordinaryive also had a mild attack after having soup at a thai restuarantfrom sasghmtheseusunxsascom gary merrillsubject re science and methodology was homeopathy traditionin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes flights of fancy and other irrational approaches are common the crucial thing is not to sit around just having fantasies they arent of any use unless they make you do some experiments ive known a lot of scientists whose fantasies lead them on to creative work usually they wont admit out loud what the fantasy was prior to the consumption of a few beers simple example warren jelinek noticed an extremely heavy band on a dna electrophoresis gel of human alu fragments he got very excited hoping that hed seen some essential part of the control mechanism for eukaryotic genes this fantasy led him to sequence samples of the band and carry out binding assays the result was a wellconserved or so bp sequencebut why do you characterize this as a flight of fancy or a fantasywhile i am unfamiliar with the scientific context here it appears obviousthat his speculation for lack of a better or more neutral word wasat least in significant part a consequence of his knowledge of and acceptanceof current theory coupled with his observations it would appear thatsomething quite rational was going on as he attempted to fit his observationinto that theory or to tailor the theory to cover the observation thisdoes not seem like an example of what most would normally call a flight offancy or a fantasy it is not clear to me what you mean by rational vs irrational perhaps you can give a few examples of surprising experiments that were tried out for perfectly rational reasons or interesting new theories that were first advanced from logical grounds the main examples i can think of are from modern highenergy physics which is not typical of science as a wholewell i think someone else in this thread was the first to use the word alsoextrascientific etc nor am i prepared to give a general account ofrationality in terms of examples there is some danger of beginning to quibbleover what a surprising experiment is what counts as surprising etcthe same may be said about logical grounds my point is that quite frequentlyperhaps even most frequently the roots of a new theory can be traced topreviously existing theories or even to previously rejected hypotheses ofsome other theory or domain i would offer some rather well known examplessuch as toricellis puy de dome experiment done for the sake of his sea of airhypothesis was this theory and the resulting experimental test surprisingwell given the prior explanations of the phenomena involved it certainly mustbe counted as so was the theory constructed and the experiment designedout of perfectly rational grounds well there was a pretty successful andwell know theory of fluids the analogy to fluids by toricelli is explicitthe novelty was in thinking of air as a fluid but this was quite a noveltyat the time was the theory interesting yes was it new well onecould argue that it was merely the extension of an existing theory to a newdomain but i think this begs certain questions we can debate that if youlike gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmsubject experts on penicillinlookfrom ndacumoeiscalstateedu noah dacumosmy name is noah dacumos and i am a student at san leandro high i amdoing a project for my physics class and i would like some info on thediscovery of penicillin its discoverersir alexander fleming and how ithelps people with many incurable bacterias also how it effects those whoare allergic to it any info will be greatly appreciatednoah dacumosfrom jfareisswaterlooncrcom jim faresubject re endometriosisin article aprrockconcertnet naomirockconcertnet naomi t courter writescan anyone give me more information regarding endometriosis i heardits a very common disease among women and if anyone can provide namesnaomiendometriosis is where cells that would normally be lining the uteris existoutside the uteris sometimes this causes problems often it doesntthere is generally no need to remove pockets of endometriosis unless they arecausing other problems one lady i know had endometriosis in an ovary this caused her a great deal of pain another lady i know has an endometrial cyst in her abdominal wall she is not having it removedthe american fertility society has information on this and they probably maintain a list of physicians in all parts of the continent that deal withendometriosis you can reach them atthe american fertility society th ave southsuite birmingham alabama jffrom szikopousuperiorcarletonca steven zikopoulossubject re prozacin clxbeiscalstateedu agilmeteiscalstateedu adriana gilmete writescan anyone help me find any information on the drug prozac i am writinga report on the inventors eli lilly and co and the product i need asmuch help as i can get thanks a lot adriana gilmetepdr and cps are good places to startsdo a medline search lots of interesting debates going on rememberwhen prozac was impicated in suicidal behavioursteve zfrom mdfshemeshgtecom mark feblowitzsubject re is msg sensitivity superstitionin article qhusduagateberkeleyedu sppzabriskieberkeleyedu steve pope writes its worse than that there is no such thing as a doubleblind study on the effects of msg by virtue of the fact that msg changes the taste of food in a characteristic way that is detectable by the subject and that cannot be duplicated by a placebocommon you can easily disguise to flavor of msg by putting it in acapsule then the study becomes a double blind of msg capsulesagainst control capsules containing exactly the same contents minusthe msgmark feblowitz gte laboratories inc sylvan rd waltham ma mfeblowitzgtecom fax from tongohsuedu gong tongsubject re is msg sensitivity superstitionin article aprcunewscarletonca wcsbeaualfredcarletonca opirg writesin article aprtmsmicroticom davidtmsmicroticom david thomas writesin article aprdelphigsfcnasagov packerdelphigsfcnasagov charles packer writesis there such a thing as msg monosodium glutamate sensitivityi saw in the ny times sunday that scientists have testified before an fda advisory panel that complaints about msg sensitivity aresuperstition anybody here have experience to the contrary im old enough to remember that the issue has come up at leasta couple of times since the s then it was called thechinese restaurant syndrome because chinese cuisine hasalways used itso far ive seen about a dozen posts of anecdotal evidence butno facts i suspect there is a strong psychological effect at work here does anyone have results from a scientific studyusing doubleblind trials check out just some posts before your own maybe you missedit amidst the flurry of responses yet again the use of thisnewsgroup is hampered by people not restricting their posts to mattersthey have substantial knowledge offor cites on msg look up almost anything by john w olney atoxicologist who has studied the effects of msg on the brain and ondevelopment it is undisputed in the literature that msg is anexcitotoxic food additive and that its major constituent glutamateis essentially the premierie neurotransmitter in the mammalian brainhumans included too much in the diet and the system gets thrownoff glutamate and aspartate also an excitotoxin are necessary insmall amounts and are freely available in many foods but the amountsadded by industry are far above the amounts that would normally beencountered in a ny single food by eating lots of junk foodpackaged soups and diet soft drinks it is possible to jack yourblood levels so high that anyone with a sensitivity to thesecompounds will suffer numerous real physilogical effects read olneys review paper in prog brain res and check hissources they are impecable there is no dispute dianne murray wcsbeauccscarletoncain order to excitotoxin effects of msg msg that in blood must go through bloodbrain barrier that i am not sure msg can go through or not in normal condition the concentration of glutamate in the cerebrospinal fluid is about um that is high enough to activate one type of glutamate receptorthe nmdareceptor but the question is neuron and glial cell in the brain have a lots of transport to get glutamate into neuron or glial so no one know exact concentration of glutamate is around neurons glutamate is most important neurotransmitter in the central nervous system it is involved in not only in daily life like the controling of movement it is alsoinvolved in develpoment memory and learn it is involved in lognterm potentialtion that be thought is the basis of learning from dyerspdcccom steve dyersubject re is msg sensitivity superstitionin article aprcunewscarletonca wcsbeaualfredcarletonca opirg writesso far ive seen about a dozen posts of anecdotal evidence butno facts i suspect there is a strong psychological effect at work here does anyone have results from a scientific studyusing doubleblind trials check out just some posts before your ownum i hate to break this to you but article numbers are unique per sitethey have no meaning on other machinesmaybe you missed it amidst the flurry of responsesyou mean the responses some of which pointed to doubleblind testswhich show no such chinese restaurant effect unique to msgits elicited by the placebo as wellyet again the use of thisnewsgroup is hampered by people not restricting their posts to mattersthey have substantial knowledge oflike youself someone who can read a scientific paper and apparentlycome away from it with bizarrely cracked ideas which have nothing todo with the use of this substance in human nutritionfor cites on msg look up almost anything by john w olney atoxicologist who has studied the effects of msg on the brain and ondevelopment it is undisputed in the literature that msg is anexcitotoxic food additiveno its undisputed in the literature that glutamate is an amino acidwhich is an excitatory neurotransmitter there is also evidence thatexcessive release of glutamate may be involved in the pathology of certainconditions like stroke drowning and lou gehrigs disease just to name a fewthis is a completely different issue than the use of this ubiquitous amino acidin foods people are not receiving intraventricular injections of glutamateand that its major constituent glutamateis essentially the premierie neurotransmitter in the mammalian brainhumans includedi dont know about premier but its certainly an important onetoo much in the diet and the system gets thrown offsez you such an effect in humans has not been demonstrated in anycontrolled studies infant mice and other models are useful as faras they go but theyre not relevant to the matter at hand which isnot to say that i favor its use in things like baby fooda patentlyridiculous use of the additive but we have no reason to believethat msg in the diet effects humans adverselyglutamate and aspartate also an excitotoxin are necessary insmall amounts and are freely available in many foods but the amountsadded by industry are far above the amounts that would normally beencountered in a ny single foodwrong do you know how much aspartate or phenylalanine is in a soft drinkmilligrams worth compare that to a glass of milk do you know how muchglutamate is present in most proteincontaining foods compared to thatadded by the use of msgby eating lots of junk foodpackaged soups and diet soft drinks it is possible to jack yourblood levels so high that anyone with a sensitivity to thesecompounds will suffer numerous real physilogical effects notice the subtle covering of her ass here anyone with a sensitivitywere disputing the size of that classread olneys review paper in prog brain res and check hissources they are impecable there is no disputeimpeccable there most certainly is a dispute steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom drandspinnerosforg douglas s randsubject re chronic sinus and antibioticsin article dehpcalvinedu dehpcalvinedu phil de haan writes in article qkinnamojoengumdedu georgecengumdedu george b clark writes you can also swab the inside of your nose with bacitracin using a q tip bacitracin is an antibiotic that can be bought otc as an ointment in a tube the doctor i listen to on the radio says to apply it for days while you are taking other antibiotics by mouth i have a new doctor who gave me a prescription today for something called septra ds he said it may cause gi problems and i have a sensitive stomach to begin with anybody ever taken this antibiotic any good suggestions for avoiding an upset stomach other tipsive taken septra my daughter has taken it many times for earinfections it works sometimes it is a sulfa drug about the onlyproblem i found was that im sensitive and developed a rash after ninedays of a ten day course no more septra for me my doctor wasremiss in not telling me to watch out for a rash i was quite in thedark and didnt realize that it could be a drug reaction no harmdone thoughdougdouglas s rand drandosforgosfmotif devsnail cambridge center cambridge ma disclaimer i dont know if osf agrees with me lets vote on itamateur radio kckjfrom richardtiscom richard clarksubject re is msg sensitivity superstitionpackerdelphigsfcnasagov charles packer writesis there such a thing as msg monosodium glutamate sensitivityi saw in the ny times sunday that scientists have testified before an fda advisory panel that complaints about msg sensitivity aresuperstition anybody here have experience to the contrary im old enough to remember that the issue has come up at leasta couple of times since the s then it was called thechinese restaurant syndrome because chinese cuisine hasalways used itmy blood pressure soars my heart pounds and i cant get to sleepfor the life of me feels about like i just drank cups of coffeei avoid it and beet sugar flavor enhancers beet powder andwhatever other names it may go under basicaly i read the ingredients andif i dont know what they all are i dont buy the productmsg sensitivity is definately realrelativity schmelativity richard h clarkmy opinions are my own and lunatik watch for me on the roadought to be yours but under its not my fault i voted perotno circumstances are they richardtiscomthose of my companyfrom turpincsutexasedu russell turpinsubject re science and methodology was homeopathy traditioni agree with everything that lee lady wrote in her previous post inthis thread in case this puzzles people i would like to expandon two of her commentsin article cjodhignewshawaiiedu ladyuhunixuhcchawaiiedu lee lady writes avoiding mistakes is certainly highly desirable however it is also widely acknowledged that perfectionism is inimicable to creativity in the extreme case a perfectionist becomes so paralyzed by all the possible mistakes he might make that he is unable to even leave the house one of the most important and difficult aspects of reasoningabout empirical investigation lies in understanding the contextscope and importance of the various arguments and pieces ofevidence that are marshalled for a claim some errors break theback of a piece of research some leave a hole that needs to befilled in and some are trivial in their importance it is agrave mistake to confuse thesepast snippets from this thread i doubt if einstein used any formal methodology he also proposed numerous experiments which if performed would distinguish a universe in which special relativity holds from one in which it does not back to lee lady these are not the rules according to many who post to scimed and scipsychology according to these posters if its not supported by carefully designed controlled studies then its not sciencethese posters are making the mistake that i have previouslycriticized of adhering to a methodological recipe a carefullydesigned and controlled study is neither always possible noralways important on the other hand if someone is proposing aremedy that supposedly alleviates a chronic medical problem wehave enough knowledge of the errors that have plagued this kindof claim to ask for a carefully designed and controlled studyto alleviate our skepticismrules such as support the hypothesis by a carefully designed andcontrolled study are too narrow to apply to all investigationi think that the requirements for particular reasoning to beconvincing depends greatly on the kinds of mistakes that haveoccurred in past reasoning about the same kinds of things toreuse the previous example we know that conclusions fromuncontrolled observations of the treatment of chronic medicalproblems are notoriously problematic russellfrom marktarbellsuitecomsubject amniocentesis et alis there some difference between the purposes behindamniocentesis and chorionic villi sampling they soundsimilar to me but are intended to detect differentthingsthankssubject need help in steroid researchfrom tthompseiscalstateedu thomas thompson i am doing a term paper on steroids actually the scientist whohelped crate the drug i discovered that joseph fruton is one of theresearchers who helped create anabolic steroids the only information on this person i know is he was a biochemist that did research in the si already did research at my local libraries but i still need moreinformation my instructor is requiring resources from the computernetworks please write back concerning my subject any books articlesetc will be appreciated from breinjplpostjplnasagov barry s reinsubject need survival data on colon cancera relative of mine was recently diagnosed with colon cancer i would liketo know the best source of survival statistics for this disease whendiscovered at its various stagesi would prefer to be directed to a recent source of this data rather thanreceive the data itselfthank you barry rein breinjplpostjplnasagov no clever comment from fulkcsrochesteredu mark fulksubject re science and methodology was homeopathy traditionin article clwsjnunxsascom sasghmtheseusunxsascom gary merrill writesin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes genes this fantasy led him to sequence samples of the band and carry out binding assays the result was a wellconserved or so bp sequencebut why do you characterize this as a flight of fancy or a fantasythe fantasy was that he had found something of fundamental importance toone of the hot questions of the day he really had very littlereason to believe it other than raw hope by fantasy i certainly dontmean velikovskian maniassome other theory or domain i would offer some rather well known examplessuch as toricellis puy de dome experiment done for the sake of hissea of air hypothesisim not familiar with the history of this experiment although arguablyi should besurprisingwell given the prior explanations of the phenomena involved it certainlybe counted as so was the theory constructed and the experiment designedout of perfectly rational grounds well there was a pretty successful andwell know theory of fluids the analogy to fluids by toricelli is explicitthe novelty was in thinking of air as a fluid but this was quite a noveltyat the time was the theory interesting yes was it new well onecould argue that it was merely the extension of an existing theory to a newdomain but i think this begs certain questions we can debate that if youlikei think that it is enough if his contemporaries found the result surprisingthats not what id quibble about what id like to know are toricellisreasons for doing his experiment not the post hoc constructed reasonsbut the thoughts in his head as he considered the problem it may beimpossible to know much about toricellis thoughts thats too bad ifit is so one of rootbernsteins services to science is that he has gonerooting about in pasteurs and flemings and other peoples notes and hasdiscovered some surprising clues about their motivations pasteur neverpublicly admitted his plan to create mirrorimage life but the dreams areright there in his notebooks finally public after many years ready foranyone to read and i and my friends often have the most ridiculousreasons for pursuing results one of my best came because i was mad ata colleague for a poorlywritten claim i disproved the claimof course toricellis case may be an example of a rarety where thefantasy not only motivates the experiment but turns out to be rightin the endmark mark a fulkuniversity of rochestercomputer science departmentfulkcsrochesteredufrom sdbsdcislabspittedu stephen d brenersubject japanese for scientists and engineers intensive japanese at the university of pittsburgh this summer the university of pittsburgh is offering two intensive japanese languagecourses this summer both courses intensive elementary japanese and intensive intermediate japanese are ten week ten credit courses each equivalent to one full year of japanese language study they begin june and end august the courses meet five days per week five hours per day there is a flat rate tuition charge of per course fellowships available for science and engineering students contact steven brener program manager of the japanese science and technologymanagement program at the university of pittsburgh at the number oraddress below all interested individuals are encouraged to apply this is not limited to university students new program announcement japanese science and technology management programthe japanese science and technology management program jstmp is a newprogram jointly developed by the university of pittsbugh and carnegie mellon university students and professionals in the engineering and scientific communitites are encouraged to apply for classes commencing in june and january program objectivesthe program intends to promote technology transfer between japan and the united states it is also designed to let scientists engineers and managersexperience how the japanese proceed with technological development this is facilitated by extended internships in japanese research facilities andlaboratories that provide participants with the opportunity to developlongterm professional relationships with their japanese counterpartsprogram designto fulfill the objectives of the program participants will be required to develop advanced language capability and a deep understanding of japan andits culture correspondingly jstmp consists of three major components training in the japanese languageseveral japanese language courses will be offered including intensive coursesdesigned to expedite language preparation for scientists and engineers in arelatively short time education in japanese business and social culturea particular enphasis is placed on attaining a deep understanding of thecultural and educational basis of japanese management approaches in manufacturing and information technology courses will be available in a variety of departments throughout both universities including anthropologysociology history and political science moreover seminars and colloquiumswill be conducted further a field trip to japanese manufacturing or research facilities in the united states will be scheduled an internship or a study mission in japanupon completion of their language and cultural training at pitt and cmu participants will have the opportunity to go to japan and observeand participate in the management of technology internships in japanwill generally run for one year however shorter ones are possiblefellowships covering tuition for language and culture courses as well asstipends for living expenses are available for more information and application materials contactsteven brenersusie brownjstmpcarnegie mellon university gsiauniversity of pittsburghpittsburgh pa e forbes quadrangletelephone pittsburgh pa fax telephone fax interested individuals companies and institutions should respond by phone ormail please do not inquire via emailplease note that this is directed at grads and professionals however advancedundergrads will be considered further funding is resticted to us citizensand permanent residents of the ussteve brenerfrom georgecengumdedu george b clarksubject re endometriosisyou may want to inquire about taking lupron as a medication itssupposed to be a new treatment and its described in nov issue of j of obst and gynlupron is taken as a monthly injection whereas other drugs suchas danazol are taken daily as pillsfrom cpsgeneraliharvardedu chris schaeffersubject re eugenicsin article pittuucp gebcspittedu gordon banks writesprobably within years a new type of eugenics will be possibleshould we do this should we make a race of diseasefree longlivedarnold schwartzeneggermuscled supermen even if we cangordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon two thoughts i think that psychologically it will be easier for the next generation to accept genetic manipulation it seems that people frownupon messing with nature ignoring our eonsold practice of doing just thatany new human intervention is arrogance and hubris and manipulationwe routinely do is natural and certainly not a big deal most interesting human traits will probably be massivelypolygenetic and be full of tradeoffs in addition without a positivesocial environment for the cultivation of genetic gifts having them wontbe the advantage its made out to be some people will certainly pursue itas if it is the grail but we know how most of those quests turn outchris schaeffer from akinscbnewsdcbattcom kayaakinssubject re foodrelated seizuresin article paulsonaprcmblarcnasagov paulsontablarcnasagov sharon paulson writes i am posting to this group in hopes of finding someone out there in network newsland who has heard of something similar to what i am going to describe here i have a fourteen year old daugter who experienced a seizure on november at am after eating kellogs frosted flakes she is perfectly healthy had never experienced anything like this before and there is no history of seizures in either side of the family all the tests eeg mri ekg came out negative so the decision was made to do nothing and just wait to see if it happened again well we were going along fine and the other morning april she had a bowl of another kellogs frosted kind of cereal fruit loops i am embarrassed to admit that i even bought that junk but every once in a while so i pour it in her bowl and think oh oh this is the same kind of junk she was eating when she had that seizure ten minutes later she had a full blown seizures this was her first exposure to a sugar coated cereal since the last seizuremy daughter has epilepsy and i attend a monthly parent support groupjust wednesday night a mother was telling how she decided to throwall the junk food out and see if it made a difference in her yearoldsseizures he was having about one seizure per week she reported thatshe did this on thursday he had a seizure on saturday and thenwent weeks without a seizure on easter he went to grandmas and ate candy pop anything he wanted he had a seizure the next day she sees sensitivity to nutrasweet sugar colors caffine and corn withcorn she says he gets very nervous and aggresive with my own daughter age i think she is also sensitive and staysaway from those foods on her own she has never had gum wont eatcandy prefers an apple to a cookie doesnt like chocolate and wonteven use toothpaste her brother on the other hand is a junk foodaddict hope this helps good luckfrom mcgnscclehighedu marc gabrielsubject bouncing lymenet newslettersthe following addresses are on the lymenet mailing list but are rejectingmail since the list server originally accepted these addresses successfullyi assume these addresses have since been eliminated improperly functioningmail gateways might also be responsibleif you are listed here and would still like to remain on the list pleasewrite to me otherwise i will remove these addresses from the list before thenext newsletter goes outas a general rule please remember to unsubscribe from all your mailinglists before your account is closed this will save the listserv maintainerfrom many headacheslezlielsitkasuncomkennethrhallrochxeroxcomwestmxayoubuunetuunetabsolabsolcomrsbpanixcom marc c gabriel uc box lehigh universityfrom andersomspotcoloradoedu marc andersonsubject miracle berries anyonefrom kalat jw biological psychology wadsworth publishing cobelmont ca pg reproduced without permissiondigression miracle berries and the modification of taste receptorsalthough the miracle berry a plant native to west africa is practicallytasteless it temporarily changes the taste of other substances miracleberries contain a protein miraculin that modifies sweet receptors insuch a way that they can be stimulated by acids bartoshuk gentile moskowitz meiselman if you ever get a chance to chew a miracleberry and i do recommend it for about the next half an hour all acids which are normally sour will taste sweet they will continue to tastesour as wellmiraculin was for a time commercially available in the united states as adiet aid the idea was that dieters could coat their tongue with a miraculinpill and then eat and drink unsweetened slightly acidic substances suchsubstances would taste sweet without providing many caloriesa colleague and i once spent an evening experimenting with miracle berrieswe drank straight lemon juice sauerkraut juice even vinegar all tastedextremely sweet somehow we forgot how acidic these substances are we awoke the next day to find our mouths full of ulcers continued discussion of a couple other tastealtering substances refs bartoshuk lm gentile rl moskowitz hr meiselman hl sweet taste induced by miracle fruit synsephalum dulcificum physiology behavior anyone ever hear of these things or know where to get themmarcandersomspotcoloradoedufrom vonwaadnkuhubccukansedusubject panic disorder more success storiesi posted this to scipsychology on april and after seeingyour post here on panice disorder thought it would berelevantmy research indicates that two schools of thought existthe literature promoting medication says its the superiortreatment not surprisingly literature promoting cognitivetherapy also claims to be superiorwhat are the facts early in my research i didnt have abias towards either medication or cognitive therapy iwas interested in a treatment that worked after readingjournals published after the cognitive therapy campclaims a higher success rate approx a lower dropoutrate and no side effects associated with medicationlarsgoran ost published an excellent article titledapplied relaxation description of a coping technique anda review of controlled studies this is from behav res thervol no pp the article providesinstructions on how to perform applied relaxation arbriefly you start with two minute sessions daily andprogress in weeks to performing thirty second sessionsdailyill snail mail this article to anyone interested usa only pleaseinternational please pay for postagemarkvonwaadnkuhubccukansedufrom mcovingtaisunaiugaedu michael covingtonsubject re foodrelated seizuresim told that corn allergy is fairly common my wife has it and it seemsto be exacerbated if sugar is eaten with the corni suppose that in a person just on the verge of having epilepsy anallergic reaction might cause a seizure but i dont really knowgordon michael a covington associate research scientist artificial intelligence programs mcovingtaiugaedu the university of georgia phone athens georgia usa amateur radio ntmi subject post polio syndrome information needed please from keithactrixgennz keith stewartmy wife has become interested through an acquaintance in postpolio syndromethis apparently is not recognised in new zealand and different symptons egchest complaints are treated separately does anone have any information onitthankskeithfrom sppzabriskieberkeleyedu steve popesubject re is msg sensitivity superstitioncarl lydick and youre condemning one particular ingredient without any evidence that thats the ingredient to which you reactedbelieve what you willthe mass of anectdotal evidence combined with the lack ofa properly constructed scientific experiment disprovingthe hypothesis makes the msg reaction hypothesis themost likely explanation for eventsstevefrom simonnmcraedartmouthedu simon n mcraesubject re hepatitisbin article aprdosgaterussellsinclairdaycanremcom russell sinclairday writes what we are really worried about is not knowing the facts the doctor has stated that things will not be good if she is a carrier and avoids further questions on the subject we really would like to know so we can take steps and plan in advance for any eventualities thankyou for your very informative post right now i am just trying to find out everything that i can russunfortunately hep b infection can eventuate in chronic hepatitis andsubsequent cirrhosis although not many patients with hep b go on tochronic hepatitis it does still occur in a good number and issomething to keep in mind hepatitis c was nona nonb hep muchmore frequently leads to chronic hep and cirrhosis there is also anautimmune chronic hepatitis that affects mostly younger women whichalso leads to cirrhosis of course cirrhosis is a most unkind disease the most dangerouseffects relate to portal hypertension and loss of liver function patients develop lifethreatening variceal bleeds and hepatic comasamong many other problems as a result of disturbances in hepaticcirculation less ominously they can exhibit the effects ofhyperestrogenemia which often characterize patients with cirrhosis these effects include telangiactasias small red skin lesions and inmen gynecomastia breast development the only real treatment forcirrhosis is liver transplantkeep in mind that cirrhosis is not expected at least statistically inyour friends case nevertheless you might want to bring up thesubject of chronic disease and cirrhosis with the doctor hopefully heor she can then carefully explain these sequelae of hep b infection toyou and offer you supportsimon from jimzisfeinfactorycom jim zisfein subject foodrelated seizuressp from paulsontablarcnasagov sharon paulsonsp to describe here i have a fourteen year old daugter who experiencedsp a seizure on november at am after eating kellogs frostedsp flakessp well we were going along fine and the other morning april she hadsp a bowl of another kellogs frosted kind of cereal fruit loops i amsp when i mentioned what she ate the first time as a possible reason forsp the seizure the neurologist basically negated that as an idea nowsp after this second episode so similar in nature to the first evensp he is scratching his headtheres no data that sugarcoated cereals cause seizures i haventeven seen anything anecdotal on it given how common they are eaten do you know any child or adolescent who doesnt eat the stuff i think that if there were a relationship we would know it by nowalso theres nothing weird in those cereals as far as the brainis concerned except for a few infantile metabolic disorders such asgalactosemia sugar is sugar regardless if it is coated on cerealsprinkled onto cereal or dissolved in soda coffee or whateverthere was some interest a few years ago in aspartame loweringseizure thresholds but i dont believe anything ever came of it slmr email jimzisfeinfactorycom jim zisfein from jimzisfeinfactorycom jim zisfein subject re could this be a migrainegb from gebcspittedu gordon banksgb the hmo would stop the overordering but in hmos tests aregb underorderedthats a somewhat overbroad statement im sure there are hmos inwhich the fees for lab tests are subtracted from the doctorsincome in most however including the one i work for there is nodirect incentive to underorder profits of the group are sharedamong all partners but the group is so large that an individualsgenerated costs have a miniscule effect i dont believe that weunderorder then again im not really sure what the right amountof ordering is or should be relative to the average britishneurologist i suspect that i rather drastically overorder slmr email jimzisfeinfactorycom jim zisfein from npmnetcomcom nancy p milligansubject re need advice with doctorpatient relationship problemid dump him rude is rude and it seems he enjoys belittling andhumiliating you but dont just dump him write to him and tellhim why you are firing him if you can think about sending a copyof your letter to whoever is in charge of the clinic where he works if applicable or maybe even to the ama dont be vindictive inyour letter be truthful but very firmbut dont be a victim and just put up with it take control itllmake you feel greatnancy m nancy p milligannpmnetcomcom ornpmdalectscomfrom mhollowaicsunysbedu michael hollowaysubject re homeopathy a respectable medical traditionin article chlbuiatriposcom homertriposcom webster homer writesmhollowaicsunysbedu michael holloway writesheres your error i really do think this shows some confusion on yourpart drum roll please science isnt so much the gathering of evidenceto support an assertion read hypothesis as it is the gathering ofempirical observations in order to make an hypothesis what shouldconvince you or not shouldnt be the final product so much as how theproduct was made heres your error there is no observation or hypothesis that is not taintedby theory i have a theory i make observations those observations will bemade with my theory in mind yes absolutely though id make the observation in a more general sense ofall observations are made by human beings and therefore made with variousbiases but here your message leaves talk of hypothesis and gets back once again to equating the business of science with the end result the gizmo producedscience works very well at developing theorieswithin paradigms but is very poor at dealing with paradigm shifts if i develop a novel paradigm that explains homeopathy chinese medicine or spontaneous combustion if the paradigm is useful it will show me the wayto make observations that prove or disprove itmy point isnt so much whether or not you have a novel paradigm but how you come about developing itthe paradigm of modern medicine is that the body can be reduced to a set ofessentially mechanical operations wherein disease is seen as malfunctions inthe machinery essentially the old newtonian model of the world it seemslikely that theories based upon this paradigm do not give a complete discription of the universe medicine healing etc indeed we now recognize an important psychological component to healing perhaps youd admit that this is an oversimplification on your part the topicof the philosophy of science is made for them im making them too but ithink that it also summarizes popular misconceptions of science and the business of doing science biomedical research doesnt make any basic assumptions that arent the same as any other discipline of scientificresearch that is that you make empirical observations form an hypothesisand test it modern medicine has much more to do with biochemistry than the old newtonian model of the world and i doubt that many psychologistswould appreciate being put outside this empirical world view psychologyalso has more to do with biochemistry than spoon bending it is also important to distinguish reason from science science may bereasonable but so are many nonscientific methodologies aristotle reasonedthat frogs came from mud by observing one hop out of a puddle oversimplified of course but a good example this is an empirical observation it was then tested though perhaps not by aristotle and eventually found wanting in the meantime some folk will have continued to believe in the spontaneous generation of animal life theres nothing at all surprising about this its the way the gathering ofknowledge works there are probably more than a few things in my own discipline of molecular biology that will be found to be totally offbaseeven idiotic to someone in the future these future people wont have cometo these relevations because they had suddenly gone all zenlike and had a vision in an lsd trip someone will have thought of something new and tested it this is the bit that people who seem to relish misrepresentingscience and research cant seem to wrap their minds around science is a creative process what i think of as factual and good research can be totallyturned on its head tommorrow by new results and theories again i think it gets down to defining what you mean by science i oftendont recognize what it is that i do and am involved in in the way scienceis portrayed by popular media or writings of people in the humanities theyportray science as a collection of immutable facts pronouncements of truthin big gold letters thats silly its as though we just go into the labturn over a stone and come up with a mechanism for transcriptional regulation its much more interesting than that it really is a very humanprocessfrom akyfnysuedu michael hollowaysubject re organ donation and transplantation fact sheetin a previous article dougbcommmotcom doug bank saysin article aprsbcssunysbedu mhollowaicsunysbedu organ donors are healthy people who have died suddenly usually through accident or head injury they are brain dead the organs are kept alive through mechanical meansok so how do you define healthy peoplemy wife cannot donate blood because she has been to a malarial regionin the past three years in fact she tried to have her bone marrowtyped and they wouldnt even do that whyi cant donate blood either because not only have i been to a malarialregion but i have also been diagnosed and surgically treated fortesticular cancer the blood bank wont accept blood from me for years obviously it wouldnt be of much help to treat one problem by knowingly introducing another cancer mestastizes my imperfect understanding of the facts are that gonadal cancer is particularly dangerous in this regard i havent done the research on it but i dont recall ever hearing of a case of cancer being transmitted by a blood transfusion probably just a common sense kind of arbitrary precaution transmissable diseases like malaria though are obviously another story michael hollowayemail mhollowaccmailsunysbedu mail to freenet is forwardedphone from wcsbeaualfredcarletonca opirgsubject re is msg sensitivity superstitionin article aprohsuedu tongohsuedu gong tong writesin article aprcunewscarletonca wcsbeaualfredcarletonca opirg writesfor cites on msg look up almost anything by john w olney atoxicologist who has studied the effects of msg on the brain and ondevelopment it is undisputed in the literature that msg is anexcitotoxic food additive and that its major constituent glutamateis essentially the premierie neurotransmitter in the mammalian brainhumans included too much in the diet and the system gets thrownoff glutamate and aspartate also an excitotoxin are necessary insmall amounts and are freely available in many foods but the amountsadded by industry are far above the amounts that would normally beencountered in a ny single food by eating lots of junk foodpackaged soups and diet soft drinks it is possible to jack yourblood levels so high that anyone with a sensitivity to thesecompounds will suffer numerous real physilogical effects read olneys review paper in prog brain res and check hissources they are impecable there is no dispute dianne murray wcsbeauccscarletoncain order to excitotoxin effects of msg msg that in blood must go through bloodbrain barrier that i am not sure msg can go through or notelevated levels of glu and asp in the blood are able to bypass thebloodbrain barrier through the circumventricular organs or cvo inparticular the adeno and neurohypophysis pituitary gland areas thearcuate nucleus of the hypothalamus and the median eminence regionsare particularly effected cvo areas are not subject to thebloodbrain barrier these areas control the release of gonadotropinwhich controls the release and flux of steroids governing developmentespecially sexual development changes in adult rats which are lesssensitive to glu than humans have been observed after ingesting gluon a chronic basis cycles of several steroids are disrupted bloodlevels of somatostatin are significantly reduced and cyclic releaseof steroids becomes flattened hope this helps dianne murray wcsbeauccscarletoncafrom lindaenetcomcomsubject friend needs advicea friend of mine is having some symptoms and has asked me to postthe following informationa few weeks ago she noticed that some of her hair was startingto fall out she would touch her head and strands of hair wouldjust fall right out by the way she is or years old it continued to occur until she had a bald spot about thesize of a half dollar since that time she has gotten twomore bald spots of the same size other symptoms shesdescribed include several months of an irregular menstrualcycle which is strange for her because she has always beenextremely regular laryngitis every few days she will wakeup one morning and have almost no voice and then the next dayits fine dizzy spells she claims that shes had or very bad dizzy spells early in the morning including one thatknocked her to the ground and general fatigueshe went to a dermatologist first who couldnt find any reasonfor the symptoms and sent her to an internist who suspectedthyroid problems he did the blood work and claims that everythingcame back normal shes very concerned and very confused does anyone have anyideas or suggestions i told her that i thought she shouldsee an endocrinologist does that sound like the right idea by the way in case you are going to askno she has recentlytaken any medications that would cause these symptomsno she hasntrecently changed her hair products and she hasnt gotten a perm coloring or other chemical process that might cause hair to falloutthanks in advance for any helpfrom mmmcupportalcom mark robert thorsonsubject eumemics was eugenics probably within years a new type of eugenics will be possible maybe even sooner we are now mapping the human genome we will then start to work on manipulation of that genome using genetic engineering we will be able to insert whatever genes we want no breeding no hybrids etc the ethical question is should we do this should we make a race of diseasefree longlived arnold schwartzeneggermuscled supermen even if we canprobably within years it will be possible to disassemble andreassemble our bodies at the molecular level not only will flawlesscosmetic surgery be possible but flawless cosmetic psychosurgerywhat will it be like to store all the prices of shelfpriced barcodedgoods in your head and catch all the errors they make in the storesfavor at safeway what will it be like to mentally edit and spellcheck your responses to the questions posed by a phone caller sellingvacation timeshare optionsindeed we are today a nation at risk the threat is not from bad genesbut bad memes memes are the basic units of culture as opposed to geneswhich are the units of geneticswe stand on the brink of new memeamplification technologies harmfulmemes which formerly were restricted in their destructive power willrun rampant over the countryside laying waste to the real benefits thatfuture technology has to offerfor example jeremy rifkin has been busy trying to whip up emotionsagainst the new genetically engineered tomatoes under development atcalgene this guy is inventing harmful memes a virtual memetic typhoidmarywe must expand the publichealth laws to include quarantine of peoplewith harmful memes they should not be allowed to infect other peoplewith their memes against geneticallyengineered food electromagneticfields and the space shuttle solid rocket boostersfrom nyedacnsvaxuwecedu david nyesubject re need advice with doctorpatient relationship problemreply to mcovingtaisunaiugaedu michael covington sounds as though his hearts in the right place but he is not adept atexpressing it what you received was meant to be a profound apologyapologies delivered by overworked shy people often come out like that the guy didnt sound too shy to me he sounded like a jerk i say ditchhim for someone more knowledgeable and empathetic david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom mhollowaicsunysbedu michael hollowaysubject re science and methodology was homeopathy traditionin article cjodhignewshawaiiedu ladyuhunixuhcchawaiiedu lee lady writesfurthermore the big bucks approach to science promotes what i think isone of the most significant errors in science choosing to investigatequestions because they can be readily handled by the currentlyfashionable methodology or because one can readily get institutionalor corporate sponsorship for them instead of directing attention tothose questions which seem to have fundamental significanceshades of james watson thats exactly the way many workers have describedtheir misgivings about the human genome project if you take a rigid definition of scientific research the mere accumulation of data is not doing science one of the early arguments against the project were that the resources would be better used to focus on specific geneticsrelated problems rather than just going off and collecting maps and sequence the project cant be so narrowly defined or easily described now thoughfrom mckayalcorconcordiaca john mckaysubject lasers for dermatologistshaving had limited tinea pedis for more than years and findingit resistant to all creams and powders i have tried i wonder whydermatologists do not use lasers to destroy the fungus it wouldseem likely to be effective and inexpensive are there good reasonsfor not using lasersi was told that dermatology had not yet reached the laser agejohn mckayvaxconcordiaca deep ideas are simple odd groups are even even simples are notfrom mjliucsienctuedutw mingzhou liusubject h e l p m e desperate with some vdi have bad luck and got a vd called granuloma ingunale which involvesthe growth of granules in the groin i found out about it by checking medicinebooks and i found the prescriptions and i know i can just go to a clinic toget it cured but unfortunately i am serving my duty in the army right now andi think its impossible to prevent anyone from knowing this if i take leaves every day for two weeks for treatment thus i bought the prescribed tabletsat some drugstore but to cure it i must get injection of streptomycin witha dose of g every hours for at least days i can probably buy the tools and this solution somewhere but i dont know how to do injection by myselfcan any kind people here tell meif its possible to do it can i do it on my arm or it must be done on the hiponly any info is welcome and please write me or post your help soon i amalready taking the tablets and i cant waitplease dont flame me for posting this and dont judge me ive learned a lesson and all i need now is real medical helpdesperate from taipei from ronrothrosecom ron rothsubject selective placebo from romdasuclinkberkeleyedu ella i baff writesjb rr i dont doubt that the placebo effect is alive and well withjb rr every medical modality estimated by some to be around jb rr but why would it be higher with alternative versus conventionaljb rr medicinejb jb because most the the time closer to in my experience there is nojb substance to the alternative intervention beyond the good intentions of thejb practitioner which in itself is quite therapeutic jbjb john badanes dc cajb romdasuclinkberkeleyedu well if thats the case in your practice i have a hard time figuring out how you even managed to make it into the bottom half of your class or did you create your diplomas with crayons if someone runs a medical practice with only a success rate they either tackle problems for which they are not qualified to treat or they have no conscience and are only in business for fraudulent purposes otoh who are we kidding the new england medical journal in ran the heading ninety percent of diseases are not treatable by drugs or surgery which has been echoed by several other reports no wonder mds are not amused with alternative medicine since the magic of the placebo effect would award alternative practitioners twice the success rate of conventional medicine ron rosereader p purranoia the fear your cat is up to something rosemail usenet rose media hamilton from ronrothrosecom ron rothsubject scientific yawn gordon rubenfeld responds to ron rothgr ronrothrosecom ron roth wrotegrgr rr well gordon i look at the results not at anyones scientificgr rr stamp of approvalgr gr if you and your patients followers are convinced as youve writtengr by your methods of uncontrolled undocumented unreported unsubstantiatedgr subjective endpoint research great but why should the rest of us care gordon even if you are trying to beat this issue to death youll never get more than a stalemate out of this one i have never tried to force my type of medicine on any of you why should i my patients are happy im happy you and your peers seem to be the only miserable ones around bemoaning the steady loss of patients to the alternative camp just look at europe there has been a steady exodus from synthetic medicine for over a decade now and itll be just a matter of time before more people on this continent will abandon their drug and white coat worship as well and visit different doctors for different needsgr you see ron the point isnt whether you and your patients aregr convinced that whatever it is you do works its whether what you do isgr more effective in similar cases of whatever it is you think you aregr treating than cupping bloodletting and placebo this is very interesting i have come exactly to the same conclusions but in regards to conventional medicine you see i dont just treat little old ladies that wouldnt know any different of what is being done but a bulk of my patients consist of teachers lawyers judges nurses accountants university graduates and various health practitioners if these people have gotten results with my method after having been unsuccessful with yours or their own i certainly wouldnt lose any sleep over whether you or your peers approve of my treatments lets face it with all the blunders committed by scientific mds over the years i know a lot of people who hold your scientific method in much lower esteem than they hold minegr as far as we know ayurveda crystals homeopathy ron rothgr which may all equal placebo administered with appropriategr trappings sorry but im not familiar or interested with what appears to be new age medicine ayurveda crystals with the exception of homeo pathy of which i took a course but gordon you already knew that you just wanted to make my system look a bit more far out right i use homeopathy very little since my cellular test emr is hard to beat for accuracy and minerals are more predictable while homeopathy does have a problem with reliability especially in acute conditions an exception perhaps are homeopathic nosodes which act fairly quickly and are more dependable in certain viral or bacterial situations gr my colleagues and i spend hours debating study designgr and results even of therapies currently accepted as standardgr as good well adequate scientists we are prepared if gr presented with appropriate data to abandon our most deeply held gr beliefs in favor of new ideas i have met the challenges of hundreds of sceptics by verifying the accuracy of measuring their mineral status to their total satisfac tion in other words everyone involved is happy if you were to cook a meal would you worry over whether everyone in this world would find it to their liking or only those that end up eating it since i have financed every research project that i have undertaken entirely myself i dont need to follow any of your rules or guide lines to satisfy any aspects of a grant application which you may have to neither am i concerned of whether or not my study designs meet your or anyone elses criteria or acceptance gr sorry ron if conviction were the ruler of truth a flat earth wouldgr still be the center of the universe and epilepsy a curse of the gods i think there would be more justification for an uneducated person growing up in an uncivilized environment to believe in a flat earth than for a civilized well educated and scientifically trained mind to follow the doctrine of evolution genetic engineering of course is now the final frontier to show god how it is properly done now weve become capable of creating our own paradise and give disease and god the boot right but just before we get rid of him for good perhaps he could leave us some pointers on how to solve a couple of tiny problems such as war poverty racism crime riots substance abuse and one last thing could he also give us a hint on how to control natural disasters the weather and last but not least peace ron rosereader p the lab called your brain is ready rosemail usenet rose media hamilton from ronrothrosecom ron rothsubject selective placebot russell turpin responds to article by ron rothtt r i dont doubt that the placebo effect is alive and well witht r every medical modality estimated by some to be around t r but why would it be higher with alternative versus conventional t r medicinet t how do you know that it is if you could show this by careful t measurement i suspect you would have a paper worthy of publicationt in a variety of medical journals t t russell if you notice the question mark at the end of the sentence i was addressing that very question to that person who has a dog named sugar and a few other people who seem to be of the same opinion i would love to have anyone come up with a study to support their claims that the placebo effect is more prevalent with alternative compared to conventional medicine perhaps the study could also include how patients respond if they are dissatisfied with a conventional versus an alternative doctor ie which practitioner is more likely to get punched in the face when the success of the treatment doesnt meet the expectations of the patient ron rosereader p when in doubt make it sound convincing rosemail usenet rose media hamilton from turpincsutexasedu russell turpinsubject re eumemics was eugenicscrossposted and with followups directed to talkpoliticstheoryin article cupportalcom mmmcupportalcom mark robert thorson writes indeed we are today a nation at risk the threat is not from bad genes but bad memes memes are the basic units of culture as opposed to genes which are the units of genetics we must expand the publichealth laws to include quarantine of people with harmful memes in other words we should jail people who say the wrong things in this advocacy we can see a truly ugly memedoes mark robert thorson advocate jailing himselfrussellfrom turpincsutexasedu russell turpinsubject re h e l p m e desperate with some vdin article aprdebbieccnctuedutw mjliucsienctuedutw mingzhou liu writes i have bad luck and got a vd called granuloma ingunale which involves the growth of granules in the groin i found out about it by checking medicine books and i found the prescriptions mingzhou lius main problem is that he has an incompetentphysician himself this physician has diagnosed a problemeven though he probably has never seen the diagnosed diseasebefore and has no idea of what kinds of problems can presentsimilar symptoms this physician now wants to treat his firstcase of this disease without any help from the medical communitythe best thing mingzhou liu could do is fire his currentphysician and seek out a better onerussellfrom rsilverworldstdcom richard silversubject barbecued foods and health risksome recent postings remind me that i had read about risks associated with the barbecuing of foods namely that carcinogens are generated is this a valid concern if so is it a function of the smoke or the elevated temperatures is it a function of the cooking elements wood or charcoal vs lava rocks i wish to know more thanks from nyedacnsvaxuwecedu david nyesubject re post polio syndrome information needed please reply to keithactrixgennz keith stewart my wife has become interested through an acquaintance in postpoliosyndrome this apparently is not recognised in new zealand and differentsymptons eg chest complaints are treated separately does anone haveany information on it it would help if you and anyone else asking for medical information onsome subject could ask specific questions as no one is likely to typein a textbook chapter covering all aspects of the subject if you arelooking for a comprehensive review ask your local hospital librarianmost are happy to help with a request of this sort briefly this is a condition in which patients who have significantresidual weakness from childhood polio notice progression of theweakness as they get older one theory is that the remaining motorneurons have to work harder and so die sooner david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom kmkybpghpaus ken mitchumsubject re how about a crash program in basic immunological researchin article cgkwuvmdwustledu cgkwuvmd gary kronk writes i have been contemplating this idea for some time as well i am not a doctor but my wife is a nurse and i know a lot of doctors and nurses the point here being that doctors and nurses do not seem to get sick nearly as much as people outside the medical professionthis is a lovely area for anecdotes but i am sure you are on to somethingas a physician i almost never get sick usually when something horrendousis going around i either dont get it at all or get a very mild casewhen i do get really sick it is always something unusualthis was not the situation when i was in medical school particularly onpediatrics i never had younger siblings myself and when i went on thepediatric wards i suddenly found myself confronting all sorts of infectiouschallenges that my body was not ready for pediatrics for me was three solidmonths of illness and i had a temp of when i took the final exami think what happens is that during training and beyond we are constantlyexposed to new things and we have the usual reactions to them so that lateron when challenged with something it is more likely a reexposure for usso we deal with it well and get a mild illness i dont think it is thatthe immune system is hyped up in any way also dont forget that thehospital flora is very different from the home and we carry a lot of thataroundkmfrom mhollowaicsunysbedu michael hollowaysubject re science and methodology was homeopathy traditionin article aprcsrochesteredu fulkcsrochesteredu mark fulk writesin article ckvpjmunxsascom sasghmtheseusunxsascom gary merrill writesin article aprcsrochesteredu fulkcsrochesteredu mark fulk writeswhat is wrong with the above observation is that it explicitly gives theimpression and you may not in fact hold this view that the common perhapseven the correct approach for a scientist to follow is to sit aroundhaving flights of fancy and scheming on the basis of his jealousies andpetty hatredsflights of fancy and other irrational approaches are common the crucialthing is not to sit around just having fantasies they arent of any useunless they make you do some experiments ive known a lot of scientistswhose fantasies lead them on to creative work usually they wont admitout loud what the fantasy was prior to the consumption of a few beersthe danger in philosophizing about science is that theory and generalization can end up being far removed from the actual daytoday of the grunt at thebench yes its great to be involved in a process were i can walk into thelab after a heavy night of dreaming and just do something for the hell of itas long as my advisor doesnt catch me which is easy enough to do but stamping out such behavior seems to be the purpose in life of grant review committees and the peer review process in general in todays world thats what determines what science is what gets funded and a damn good thing toflights of fantasy just dont have much chance of producing anything at least not in biomedical research the surest way for a graduate student toruin their life is to work in a lab where the boss is more concerned with fleshing out hisher fantasies than with having the student work on a projectthat actually has a good chance of producing some results mds seem to be particularly prone to this aberrant behavior simple example warren jelinek noticed an extremely heavy band on a dnaelectrophoresis gel of human alu fragments he got very excited hoping thathed seen some essential part of the control mechanism for eukaryoticgenes this fantasy led him to sequence samples of the band and carry outbinding assays the result was a wellconserved or so bp sequencethat occurs about times in the human genome unfortunately forwarrens fantasy it turns out to be a transposon that is present inso many copies because it replicates itself and copies itself back intothe genome on the other hand the characteristics of transposons weremuch elucidated the necessity of a cellular reverse transcriptase wasrecognized and the standard method of recognizing human dna was createdother species have different sets of transposons fortunately for mewarren and i used to eat dinner at tgi fridays all the timei have to agree with gary merrills response to this ive read alot of thealu and middle repetitive sequence work and its really very interesting good work with implications for many fields in molecular genetics its really an example of how a well reasoned project turned up interesting results that were unexpectedmikefrom jeffpvetmedwsuedu jeff parkesubject re lyme vaccinekathleen richards kiltyucrengr wrote my nearly year old pomeranian had a nasty reaction to this vaccination suffice it to say we will not vaccinate her for lyme disease again shes been camping through some states and has backpacked with us as well and we are used to watching for ticks and dealing with them and we simply wont take her to really active lyme disease areasnot to drag this out anymore butmany veterinarians feel that lyme disease in dogs is so easy to treat thatin an endemic area they often just give the appropriate antibiotics to dogspresenting with lameness swollen joints fevera recent paper march has finally established that lyme disease in dogscan be reproduced in a controlled experimentaly setting this has beenan ellusive matter for researchers and is one of the fundamental requirementsfor many to acknowledge an agent as being causitive of a particular diseaseup to now only the vaccine manufacturer has been able to prove thatthe disease existsthis paper is noteworthy in two other regards none of the animals they infected were treated in any way the dogshad episodes of lameness during a week period which occurred months after exposure after this period none showed any furtherclinical signs up to the month observation period of the study sothese are proven clinically sick lyme patients showing spontaneousrecovery without the benefit of drug treatment of course observationslonger than months will be necessary to be sure the disease doesnthave the same chronicity that some see in humans the addendum to the paper calls into question the techniques used by thevaccine manufacturer to validate the vaccine of course they wantthe world to use the model they developed in order to test vaccineefficacyanyway maybe we will see some independent scientifically sound evaluationsof this vaccine in the next year or sojeff parke jeffppgavinvetmedwsuedualso jeffpwsuvmbitnet aol jeffparkewashington state university college of veterinary medicine class of pullman wa from kflaccessdigexcom keith f lynchsubject re my new diet it works great in article pittuucp gebcspittedu gordon banks writes keith is the only person i have ever heard of that keeps the weight off without any conscious effort to control eating behavior most of us have to diet a lot to keep from going back to morbid obesityi attribute my success to several factorsvery low fat except when someone else has cooked a meal for mei only eat fruit vegetables and whole grain or bran cereals iestimate i only get about to percent of my calories from fatvery little sugar or saltvery high fiber most americans get about grams to arerecommended i get between and sometimes ive heardof people taking fiber pills it seems unlikely that pills cancontain enough fiber to make a difference it would be about aslikely as someone getting fat by popping fat pills tablets arejust too small unless you snarf down hundreds of them dailymy clean your plate conditioning works for me eating the last takes half my eating time and gives satiety a chance to catchup so i dont still feel hungry and go start eating something elsei dont eat when im not hungry unless im sure ill get hungryshortly and eating wont be practical theni bike to work miles a day year round fast i also bike tostores movies and everywhere else as ive never owned a cari estimate this burns about calories a day it also helpsbuild and maintain muscle mass prevent insulin resistance diabetesruns in my family and increase my metabolism even so mymetabolism is so low that when im at rest im most comfortablewith a temperature in the s f and usually wear a sweater ifit drops to cycling also motivates me to avoid every excessounce cyclists routinely pay a premium for cycling products thatweigh slightly less than others but its easier and cheaper to trimweight from the rider than from the vehicletheres no question in my mind that my metabolism is radicallydifferent from that of most people who have never been fat fortunatelyit isnt different in a way that precludes excellent healthobviously i cant swear that every obese person who does what ivedone will have the success i did but ive never yet heard of one whodid try it and didnt succeed i think all of us cycle ones success depends on how large the fluctuations in the cycle are some people can cycle only poundsim sure everyones weight cycles whether or not theyve ever been fati usually eat extremely little salt when i do eat something saltymy weight can increase overnight by as much as ten pounds it comesoff again over a week or two keith lynch kflaccessdigexcomf p s q x f f qffpq s qpf wq pxfrom amigancupportalcom mike medwidsubject re emphysema questionthanks to all who replied to my initial question ive been away in new jersey all week and was surprised to see all the responseswhen i got back to the person asking about nicotine patches there are four on themarkethabitrol ciba pharmaceuticalsnicoderm marion merill dow alza madenicotrol warner lambert cygnus madeprostep made by elan and marketed by from mmmcupportalcom mark robert thorsonsubject re foodrelated seizuresi remember hearing a few years back about a new therapy for hyperactivitywhich involved aggressively eliminating artificial coloring and flavoringfrom the diet the theory which was backed up by interesting anecdotalresults is that certain people are just way more sensitive to thesechemicals than other people i dont remember any connection being madewith seizures but it certainly couldnt hurt to try an allnatural dietfrom mmmcupportalcom mark robert thorsonsubject re what are the problems with nutrasweet aspartamephenylketonuria is a disease in which the body cannot process phenylalanineit can build up in the blood and cause seizures and neurological damagean odd side effect is that the urine can be deeply colored like red winepeople with the condition must avoid nutrasweet chocolate and anythingelse rich in phenylalanineaspartame is accused of having caused various vague neurological symptomspat robertsons program theclub was beating the drum againstaspartame rather vigorously for about a year but that issue seems tohave been pushed to the back burner for the last year or so apparentlythe evidence is not very strong or pat would still be flailing awayfrom dyerspdcccom steve dyersubject re is msg sensitivity superstitionin article qnnslagateberkeleyedu sppzabriskieberkeleyedu steve pope writesthe mass of anectdotal evidence combined with the lack ofa properly constructed scientific experiment disprovingthe hypothesis makes the msg reaction hypothesis themost likely explanation for eventsyou forgot the smileyfacei cant believe this is what they turn out at berkeley tell meyoure an aberration steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom youngserumkodakcom rich youngsubject re blood glucose test stripsin article apromenuucp cafomenuucp chuck forsberg wakgx writesin article aprclpdkodakcom youngserumkodakcom writeshuman glucose mgdl fasting are these numbers for whole blood or plasmaserum actually but plasma numbers are the same whole bloodnumbers for humans tend to be somewhat lower roughly to percent lower i find the following range for whole blood infundamentals of clinical chemistry n w teitz editor w bsaunders human glucose whole blood fasting levels mgdlwhich are the strips calibrated for obviously they measure whole bloodindeed they do measure whole blood levels although they are notas accurate as a serum test done in a laboratory one problem isthat cells in the sample continue to metabolize glucose after thesample is drawn reducing the apparent level according to teitzhowever results compare reasonably well with laboratory resultsalthough values below mgdl tend to be lower with strip testswhereas values above mgdl can be very erraticwhat is the conversion factor between human plasma glucose andwhole blood pin prick glucose concentrationas stated above whole blood levels tend to be roughly to percent lower than serum levels sample freshness will affectwhole blood levels however i dont believe there is a welldefined conversion factor since cell metabolism will affectsamples to varying degrees the serumplasma test is much preferred for any except general ball park testingrich young these are not kodaks opinionsfrom wcsbeaualfredcarletonca opirgsubject re is msg sensitivity superstitionin article aprspdcccom dyerspdcccom steve dyer writesin article aprcunewscarletoncawcsbeaualfredcarletonca opirg writesmaybe you missed it amidst the flurry of responsesyou mean the responses some of which pointed to doubleblind testswhich show no such chinese restaurant effect unique to msgits elicited by the placebo as wellmany people responded with more anecdotal stories i think its safe tosay the original poster is already familiar with such storiespresumably he wants hard info to substantiate or refute claims aboutmsg making people ill similarly debunking such claims without doing research whetherliterature and lab is equally beside the point the original posterno doubt already knows that some people think chinese restaurantsyndrome is bogusplacebos are all very interesting but irrelevant to the question ofwhat effects msg has you could have real effects and placeboeffects people may have allergies in addition yet again the use of thisnewsgroup is hampered by people not restricting their posts to mattersthey have substantial knowledge oflike youself someone who can read a scientific paper and apparentlycome away from it with bizarrely cracked ideas which have nothing todo with the use of this substance in human nutritionhave you read olneys work i fail to see how citing results frompeerreviewed studies qualifies as bizarrely crackedfor cites on msg look up almost anything by john w olney atoxicologist who has studied the effects of msg on the brain and ondevelopment it is undisputed in the literature that msg is anexcitotoxic food additiveno its undisputed in the literature that glutamate is an amino acidwhich is an excitatory neurotransmitter there is also evidence thatexcessive release of glutamate may be involved in the pathology of certainconditions like stroke drowning and lou gehrigs disease just to name a fewthis is a completely different issue than the use of this ubiquitous amino acidin foods people are not receiving intraventricular injections of glutamatetests have been done on rhesus monkeys as well i have never seen astudy where the mode of administration was intraventricular the gluand asp were administered orally some studies used iv and scintraventricular is not a normal admin method for food tox studiesfor obvious reasons you must not have read the peerreviewed worksthat i referred to or you would never have come up with this braininjection bunktoo much in the diet and the system gets thrown offsez you such an effect in humans has not been demonstrated in anycontrolled studies infant mice and other models are useful as faras they go but theyre not relevant to the matter at hand which isnot to say that i favor its use in things like baby fooda patentlyridiculous use of the additive but we have no reason to believethat msg in the diet effects humans adverselypardon me but where are you getting this from have you read thejournals have you done a thorough literature searchbut youre right mice arent the best to study this on theyre fourtimes less sensitive than humans to msgglutamate and aspartate also an excitotoxin are necessary insmall amounts and are freely available in many foods but the amountsadded by industry are far above the amounts that would normally beencountered in a ny single foodwrong do you know how much aspartate or phenylalanine is in a soft drinkmilligrams worth compare that to a glass of milk do you know how muchglutamate is present in most proteincontaining foods compared to thatadded by the use of msgthe point is exceeding the window of course theyre amino acidsnote that people with pku cannot tolerate any phenylalanineolneys research compared infant human diets specifically the amountof freely available glu in mothers milk versus commercial baby foodsvs typical lunch items from the standard american diet such as packagedsoup mixes he found that one could exceed the projected safety marginfor infant humans by at least fourfold in a single meal of processedfoods mothers milk was well below the effective doseread olneys review paper in prog brain res and check hissources they are impecable there is no disputeimpeccable there most certainly is a disputebetween who over what i would be most interested in seeing youprovide peerreviewed nonfoodindustryfunded citations to articlesdisputing that msg has no effects whatsoever steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerhmm com why am i not surprised dianne murray wcsbeauccscarletoncafrom hbloommooseuvmedu heathersubject re what are the problems with nutrasweet aspartamenutrasweet is a synthetic sweetener a couple thousand times sweeter thansugar some people are concerned about the chemicals that the body produces when it degrades nutrasweet it is thought to form formaldehyde and known tofor methanol in the degredation pathway that the body uses to eliminate substances the real issue is whether the levels of methanol and formaldehydeproduced are high enough to cause significant damage as both are toxic toliving cells all i can say is that i will not consume it phenylalanine isnothing for you to worry about it is an amino acid and everyone uses smallquantities of it for protein synthesis in the body some people have a diseaseknown as phenylketoneurea and they are missing the enzyme necessary to degrade this compound and eliminate it from the body for them it will accumulate in the body and in high levels this is toxic to growing nervecells therefore it is only a major problem in young children until aroundage or so or women who are pregnant and have this disorder it used tobe a leading cause of brain damage in infants but now it can be easily detected at birth and then one must simply avoid comsumption of phenylalanineas a child or when pregnant heatherfrom dyerspdcccom steve dyersubject re foodrelated seizuresin article cupportalcom mmmcupportalcom mark robert thorson writesi remember hearing a few years back about a new therapy for hyperactivitywhich involved aggressively eliminating artificial coloring and flavoringfrom the diet the theory which was backed up by interesting anecdotalresults is that certain people are just way more sensitive to thesechemicals than other people i dont remember any connection being madewith seizures but it certainly couldnt hurt to try an allnatural dietyeah the feingold diet is a load of crap children diagnosed with addwho are placed on this diet show no improvement in their intellectual andsocial skills which in fact continue to decline of course the parentswho are enthusiastic about this approach lap it up at the expense of theirchildrens development so much for the value of interesting anecdotalresults people will believe anything if they want to steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom ladyuhunixuhcchawaiiedu lee ladysubject re science and methodology was homeopathy traditionin article clwsjnunxsascom sasghmtheseusunxsascom gary merrill writesin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes flights of fancy and other irrational approaches are common the crucial thing is not to sit around just having fantasies they arent of any use unless they make you do some experiments simple example warren jelinek noticed an extremely heavy band on a dna electrophoresis gel of human alu fragments he got very excited but why do you characterize this as a flight of fancy or a fantasywhile i am unfamiliar with the scientific context here it appears obviousthat his speculation for lack of a better or more neutral word wasat least in significant part a consequence of his knowledge of and acceptanceof current theory coupled with his observations it would appear thatsomething quite rational was going on as he attempted to fit his observationinto that theory or to tailor the theory to cover the observation whether a scientific idea comes while one is staring out the window ordreaming or having a fantasy or watching an apple fall newton orsitting in a bath archimedes it is ultimately the result of a lot ofintense scientific thinking done beforehand letting ones mind roamfreely and giving rein to ones intuition can be a useful way of comingup with new ideas but only when one has done a lot of rational analysisof the problem first scientific intuition is not something one is born with it is somethingthat one learns maybe we dont understand completely how it is learnedbut training in systematic scientific thinking is certainly one of the key elements in developing it informal exploration is also often an important element in finding newscientific ideas one thinks for instance of darwins naturalisticstudies in the galapagos islands which led him to the ideas for the theory of evolution this is why i am offended by a definition of science that emphasizesempirical verification and does not recognize thinking and informalexploration as important scientific work i agree that mere speculationdoes not deserve to be called science i also think that mere empiricalstudies not directed by good scientific thinking are at best a verypoor kind of science in article qklinnlimucsutexasedu turpincsutexasedu russell turpin writes i think that lee lady and i are talking at cross purposes lady seems concerned with the contrast between greatscience that makes big advances in our knowledge and mediocrescience that makes smaller steps in most of this thread i havebeen concerned with the difference between what is science andwhat is not i dont think that science should be defined in a way that some of theactivities that lead to really important science namely thinking andinformal exploration are not recognized as scientific work in the arguments between behaviorists and cognitivists psychology seems less like a science than a collection of competing religious sects ladyuhunixuhcchawaiiedu ladyuhunixbitnetfrom abfreenetcarletonca robert allisonsubject bursitis and laser treatmentmy family doctor and the physiotherapist pt she sent me to agree that thepain in my left shoulder is bursitis i have an appointment with an orthpodi love that its short for orthopedic surgeon apparently but while imwaiting the pt is treating meshes using hot packs ultrasound and lasers but theres no improvementyet in fact i almost suspect its getting worsemy real question is about the laser treatment i cant easily imagine whatthe physical effect that could have on a deep tissue problem can anyoneshed some light so to speak on the matter robert allisonottawa ontario canadafrom dpcuxacsouiucedu daniel paul checkmansubject re is msg sensitivity superstitiondyerspdcccom steve dyer writesin article qnnslagateberkeleyedu sppzabriskieberkeleyedu steve pope writesthe mass of anectdotal evidence combined with the lack ofa properly constructed scientific experiment disprovingthe hypothesis makes the msg reaction hypothesis themost likely explanation for eventsyou forgot the smileyfacei cant believe this is what they turn out at berkeley tell meyoure an aberration steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyer hey keep your fung flaming out of this group that goes for you mrdyer as well as several other nasty sarcastic people regarding thissubject shoot now im all riled up too and i was just going to ask ifwe can keep our discussion about msg a little more civil blasting a schoolor an idea through simple insults as demonstrated above is not necessaryand otherwise out of line if you want to continue your insult war takeit elsewhere and stop wasting everyone elses timemost sincerelydan checkmanfrom abfreenetcarletonca robert allisonsubject frequent nosebleedsi have between and nosebleeds each week as a result of a geneticpredisposition to weak capillary walls oslerweberrendu fortunatelyeach nosebleed is of short durationdoes anyone know of any method to reduce this frequency my younger brotherseach tried a skin transplant thigh to nose lining but their nosebleedssoon returned ive seen a reference to an herb called rutin that issupposed to help and id like to hear of experiences with it or othertechniques robert allisonottawa ontario canadafrom brennerldgocolumbiaedu carl brennersubject re update help was what is this is it lymesin article pittuucp gebcspittedu gordon banks writes in article aprlamontldgocolumbiaedu brennerldgocolumbiaedu carl brenner writes see the ulterior motive here it is easy for me to see it the those physicians who call everything lyme and treat everything there is a lot of money involved you keep bringing this up but i dont understand whats in it financially for the physician to go ahead and treat unless the physician has an investment in or is involved in some kickback scheme with the home infusion company where is the financial gain for the doctor well let me put it this way based on my own experience a general practitioner with no training in infectious diseases by establishing links to the lyme community treating patients who come to him wondering about lyme or having decided they have lyme as if they did saying that diseases such as ms are probably spirochetal if not lyme giving talks at meetings of users groups validating the feelings of even delusional patients etc this gp can go from being a runofthemill kyr gp to someone with lots of patients in the hospital and getting expensive infusions that need monitoring in his office and making lots of bread also getting the adulation of many who believe his is their only hope if not of cure then of control and seeing his name in publications put out by support groups etc this is a definite temptationharumph getting published in these newsletters is hardly somethingto aspire to i cant really argue with your logic though i think you may beextrapolating a bit recklessly from what appears to be a sample size ofone even if what you say about this local pittsburgh guy is true it isnot logical or fair to conclude that this is true of all doctors whotreat lyme diseaseby your logic i could conclude that all of the physicians whoconsult for insurance companies and make money by denying benefits tolyme patients are doing it for the money rather than because they believethey are encouraging good medicine i have no idea how sincere these guysare but their motives are as suspect as the physicians you excoriate forwhat you believe to be indiscriminate treatmenti would really feel more comfortable discussing the medical issuesin lyme rather than speculating as to the motives of the various partiesinvolved gordon banks njxp skepticism is the chastity of the intellect and gebcadredslpittedu it is shameful to surrender it too soon carl brennerfrom mhollowaicsunysbedu michael hollowaysubject transplant recipients newsletter april dddddddddddddddddddddinternational newsletter april this will be the first of monthly postings of the newsletter of the long island chapter of the transplant recipients international organization trio unfortunately i was unable to post it before the date of this months meeting im posting it anyway and posting it worldwide instead of regional in the hopes that some of the information may be useful or illustrative also i hope it can be used as an example and inspiration for the posting of other newsletters and data related to organ transplantation and donation miketransplant recipientsinternational organizationlong island chapterpo box huntington ny newsletter april volume iv no next meetingthe next meeting is wednesday april at pm at the knights of columbus emerald manor uniondale avenue in uniondale our guest speaker will be dr lewis teperman dr teperman trained in pittsburgh under dr starzl and is now the assistant director of the liver transplant program at new york university medical center dr teperman will discuss current trends in transplantation and treatment and will answer questions he is a long time friend of trio surgeon to many of our members and always a gracious and delightful guest it is sure to be a very informative interesting and engaging evening our hospitality committee bette and vito suglia and jim spence will be well prepared and at last the weather should be cooperative we hope to see a very large gathering to welcome dr teperman wednesday april k of c uniondalelast meetingit has been noted here before that the long island chapter of trio has extraordinary power in predicting bad weather being able to forecast rain sleet and snow fully a month in advance no tv weatherman can match us this time we not only scored again but we were also able to disable the long island railroad making travel really difficult none the less many braved the snow and we had an interesting meeting and good conversation our scheduled speaker mrs elizabeth linnehan a professional nutritionist had a family emergency and was not able to attend she hope she will be with us in the fall to discuss diet and medications however ms jennifer friedman an image consultant and sister of a liver transplant recipient was kind enough to step in on very short notice ms friedman gave us a lot of good advice about choosing clothes and makeup even a bit for men to help us look well and healthy and to minimize some of the cosmetic effects of some of the medicine and drugs we take we are most grateful to jennifer and thank her for an entertaining eveningannual meetingin addition to welcoming dr teperman the april meeting is also the annual meeting of the chapter this is the official notice of the meeting as required by our bylaws the main purpose of the meeting is to review the past year solicit member views and ideas for better ways to meet their needs and to elect members of the board of directors for the coming two year term the nominating committee has prepared the following slate for the board anne liver recipient and don treffeisen robert heart recipient and eulene smith vito kidney recipient and bette suglia kay grenzig liver recipient jan schichtel kidney recipient larry juliano kidney recipient david bekofsky director public education litpthose remaining on the board for another year are robert carroll liver kidney pancreas recipient jerry kidney recipient and jeanne eichhorn ron kidney donor and marie healy peter smith bone marrow recipient patricia ann yankus kidney and pancreas recipient walter ruzak kidney recipientthis may seem to be a big board but many hands make light work and with our various medical uncertainties it is good to have backups for all the jobs on the board therefore in addition to the slate being presented for voting nominations will also be accepted from the floor there is no set number of board members and there is plenty of work in addition brief treasurers and membership reports will be given and the floor will be open for any new business suggestions or comments anyone would like to bring upwe will keep the formal meeting short so that we can spend the majority of the time with dr tepermanfuture meetingsremember the scheduled guests for the rest of the year may dr peter shaprio chief of psychiatry columbia presbyterian medical center june dr felix rappaport director of the stony brook kidney transplant program plan on being with us the second wednesday of each monthnotdawthe week of april is national organ and tissue donor awareness week notdaw while we are planning news releases speaking engagements and meetings with supervisors gullata and gaffney we have decided not to have our softball game because of two years experience with miserable weather we all can help spread the word on donor awareness however we have found it effective to ask your pastor or rabbi to publish a letter or announcement in the parish bulletin allow you to address the congregation or include mention of the gift of life in his sermon attached to this newsletter is a sample letter and fact sheet you can use thank youdr starzl to be honored the long island chapter of the american liver foundation will hold its annual auction and dinner dance on may th at the fountainbleu on jericho turnpike in jericho dr thomas starzl will be the honored guest tickets are person and are going fast if youd like to meet dr starzl call anne treffeisen at for detailsmembership news congratulations to al reese al received his heart transplant in pittsburgh after waiting years he is home and doing well after only days in hospitalarthur michaels liver recipient is planning to run the boston marathon in april what fantastic proof that transplantation works we hope the national press notices bob mccormack after a persistent bout with infection had his transplanted kidney removed he is home now back on dialysis and feeling better nicole healy kidney recipient and daughter of ron and marie spent the past several weeks in hospital in miami with problems encountered on vacation marie has been with her in florida they are back in new york where nicoles treatment will continue we wish nicole a speedy recovery kay grenzig liver recipient is mending now after a bad fall that resulted in a broken arm and a broken leg kay is a candidate for the board so we need her well soon and best wishes to all coming out of the flu it was a tough winter for many but the tulips are just under the snowsee youwednesday april pm k of c uniondale dr lewis tepermanfrom dyerspdcccom steve dyersubject re what are the problems with nutrasweet aspartamein article apruvmedu hbloommooseuvmedu heather writesnutrasweet is a synthetic sweetener a couple thousand times sweeter thansugar some people are concerned about the chemicals that the body produces when it degrades nutrasweet it is thought to form formaldehyde and known tofor methanol in the degredation pathway that the body uses to eliminate substances the real issue is whether the levels of methanol and formaldehydeproduced are high enough to cause significant damage as both are toxic toliving cells all i can say is that i will not consume it aspartame is the methyl ester of a dipeptide so a product of itshydrolysis is going to be methanol which can then be oxidized toformaldehyde the amounts of methanol formed from the ingestion ofaspartamecontaining foods are completely in the metabolic noisesince youre forming equally minute amounts of methanol from othercomponents of food all the time in studies involving administrationof high doses of the additive blood methanol levels were undetectablemethanol is a poison only in quantities seen in human poisoningssay ml and above this is a consequence of its oxidation to formaldehydeand formic acid two quite reactive compounds which at high enough levelscan damage tissues like the retina and kidney because at such high dosesthe bodys detoxification system is overwhelmed interestingly onetreatment for early methanol poisoning is to get the person drunk onethyl alcoholvodka or an equivalent thats because ethanol ismetabolized preferentially over methanol by the enzymes in the liverif the methanol stays as methanol and isnt metabolized to formaldehydeit is actually relatively nontoxic steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom dyerspdcccom steve dyersubject re is msg sensitivity superstitionin article aprcunewscarletonca wcsbeaualfredcarletonca opirg writesmany people responded with more anecdotal stories i think its safe tosay the original poster is already familiar with such storiespresumably he wants hard info to substantiate or refute claims aboutmsg making people ill there has been no hard info provided about msg making people illthats the point after alllike youself someone who can read a scientific paper and apparentlycome away from it with bizarrely cracked ideas which have nothing todo with the use of this substance in human nutritionhave you read olneys work i fail to see how citing results frompeerreviewed studies qualifies as bizarrely crackedthats because these peerreviewed studies are not addressingthe effects of msg in people theyre looking at animal modelsyou cant walk away from this and start ranting about gloom anddoom as if there were any documented deleterious health effectsdemonstrated in humans note that i wouldnt have any argumentwith a statement like noting that animal administration has produced the following blah blah we must be careful about itsuse in humans this is precisely not what you saidtests have been done on rhesus monkeys as well i have never seen astudy where the mode of administration was intraventricular the gluand asp were administered orally some studies used iv and scintraventricular is not a normal admin method for food tox studiesfor obvious reasons you must not have read the peerreviewed worksthat i referred to or you would never have come up with this braininjection bunkit most certainly is for neurotoxicology you know studies ofglutamate involve more than food sciencepardon me but where are you getting this from have you read thejournals have you done a thorough literature searchso point us to the studies in humans please im familiar withthe literature and ive never seen any which relate at all toolneys work in animals and the effects of glutamate on neuronsthe point is exceeding the window of course theyre amino acidsnote that people with pku cannot tolerate any phenylalaninewell actually they have to tolerate some phenylalanine its aessential amino acid they just try to get as little as is healthywithout producing dangerous levels of phenylalanine and its metabolitesin the bloodolneys research compared infant human diets specifically the amountof freely available glu in mothers milk versus commercial baby foodsvs typical lunch items from the standard american diet such as packagedsoup mixes he found that one could exceed the projected safety marginfor infant humans by at least fourfold in a single meal of processedfoods mothers milk was well below the effective dosegoodness im not saying that its good to feed infants a lot ofglutamatesupplemented foods its just that this projected safetymargin is a construct derived from animal models and given thatyou can prove anything you like were talking prudent policy ininfant nutrition here yet youre misrepresenting it as received wisdomread olneys review paper in prog brain res and check hissources they are impecable there is no disputeimpeccable there most certainly is a disputebetween who over what i would be most interested in seeing youprovide peerreviewed nonfoodindustryfunded citations to articlesdisputing that msg has no effects whatsoever you mean asserting youre being intellectually dishonest or justplain confused because youre conflating reports which do not necessarilyhave anything to do with each other olneys reports would argue a potentialfor problems in human infants but thats not to say that this says anythingwhatsoever about the use of msg in most foods nor does he provide anystudies in humans which indicate any deleterious effects for obviousreasons it says nothing about msgs contribtion to the phenomenonof the chinese restaurant syndrome it says nothing about the frequentinability to replicate anecdotal reports of msg sensitivity in the labdyerursamajorspdcccom hmm com why am i not surprised dianne murray wcsbeauccscarletoncaprobably one of the dumber remarks youve made steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom dyerspdcccom steve dyersubject re frequent nosebleedsin article aprfreenetcarletonca abfreenetcarletonca robert allison writesdoes anyone know of any method to reduce this frequency my younger brotherseach tried a skin transplant thigh to nose lining but their nosebleedssoon returned ive seen a reference to an herb called rutin that issupposed to help and id like to hear of experiences with it or othertechniquesrutin is a bioflavonoid compounds found among other places in therinds of citrus fruits these have been popular especially in europeto treat capillary fragility and seemingly in even more extreme casesa few months ago a friend was visiting from italy and he said that hedhad hemorrhoids but his pharmacist friend sold him some pills incredulouslyi asked to look at them and sure enough these contained rutin as the activeingredient i probably destroyed the placebo effect from my skepticalsputtering i have no idea how hes doing hemorrhoidwise these daysthe studies which attempted to look at the effect of these compounds inhuman disease and nutrition were never very well controlled so thereports of positive results with them is mostly anecdotalthis stuff is pretty much nontoxic and probably inexpensive so thereslittle risk of trying it but i wouldnt expect much of a result steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom lundbyrtsgmotcom walter f lundbysubject re is msg sensitivity superstitionis there such a thing as msg monosodium glutamate sensitivitysuperstition anybody here have experience to the contrary as a person who is very sensitive to msg and whose wife and kids aretoo i want to know why the food industry wants to put msg in foodsomebody in the industry give me some reasons why is it an industrial byproduct that needs getting get rid ofis it to cover up the fact that the recipes are not very good or the food is poor qualitydo some of you get a sadistic pleasure out of making some of us sickdo the taste testers have some defect in their flavor sensors mouth etc that msg correctsi really dont understandalso nitrosiamines sp and sulfites why them there are safer ways to preserve food wines and beersi think outlaw the use of these substances without warning labels aslarge as those on cig packages require of comparable products on the market to be free of thesesubstances and state that they are free of msg dyes nitrosiamines and sulfites on the package while at it outlaw yellow dye for that matter why dye food take the dyes and flavorings out of vitamins in my osco only stresstabs tm didnt have yellow dye my doctor says yellow dye isresponsible for of all nasal polyps keep food food quit putting in junkjust my two cents worthsig a person tired of getting sick from this junk walter lundby walter lundbyfrom ladyuhunixuhcchawaiiedu lee ladysubject re science and methodology was homeopathy traditionin article lsuqinniasaltillocsutexasedu turpincsutexasedu russell turpin writesi agree with everything that lee lady wrote in her previous post inthis thread gee maybe ive misjudged you russell anyone who agrees with something i say cant be all bad seriously im not sure whether i misjudged you or not in one respect i still have a major problem though with your insistence that science is mainly about avoiding mistakes and i still disagree with your contention that nobody who doesnt use methods deemed scientific can possibly know whats true and whats not deleted material which i agree with back to lee lady these are not the rules according to many who post to scimed and scipsychology according to these posters if its not supported by carefully designed controlled studies then its not sciencethese posters are making the mistake that i have previouslycriticized of adhering to a methodological recipe a carefully rules such as support the hypothesis by a carefully designed andcontrolled study are too narrow to apply to all investigationi think that the requirements for particular reasoning to beconvincing depends greatly on the kinds of mistakes that haveoccurred in past reasoning about the same kinds of things toreuse the previous example we know that conclusions fromuncontrolled observations of the treatment of chronic medicalproblems are notoriously problematic okay so lets see if we agree on this first of all there are degrees of certainty it might be appropriate for instance to demand carefully controlled trials before we accept as absolute scientific truth to the extent that there is any such thing the effectiveness of a certain treatment on the other hand highly favorable clinical experience even if uncontrolled can be adequate to justify a preliminary judgement thata treatment is useful this is often the best evidence we can hope forfrom investigators who do not have institutional or corporate supportin this case it makes sense to tentatively treat claims as crediblebut to reserve final judgement until establishment scientists who arequalified and have the necessary resources can do more careful testingsecondly it makes sense to be more tolerant in our standards of evidence for a pronounced effect than for one that is marginal i come to this dispute about what science is not only as amathematician but as a veteran of many arguments in scipsychology andoccasionally in scimed about nlp neurolinguistic programming muchof the work done to date by nlpers can be better categorized asinformal exploration than as careful scientific research for yearsnow i have been trying to get scientific and clinical psychologists tojust take a look at it to read a few of the books and watch some ofthe videotapes courtesy of your local university library not forthe purpose of making a definitive judgement but simply to look at thenlp methodology especially the approach to eliciting information fromsubjects and look for ideas and hypotheses which might be ofscientific interest and most especially to be aware of thequestions nlp suggests which might be worthy of scientificinvestigationover and over again the response i get in scipychology is if thishasnt been thoroughly validated by the accepted form of empiricalresearch then it cant be of any interest to us to me the ultimate reducio ad absurdum of the extreme thereve got tobe controlled studies position is an nlp technique called the fastphobiatrauma curesimple phobias as opposed to agoraphobia may not be the worlds most important psychological disorder but the nice thing about them is that it doesnt take a sophisticated instrument to diagnose them or tell when someone is cured of one the nlp phobia cure is a simple visualization which requires less than minutes nlpers claim thatit can also be used to neutralize a traumatic memory and hence isuseful in treating posttraumatic stress syndrome it is essentiallya variation on the classic desensitization process used by behavioraltherapists a subject only needs to be taken through the technique onceor in the case of ptsd once for each traumatic incident theprocess doesnt need to be repeated and the subject doesnt need topractice it over again at homenow to me it seems pretty easy to test the effectiveness of this cure especially if as nlpers claim the success rate is extremely high take someone with a fear of heights as i used to have take them up to a balcony on the th floor and observe their response spend minutes to have them do the simple visualization send them back up to the balcony and see if things have changed check back with them in a few weeks to see if the cure seems to be lasting more long term followup is certainly desirable but from a scientific point of view even a cure that lasts several weeks has significance in any case there are many known cases where the cure has lasted years to the best of my knowledge there is no known case where the cure has been reversed after holding for a few weeks my own cure incidentally was donewith a slightly different nlp technique before i learned of the fast phobiatrauma cure ten years later now i enjoy living on the thfloor of my building and having a large balcony the folks over in scipsychology have a hundred and one excuses not tomake this simple test they claim that only an elaborate outcome studywill be satisfactory a study of the sort that nlp practitioners many of whom make a barely marginal living from their practice can ill afford to do most of them are also just plain not interested because the whole idea seems frivolous and since theyre not part of thescientific establishment they have no tangible rewards to gain from scientific acceptance the fast phobiatrauma cure is over ten years old now and the clinical psychology establishment is still saying we dont have any way of knowing that its effective these academics themselves have the resources to do a study as elaborate as anyone could want of course but they say why should i prove your theory and the burden of proof is on the one making the claim one academic in scipsychology said that it would be completely unscientific for him to test the phobia cure since it hasnt been described in a scientific journal its described in a number of books and ive posted articles in scipsychology describing it in as much detail as im capable of actually at least one fairly careful academic study has been done with favorable results but its apparently not acceptable because its adoctoral dissertation and not published in a refereed journalto me this sort of attitude does not advance science but hinders it this is the kind of thing i have in mind when i talk about doctrinnaire attitudes about science now maybe i have been unfair in imputing such attitudes to you russell if so i apologize in the arguments between behaviorists and cognitivists psychology seems less like a science than a collection of competing religious sects ladyuhunixuhcchawaiiedu ladyuhunixbitnetfrom steveoworldstdcom steven w orrsubject need to find information about current trends in diabetesi looked for diab in my newsrc and came up with nuthin anyone haveany good sources for where i can read in particular im interestedin finding out more about intravenous insulin injection for hepaticvein liver activation whew wotta mouthfulanything that smells like a pointer would be helpful newsgroupmailinglist etcmany thanks time flies like the wind fruit flies like bananassteven w orr steveoworldstdcom uunetworldsteveoeverybody repeat after me we are all individualsfrom mark w dubinsubject re barbecued foods and health riskrsilverworldstdcom richard silver writessome recent postings remind me that i had read about risks associated with the barbecuing of foods namely that carcinogens are generated is this a valid concern if so is it a function of the smoke or the elevated temperatures is it a function of the cooking elements wood or charcoal vs lava rocks i wish to know more thanks i recall that the issue is that fat on the meat liquifies and thendrips down onto the hot elementswhatever they arethat the extremeheat then catalyzes something in the fat into one or morecarcinogens which then are carried back up onto the meat in the smokethe ol professorfrom mmmcupportalcom mark robert thorsonsubject re barbecued foods and health riskthis reminds me of the last graham kerr cooking show i saw today hesmoked meat on the stovetop in a big pot he used a strange techniqueid never seen beforehe took a big pot with lid and placed a tray in it made from aluminum foilthe tray was about the size and shape of a typical coffeetable ash traymade by crumpling a sheet of foil around the edgesin the tray he placed a couple spoonfuls of brown sugar a similarquantity of brown rice he said any rice will do the contents of twoteabags of earl grey tea and a few cloveson top of this was placed an ordinary aluminum baskettype steamer withtwo chicken breasts in it the lid was put on and the whole assemblywent on the stovetop at high heat for or minuteslater he removed what looked like smoked chicken breasts what surprisesand concerns me are no wood chips where does the smoke flavor come from about or years ago i remember hearing that carmel color obtained by caramelizing sugar a common coloring and flavoring agent had been found to be carcinogenic i believe they injected it under the skin of rats or something if the results were conclusive caramel color would not be legal in the us yet it is still being used was the initial research result found to be incorrect or what about or years ago i remember earl grey tea being implicated as carcinogenic because it contains oil of bergamot an extract from the skin of a type of citrus fruit does anyone know whatever happened with that story if it were carcinogenic earl grey tea could not have it as an additive yet it apparently continues to do sowrt natural wood smoke ive smoking a duck right now as it happensive noticed that a heavilysmoked food item will have an unpleasant tangytaste when eaten directly out of the smoker if the smoke has only recentlystopped flowing i find the best taste to be had by using dry wood chipsgetting lots of smoke right up at the beginning of the cooking processthen slowly barbequing for hours and hours without adding additional wood chipsmy theory is that the unpleasant tangy molecules are lowmolecular weightstuff like terpenes and that the smoky flavor molecules are some sortof larger molecule more similar to tar the long barbeque time afterthe initial intensive smoke drives off the lowmolecular weight stuffjust leaving the flavor behind does anyone know if my theory is correcti also remember hearing that the combustion products of fat drippingon the charcoal and burning are carcinogenic for that reason and becauseit covers the product with soot and some unpleasant tanginess i only grillnondrippy meats like prawns directly over hot coals i do stuff like thisduck by indirect heat i have a long rectangular weber and i put the coalsat one end and the meat at the other end the fat drops directly on thefloor below the meat and next time i use the barbeque i make the firein that end to burn off the fat and help ignite the coalsand yet another reason ive heard not to smoke or barbeque meat is thatsmoked cured meat like pork sausage and bacon containsnitrosamines which are carcinogenic im pretty sure this claim actuallyhas some standing dont know about the othersan amusing incident i recall was the duncan hines scandal when it wasdiscovered that the people who make duncan hines cake mix were puttinga lot of ethylene dibromide edb into the cake mix to suppress weevilsthis is a fumigant which is known to be carcinogenicthe guy who represented the company in the press conference defendedhimself by saying that the risk from eating duncan hines products every dayfor a year would be equal to the cancer risk from eating two charcoalbroiled steaks what a great analogy when i first heard that myimmediate reaction was we should make that a standard unit one charcoalbroiled steak would be equivalent to duncansfrom gebcspittedu gordon bankssubject re brain abscess definition neededin article aprtardismdcorpkscnasagov fresatardismdcorpkscnasagov writescould someone please define a brain abscess for me a relative has one nearhis cerebelluma brain abscess is an infection deep in the brain substance it ishard to cure with antibiotics since it gets walled off and usuallyit needs surgical drainage gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from jimzisfeinfactorycom jim zisfein subject hypoglycemiafrom anelloadcsfnalgov anthony anellocan anyone tell me if a bloodcount of when diagnosed as hypoglycemic isdangerous ie indicates a possible pancreatic problem one dr says no theother not his specialty says the first is negligent and that another bloodblood glucose levels of or so are common several hours after abig meal this level will usually not cause symptomstest should be done also what is a good diet what has worked for a hypoglycemicif you mean reactive hypoglycemia there are usually no symptomshence there is no disease hence the dietary recommendations are thesame as for anyone else if a patient complains of dizzinessfaintness sweating palpitations etc reliably several hours aftera big meal the recommendations are obvious eat smaller meals slmr email jimzisfeinfactorycom jim zisfein from jimzisfeinfactorycom jim zisfein subject need advice with doctorpatient relationship problemml from libmanhscuscedu marlena libmanml i need advice with a situation which occurred between me and a physicanml which upset meml my questions should i continue to have this doctor manage my carethats easy no you wouldnt take your computer into a repairshop where they were rude to you even if they were competent intheir business why would you take your own body into a repairshop where the repairman has such a bad attitude slmr email jimzisfeinfactorycom jim zisfein from slyxccusuedusubject re is msg sensitivity superstitionbetween who over what i would be most interested in seeing youprovide peerreviewed nonfoodindustryfunded citations to articlesdisputing that msg has no effects whatsoever you mean asserting youre being intellectually dishonest or just plain confused because youre conflating reports which do not necessarily have anything to do with each other olneys reports would argue a potential for problems in human infants but thats not to say that this says anything whatsoever about the use of msg in most foods nor does he provide any studies in humans which indicate any deleterious effects for obvious reasons it says nothing about msgs contribtion to the phenomenon of the chinese restaurant syndrome it says nothing about the frequent inability to replicate anecdotal reports of msg sensitivity in the labokay mr dyer were properly impressed with your philosophical skills andability to insult people youre a wonderful speaker and an adept politicianhowever i believe that all you were asked to do was simply provide scientificresearch refuting the work of olney i dont think the original poster soughtto start a philisophical debate she wanted some information given a littleeffort one could justify that shooting oneself with a before breakfast is ahealthy practice but were not particularily interested in what you canverbally provedisprove or rationalize wheres the research where are thestudiesi appoligize if this sounds flamish i simply would like to see the thread getback on track lone wolf happy are they who dream dreamsed philips and pay the price to see them come trueslyxccusuedu unknownfrom doylepittedu howard r doylesubject re barbecued foods and health riskin article dubinspotcoloradoedu dubinspotcoloradoedu writesi recall that the issue is that fat on the meat liquifies and thendrips down onto the hot elementswhatever they arethat the extremeheat then catalyzes something in the fat into one or morecarcinogens which then are carried back up onto the meat in the smoke hmmm care to be more vaguehoward doyledoylepittedufrom gebcspittedu gordon bankssubject re sleeping pill odin article aprscottskidmoreedu dfedermascottskidmoreedu daniel federman writesa friend of mine took appoximately cvs sleeping pills eachcontaining mg of diphenhydramine i think thats mg totalim worried though about the longterm effects since henever had his stomach pumped will he have liver or brain damage anyinformation would be greatly appreciatedshouldnt have but he may need to see the shrink about why hewanted to kill himself depressed people can be succesfully treatedusually gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re request for information on essential tremor and indrolin article qtbninnnfnlifeaimitedu sundaraimitedu writesessential tremor is a progressive hereditary tremor that gets worsewhen the patient tries to use the effected member all limbs vocalcords and head can be involved inderal is a betablocker andis usually effective in diminishing the tremor alcohol and mysolineare also effective but alcohol is too toxic to use as a treatment gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from aldridgenetcomcom jacquelin aldridgesubject re what are the problems with nutrasweet aspartamehbloommooseuvmedu heather writesnutrasweet is a synthetic sweetener a couple thousand times sweeter thansugar some people are concerned about the chemicals that the body produces when it degrades nutrasweet it is thought to form formaldehyde and known tofor methanol in the degredation pathway that the body uses to eliminate substances the real issue is whether the levels of methanol and formaldehydeproduced are high enough to cause significant damage as both are toxic toliving cells all i can say is that i will not consume it phenylalanine isnothing for you to worry about it is an amino acid and everyone uses smallquantities of it for protein synthesis in the body some people have a diseaseknown as phenylketoneurea and they are missing the enzyme necessary to degrade this compound and eliminate it from the body for them it will accumulate in the body and in high levels this is toxic to growing nervecells therefore it is only a major problem in young children until aroundage or so or women who are pregnant and have this disorder it used tobe a leading cause of brain damage in infants but now it can be easily detected at birth and then one must simply avoid comsumption of phenylalanineas a child or when pregnant heatherif i remember rightly pku syndrome in infants is about they lacktwo genes and people who lack one gene are supposed to be personsthose with pku have to avoid naturally occuring phenylalanine and thosewho only have one gene and underproduce whatever it is they are supposed tobe producing are supposed to be less tolerant of aspartame the methol formaldahyde thing was supposed to occur with heatingi dont drink it i figure sugar was made for a reason to quickly andeasily satiate hungry people if you dont need the calories its just aseasy to drink water used to drink a six pack a aday of aspartame soda donteven drink one coke a day when sugaredfrom gebcspittedu gordon bankssubject re nih offers exploratory grants for alternative medicinein article aprislandcom greenislandcom robert greenstein writesin article pittuucp gebcspittedu gordon banks writesone problem is very few scientists are interested in alternative medicineso gordon why do you think this is so probably because most of them come packaged with some absurd theorybehind them eg homoeopathy like cures like the more you dilutethings the more powerful they get even if you dilute them so muchthere is no ingredient but water left chiropractic all illnessstems from compressions of nerves by misaligned vertebrae suchsystems are so patently absurd that any good they do is accidentaland not related to the theory the only exception is probably herbalismbecause scientists recognize the potent drugs that derive from plantsand are always interested in seeing if they can find new plantsthat have active and useful substances but that isnt what is meant by alternative medicine usually if you get into the qiaccupuntunce charts etc you are now back to silly theories thatprobably have nothing to do with why accupuncture works in some casesperhaps another reason they are reluctant is the rhine experiencerhine was a scientist who wanted to investigate the paranormaland his lab was filled with so much chacanery and fakery that people dont want to be associated with that sort of thing gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re dislocated shoulderin article aprebigmkodeccom stevecaboomcbmdeccom steve katz writesrecently i managed to dislocate my shoulder whilesking the injury also seems to have damaged the nervesin my arm i was wondering if someone could point me towardssome literature that would give me some background intothese types of injuries please respond by email if possibleyour medical school library should have books on peripheral nerveinjuries probably it was your brachial plexus so look that up gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re too many mrisin article qriemoaccessdigexnet kflaccessdigexcom keith f lynch writesso why are the scans so expensive and what can be done to reduce theexpense isnt it just a box with some big magnets a radio transmitterand an attached pcthe magnets are huge good mri sets with big tesla magnetscost millions of dollars then the radiologist wants forreading each scan gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re helium nonrenewable was too many mrisin article lsjgdinnkorsaltillocsutexasedu turpincsutexasedu russell turpin writeshow does the helium get consumed i would have thought that failureto contain it perfectly would result in its evaporation back into the atmosphere sounds like a cycle to me obviously it takes energy to run the cycle but i seriously doubt that helium consumptionis a resource issueits not a cycle free helium will escape from the atmosphere due toits high velocity it wont be practical to recover it it hasto be mined gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from kaminskinetcomcom peter kaminskisubject re need to find information about current trends in diabetesin cnfrkpjworldstdcom steveoworldstdcom steven w orr writesi looked for diab in my newsrc and came up with nuthin anyone haveany good sources for where i can readcheck out the diabetic mailing list a knowledgable helpful friendlyvoluminous bunch send email to listservpccvmbitnet with this linein the bodysubscribe diabetic your name herealso the vote for mischealthdiabetes a newsgroup for general discussionof diabetes is currently underway and will close on april from thend cfv posted to newsannouncenewgroups newsgroups and scimedmessage qjshinnvrodanuunetto place a vote for the creation of mischealthdiabetes send anemail message to yessunnrlnavymilto place a vote against creation of mischealthdiabetes send anemail message to nosunnrlnavymilthe contents of the message should contain the line i voteforagainst mischealthdiabetes as proposed email messages sent tothe above addresses must constitute unambiguous and unconditionalvotes foragainst newsgroup creation as proposed conditional voteswill not be accepted only votes emailed to the above addresses willbe counted mailed replies to this posting will be returned in theevent that more than one vote is placed by an individual only themost recent vote will be counted one additional cfv will be postedduring the course of the vote along with an acknowledgment of thosevotes received to date no information will be supplied as to howpeople are voting until the final acknowledgment is made at the endat which time the full vote will be made publicvoting will continue until gmt apr votes will not be accepted after this dateany administrative inquiries pertaining to this cfv may be made byemail to swkirchsunnrlnavymilthe proposed charter appears belowcharter mischealthdiabetes unmoderated the purpose of mischealthdiabetes is to provide a forum for thediscussion of issues pertaining to diabetes management ie dietactivities medicine schedules blood glucose control exercisemedical breakthroughs etc this group addresses the issues ofmanagement of both type i insulin dependent and type ii noninsulindependent diabetes both technical discussions and general supportdiscussions relevant to diabetes are welcome postings to mischeathdiabetes are intended to be for discussionpurposes only and are in no way to be construed as medical advicediabetes is a serious medical condition requiring direct supervisionby a primary health care physician end of charterfrom mmatusevradfordvakededu melissa n matusevichsubject foreskin troubleswhat can be done short of circumcision for an adult malewhose foreskin will not retractfrom joelcsmcgillca joel malardsubject bone marrow sclerosisi am looking for information on possible causes and long term effectsof bone marrow sclerosis i would also be thankful if anyone readingthis newsgroup could list some recognized treatment centers if anythingelse than massive blood transfusion can be effective if you plan ona go to the librarystyle reply please be kind enough to add a list of suggested topics or readings medicine is not my fieldregardsjoel malardjoelcsmcgillcafrom uuicvmuicedusubject quality control in medicinedoes anybody know of any information regarding the implementaion of total quality management quality control quality assurance in the delivery of health care service i would appreciate any information if there is enoughinterest i will post the responses thank you abhin singla ms bioe mba md president ac medcomp incfrom kiltyucrengr kathleen richardssubject re lyme vaccinejeff if you have time to type it in id love to have the reference for thatpaper thankskathleen richards email karichaeiscalstateedu sometimes youre the windshield sometimes youre the bug dire straitsfrom kxgstpittedu kenneth gilbertsubject re quality control in medicinein article uuicvmuicedu uuicvmuicedu writesdoes anybody know of any information regarding the implementaion of total quality management quality control quality assurance in the delivery of health care service i would appreciate any information if there is enoughinterest i will post the responsesthis is in fact a hot topic in medicine these days and much of themedical literature is devoted to this the most heavily funded studiesthese days are for outcome research and physicians and others areconstantly questionning whether what we do it truly effective in any givensituation qa activities are a routine part of every hospitalsadministrative function and are required by accreditation agencies thereare even entire publications devoted to qa issues kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from rgaschnloraclecom robert gaschsubject re homeopathy a respectable medical traditiongordon banks gebcspittedu wrote in article nlsunoraclenl rgaschnloraclecom robert gasch writes from a business point of view it might make sense it depends on the personality of the practitioner if he can charm the patients into coming homeopathy can be very profitable it wont be covered by insurance however just keep that in mind myself id have in many european countries homepathy is accepted as a method of curing or at least alleiating many conditions to which modern medicine has no answer in most of these countries insurance pays for the treatments accepted by whom not by scientists there are people in every country who waste time and money on quackery in britain and scandanavia where i have worked it was not paid for what are most of these countries i dont believe youin holland insurences pay for homeopathic treatment in germany they doso as well i austria they do if you have a condition which can not be helped by normal medicine happened to me switzerland seems to be the same as austria i have direct experience in the swiss caseat the univeristy of vienna i believe innsbruck as well homeopathycan be taken in med schooli found that in combination with acupuncture it changed my life fromliving hell to a condition which enables me to lead a relatively normal life i found that modern medicine was powerless to cure meof a severe case of neurodermitis note i mean cure not surpress the symptoms which is what modern medicine attempts to do in the case of neurodermitis im not saying that homeopathy is scientific but that it can offer help in areas in which modern medicine is absolutely helplessfrom reading your aritcle it seems that your have some deeply rootedbeliefs about this issue this is not intended to be offensive or sarcastic it just sounded like that to me which makes me doubt if you can read this with an open mind if you docan please excusemy last comment robertrgaschnloraclecomfrom gia kiria gkiriakiriakhetageorgiasusubject help helpmaybe anybody know names of conferences inplease help me find any information for next keywordsechocardiography and cardiologydopleri hawe no informatins on this subjects years becouse i leave intbilisysorry for my bad englishmy adress irinakiriakhetageorgiasufrom ronrothrosecom ron rothsubject hypoglycemia anelloadcsfnalgov anthony anello writesa can anyone tell me if a bloodcount of when diagnosed as hypoglycemic isa dangerous ie indicates a possible pancreatic problem one dr says no thea other not his specialty says the first is negligent and that another blooda test should be done also what is a good diet what has worked for a hypoa glycemic tiaa a a anthony anelloa fermilaba batavia illinois once you have your hypoglycemia confirmed through the proper channels you might consider ther following chelated manganese mgday chelated chromium mcgday increase protein through foods or supplements avoid supplementsfoods high in potassium calcium zinc avoid vit c supplements in excess of mg avoid honey and foods high in simple sugars enjoy breads cereals grains discuss the above with your health practitioner for compatibility with your body chemistry and safety ron rosereader p beer its not just for breakfast anymore rosemail usenet rose media hamilton from kflaccessdigexcom keith f lynchsubject glutamatein article lsoqinnkprnewsbbncom sherbbncom lawrence d sher writes from the nejmed editorial the dicarboxylic amino acid glutamate is not only an essential amino acid glutamate is not an essential amino acid people can survive quite wellwithout ever eating any keith lynch kflaccessdigexcomf p s q x f f qffpq s qpf wq pxfrom jeffpvetmedwsuedu jeff parkesubject re lyme vaccinekathleen richards kiltyucrengr wrote if you have time to type it in id love to have the reference for that paper thanksexperimental lyme disease in dogs produces arthritis and persistant infectionthe journal of infectious diseases march jeff parke jeffppgavinvetmedwsuedualso jeffpwsuvmbitnet aol jeffparkewashington state university college of veterinary medicine class of pullman wa from kingreasoningcom dick kingsubject re selective placeboin article aprrosecom ronrothrosecom ron roth writes otoh who are we kidding the new england medical journal in ran the heading ninety percent of diseases are not treatable by drugs or surgery which has been echoed by several other reports no wonder mds are not amused with alternative medicine since the magic of the placebo effect would award alternative practitioners twice the success rate of conventional medicine of diseases is not the same thing as of patients in a world with one curable disease that strikes people and nine incurable diseases which strikes one person each medical science will cure of the patients and report that of diseases have no therapy a disease would be counted among the untreatable if nothing better than a placebo were known of course mds are ethically bound to not knowingly dispense placebosdkfrom jchenwindbellcorecom jason chensubject re glutamatein article qrsrdaccessdigexnet kflaccessdigexcom keith f lynch writesin article lsoqinnkprnewsbbncom sherbbncom lawrence d sher writes from the nejmed editorial the dicarboxylic amino acid glutamate is not only an essential amino acid glutamate is not an essential amino acid people can survive quite wellwithout ever eating anythere is no contradiction here it is essential in the sense that yourbody needs it it is nonessential in the sense that your body canproduce enough of it without supplementjason chenfrom carlsolgpscaltechedu carl j lydicksubject re glutamatein article aprwalterbellcorecom jchenwindbellcorecom jason chen writesthere is no contradiction here it is essential in the sense that yourbody needs it it is nonessential in the sense that your body canproduce enough of it without supplementand when youre in a technical discussion of amino acids its the latterdefinition thats used almost universallycarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itfrom youngserumkodakcom rich youngsubject re barbecued foods and health riskin article cmvvoworldstdcom rsilverworldstdcom richard silver writessome recent postings remind me that i had read about risks associated with the barbecuing of foods namely that carcinogens are generated is this a valid concern if so is it a function of the smoke or the elevated temperatures is it a function of the cooking elements wood or charcoal vs lava rocks i wish to know more thanks from the tufts university guide to total nutrition stanley gershoff phd dean of tufts university school of nutrition harperperennial isbn the greatest hazard of barbecuing is that the cook will not use enough caution and get burned some people suggest that the barbecuing itself is dangerous because the smoke which is absorbed by the meat contains benzopyrene which in its pure form has been known to cause cancer in laboratory animals however in order to experience the same results people would have to consume unrealistically large quantities of barbecued meat at a timerich young these are not kodaks opinionsfrom youngserumkodakcom rich youngsubject re what are the problems with nutrasweet aspartamein article apruvmedu hbloommooseuvmedu heather writesnutrasweet is a synthetic sweetener a couple thousand times sweeter thansugar some people are concerned about the chemicals that the body produces when it degrades nutrasweet it is thought to form formaldehyde and known tofor methanol in the degredation pathway that the body uses to eliminate substances the real issue is whether the levels of methanol and formaldehydeproduced are high enough to cause significant damage as both are toxic toliving cells all i can say is that i will not consume it in the september issue of the tufts university diet and nutrition letter there is a three page article about artificial sweeteners what follows are those excerpts which deal specifically with nutrasweet reproduced without permission the controversy over aspartame began six years ago in englandwhere a group of researchers found that aspartame marketed underthe tradename nutrasweet appears to stimulate appetite andpresumably the eating of more calories in the long run than ifa person simply consumed sugar when researchers asked a groupof people to drink plain water aspartamesweetened water andsugared water they said that overall they felt hungriest afterdrinking the artificially sweetened beverage the study received widespread media attention and stirred agood deal of concern among the artificialsweetenerusing publichowever its results were questionable at best since the researchersdid not go on to measure whether the increase in appetite didactually translate into an increase in eating the two do notnecessarily go hand in hand in the years that followed more than a dozen studies examiningthe effect of aspartame on appetite and eating were conductedand after reviewing every one of them the director of thelaboratory of the study of human ingestive behavior at johns hopkinsuniversity barbara rolls phd concluded that consuming aspartamesweetened foods and drinks is not associated with any increase inthe amount of food eaten afterward one artificial sweetener that is not typically accused of causingcancer is aspartame but it most certainly has been blamed for ahost of other ills since its introduction in the governmenthas received thousands of complaints accusing it of causingeverything from headaches to nausea to mood swings to anxietystill years of careful scientific study conducted both before andafter the sweeteners entering the market have failed to confirmthat it can bring about adverse health effects thats why thecenters for disease control the government agency charged withmonitoring public health the american medical associationscouncil on scientific affairs and the food and drug administrationhave given aspartame one of the most studied food additives aclean bill of health granted the fda has set forth an acceptable daily intake of milligrams of aspartame per kilogram of body weight to exceedthe limit however a pound kg woman would have to takein milligrams of aspartame the amount in cans ofaspartamesweetened soda pop cups of gelatin cups of yogurtor sixounce servings of aspartamecontaining hot cocoaa pound kg man would have to consume some milligramsof the sweetener the amount in cans of soda pop or cupsof yogurt to go over the limit chart with aspartame contentof selected foods omitted only one small group of people must be certain to stay awayfrom aspartame those born with a rare metabolic disorder calledphenylketonuria or pku the estimated one person in every to who has it is unable to properly metabolize an essentialamino acid in aspartame called phenylalanine once a childconsumes it it builds up in the body and can ultimately causesuch severe problems as mental retardation to help people withpku avoid the substance labels on cans of soda pop and otheraspartamesweetened foods must carry the warning phenylketonuricscontains phenylalaninerich young these are not kodaks opinionsfrom isabellerossodartmouthedu isabelle rossosubject hunchbacki have a friend who has a very pronounced slouch of his upper back healways walks and sits this way so i have concluded that he ishunchbackis this a genetic disorder or is it something that people can correctie is it just bad posture that can be changed with a bit of willpowerisabellerossodartmouthedu from jimzisfeinfactorycom jim zisfein subject post polio syndrome information needed please ks from keithactrixgennz keith stewartksmy wife has become interested through an acquaintance in postpolio syndromeksthis apparently is not recognised in new zealand and different symptons egkschest complaints are treated separately does anone have any informationim not sure that this condition is recognised anywhere in thesense of a disease with diagnostic criteria clear boundariesbetween it and other diseases unique pathologic or physiologicfeatures etc but here goes with what many neurologists agree onpostpolio syndrome patients have evidence of motor neuron diseaseby clinical examination emg and muscle biopsy the abnormalitiesare mostly chronic due to old polio but there is evidence ofongoing deterioration clinically the patients complain ofdeclining strength and endurance with everyday motor tasksmusculoskeletal pain is a nearly universal feature that doubtlesscontributes to the impaired performance the examination showsmuscle weakness and atrophy the emg shows evidence of olddenervation with reinnervation giant and longduration motor unitaction potentials and evidence of active denervationfibrillation potentials the biopsy also shows old denervationwith reinnervation fibertype grouping and evidence of activedenervation small angulated fibers with dense oxidative enzymestaining but curiously little or no group atrophypostpolio patients do not have als in als there is clinicallyevident deterioration from one month to the next in postpoliothe patients are remarkably stable in objective findings from oneyear to the next of course there are patients who had poliobefore who develop genuine als but als is no more common amongpolio survivors than among people who never had poliothe cause of postpolio syndrome is unknown there is littleevidence that postpolio patients have active polio virus ordestructive immunologic response to virus antigenthere is no solid evidence that patients with postpolio haveanything different happening to the motor unit anterior horn cellsmotor axons neuromuscular junctions and muscle fibers thanpatients with old polio who are not complaining of deteriorationboth groups can have the same emg and biopsy findings the reasonfor these acute changes in a chronic disease old polio isunknown possibly spinal motor neurons that have reinnervated hugenumbers of muscle fibers start shedding the load after severalyearsthere are a couple of clinical features that distinguish postpoliosyndrome patients from patients with old polio who denydeterioration the pps patients are more likely to have had severepolio the pps patients are much more likely to complain of painthey also tend to score higher on depression scales ofneuropsychologic testsmy take on this im sure some will disagree after recovery fromsevere polio there can be abnormal loading on muscles tendonsligaments bones and joints that leads to inflammatory andordegenerative conditions affecting these structures the increasingpain superimposed on the chronic but unchanging weakness leadsto progressive impairment of motor performance and adl i amperhaps biased by personal experience of having never seen a ppspatient who was not limited in some way by pain i do not believethat pps patients have more rapid deterioration of motor units thannonpps patients ie those with old polio of similar severity butwithout pps complaints slmr email jimzisfeinfactorycom jim zisfein from jimzisfeinfactorycom jim zisfein subject re post polio syndrome information needed please dn from nyedacnsvaxuwecedu david nyedn briefly this is a condition in which patients who have significantdn residual weakness from childhood polio notice progression of thedn weakness as they get older one theory is that the remaining motordn neurons have to work harder and so die soonerif this theory were true the muscle biopsy would show group atrophyevidence of acute loss of enlarged motor units it doesntinstead the biopsy shows scattered angulated atrophic fibersthis is more consistent with loadshedding by chronically overworkedmotor neurons the neurons survive at the expense of increasinglydenervated muscle slmr email jimzisfeinfactorycom jim zisfein from dozonoffbuedu david ozonoffsubject re foodrelated seizuressharon paulson paulsontablarcnasagov wrote once again we are waiting i have been thinking that it would be good to get to as large a group as possible to see if anyone has any experience with this kind of thing i know that members of the medical community are sometimes loathe to admit the importance that diet and foods play in our general health and wellbeing anyway as you can guess i am worried sick about this and would appreciate any ideas anyone out there has sorry to be so wordy but i wanted to really get across what is going on here i dont know anything specifically but i have one further anecdote acolleague of mine had a child with a serious congenital disease tuberoussclerosis along with mental retardation comes a serious seizure disorderthe parents noticed that one thing that would precipitate a seizure wasa meal with corn in it i have always wondered about the connection andfurther about other dietary ingredients that might precipitate seizuresother experiences would be interesting to hear about from nettersdavid ozonoff md mph boston university school of public healthdozonoffmeditvaxbuedu east concord st tc boston ma from rueggmeduncedu robert g rueggsubject re eugenicssubject re eugenicsgordon banks writesprobably within years a new type of eugenics will be possible maybe even sooner we are now mapping the human genome we will then start to work on manipulation of that genome using geneticengineering we will be able to insert whatever genes we wantno breeding no hybrids etc the ethical question is shouldwe two past problems with eugenics have been reducing the gene pool and defining the status of the eugenized inserting genes would not seem to reduce the gene pool unless the insertedgenes later became transmissible to progeny then they may be able tocrowd out garbage genes this may in the future become possible even ifit does awareness of the need to maintain the gene pool would hopefullymean provisions will be made for saving genes that may come in handylater evidently the genes for sickle cell disease in equatorial africaand for diabetes in the hopi promoted survival in some conditions wedont really know what the future may hold for our environment thereduced wilderness and diseasesurvival capacity of our relatively inbreddomesticated animals comes to mind vulcanism nuclear winter ice agemeteor impact new microbiological threats famine global warming etcetc are all conceivable therefore having as many genes as possibleavailable is a good strategy for species survival of course the status of genetically altered individuals would start outas no different than anyone elses but if we could makephilosopherkings with great bodies and long lives would we or theywant to give them elevated status we could the romans did it with theirkings without the benefits of such eugenics the race eventuallyrealized and dealt with the problems which that caused but for a whileit was a problem orwell introduced us to the notion of what might happento persons genetically altered for more menial tasks but there is nothingnew under the sun we treated slaves the same way for millennia before i see no inherent problem with gene therapy which avoids at least these problems humans have always had trouble having the virtue and wisdom touse any power that falls into their hands to good ends all the time thathasnt stopped the race as a whole yet many are the civilizations whichhave died from inability to adapt to environmental change however alsomany are the civilizations which have died from the abuse of their ownpower the ones which survived have hopefully learned a lesson from thefates of others and have survived by making better choices when theirturns came not that i dont think that this gene altering power couldnt wipe us offthe face of the earth or cause endless suffering nuclear power or globalwarming or whatever could and may still do that too the real issue is an issue of wisdom and virtue i personally dont thinkman has enough wisdom and virtue to pull this next challenge off anybetter than he did the for last few we as eugenists may make it an wemay not if we dont i hope there are reservoirs of garbage people outin some backwater with otherwise long discarded garbage genes which willpull us through i believe that the real problem is and will probably always be the sameman needs to accept input from the great spirit of god to overcome hislacks in the area of knowing how to use the power he has some men haveand i believe all men may listen to and obey the still small voice of godin their hearts this is the way to begin to recieve the wisdom and virtueneeded to escape the problems consequent to poor choices peoples havedied out for many reasons the societies which failed to accept enoughinput from god to safely use the power they had developed have destroyedthemselves and often others in the process it is selfevident that theones which survive today have either accepted enough input from the spiritto use their powers wisely enough to avoid or survive their own mistakesthus far or else havent had enough power for long enough in summary i would say that the question of whether to use this newtechnology is really an ancient one and the answer in some ways hard insome ways easy is the same ancient answer it isnt the power it is thespirit sorry for the long post got carried away bob rueggmeduncedufrom ladyuhunixuhcchawaiiedu lee ladysubject re science and methodology was homeopathy traditionin article lslnvinnrtbsaltillocsutexasedu turpincsutexasedu russell turpin writes not imply that all their treatments are ineffective it doesimply that those who rely on faulty methodology and reasoning areincapable of discovering which treatments are effective andwhich are notto start with no methodology or form of reasoning is infallible sotheres a question of how much certainty we are willing to pay for in agiven context insistence on too much rigor bogs science down completelyand makes progress impossible expenditure of sufficiently large sumsof money and amounts of time can sometimes overcome this on the otherhand with too little rigor much is lost by basing work on results whicheventually turn out to be false there is a morass of studiescontradicting other studies and outsiders start saying you people callthis science my opinion for what its worth is that one sees boththese phenomena happening simultaneously in some parts of psychology some subjective judgement is required to decide on the level of rigorappropriate for a particular investigation i dont believe it is ever possible to banish subjective judgement from science my second point though is that highly capable people can often makeextremely reliable judgements about scientific validity even when usingmethodology considered inadequate by the usual standards i think thisis true of many scientists and i think it is true of many who approachtheir discipline in a way that is not generally recognized as scientificwithin mathematics i think there are several examples especially beforethe twentieth century one conspicuous case is that of riemann who isfamous for many theorems he stated but did not prove later mathematicians did prove them of course i think that for a good scientist empirical investigation is often notso much a matter of determining what is true and whats not as it is a matter of convincing other people people have proposed lots of incompatible definitions of science here but i think the ability to objectively convince others of the validity of ones results is anessential element not that one can necessarily do that at every step of the scientific process but i think that if one is not moving toward that goal then one is not doing sciencewhen a person other than a scientist is quite good at what he does andseems to be very successful at it i think that his judgements are alsoworthy of respect and that his assertions are well worth furtherinvestigation in article cbyhdnewshawaiiedu i wrote namely is there really justification for the belief that science is a superior path to truth than nonscientific approaches admittedly my question was not at all well posed a considerableamount of effort in a serious scholarly investigation such as isuggested would be required simply to formulate an appropriately specific question to try and answer the science i was thinking of in my question is the actual science currently practiced now in the last decade of the twentieth century i certainly wasnt thinking of some idealized science or the mere use of reason and observationone thing i had in mind in my suggestion was the question as to whetherin many cases the subjective judgements of skilled and experiencedpractitioners might be more reliable than statistical studies since russell turpin seems to be much more familiar than i am withthe study of scientific methodology perhaps he can tell us if there is any existing research related to this question in the arguments between behaviorists and cognitivists psychology seems less like a science than a collection of competing religious sects ladyuhunixuhcchawaiiedu ladyuhunixbitnetfrom rueggmeduncedu robert g rueggsubject re eugenicsthanks to tarl neustaedter of ma for kindly letting me know that myreference in prior post to orwell and should probably have been tohuxley and brave new world sorry albob rueggmeduncedufrom marcbgfeenixmetronetcom marc grantsubject adult chicken poxi am and am recovering from a case of chicken pox which i contractedfrom my year old daughter i have quite a few of these little puppiesall over my bod at what point am i no longer infectious my physiciansoffice says when they are all scabbed over is this trueis there any medications which can promote healing of the pox speed uphealing please email replies and thanks in advance marc grant internet marcbgfeenixmetronetcom pob amateur radio station nmei richardson tx voicefax from uuicvmuicedusubject re foreskin troublesthis is generally called phimosisusually it is due to an inflammation and can be retracted in the physicians offfice rather eaaasily one should see a gp or in complicated cases a urologistfrom romdasuclinkberkeleyedu ella i baffsubject re selective placebo ron roth recommends once you have your hypoglycemia confirmed through the proper channels you might consider ther following diet omitted ronwhat do you consider to be proper channelsthis sounds suspiciouslylike a blood chemistryglucose tolerance and the likesuddenly chemistry exists you know perfectly well that this person can be saved needless trouble and expense with simple muscle testing and hair analysis to diagnosenoconfirm any aberrant physiologybut then againmaybe thats what you meantby proper channels were you able to understand dick kings post that of diseases is not thesame thing as of patients which was a reply to your inability to criticallyevaluate the statistic you cited from the new england journal of medicine couldyou figure out what is implied by the remark of course mds are ethically bound to not knowingly dispense placebos ronhave you ever thought about why you never post in mischealthalternativeand insist instead upon insinuating your untrained nonmedical often delusional notions of health and disease into this forum i suspect from yourapparent anger toward mds and heteropathic medicine that there may be anunderlying father problemof course i can confirm this by surrogate muscletesting one of my patients while they ponder my theory to see if one of their previously weak indicator muscles strengthensor do you have reservationsabout my unique methods of diagnosis ohi forgot what you said in an earlierpostneither am i concerned of whether or not my study designs meet your oranyone elses criteria of acceptance john badanes dc caromdasuclinkberkeleyedu ideas from twongcivilubcca thomas wongsubject image processing software for pci am posting the following for my brother please post your replies orsend him email to his address at the end of his message thank youmy supervisor is looking for a image analysis software forms dos we need something to measure lengths and areas onmicrographs sometime in the future we may expand to dosome densitometry for gels etc weve found lots of ads andinfo for the jandel scientific products sigmascan and javabut we have not been able to find any competing products wewould appreciate any comments on these products andsuggestions comments on other products we should considerthanks donalduserdonomtsgubccafrom robinntmtvcom robin coutelliersubject critique of pressure point massageras promised below is a personal critique of a pressure point massager i recently bought from the self care catalog i am very pleased with the results the catalog description is as followsthe pressure point massager is an aggressive physical massager that actually kneads the tension out of muscles much like aprofessional shiatsu masseur the powerful motor drives twocounterrotating thumbs that move in oneinch orbits releasing tension in the neck back legs and armspressure point massager a to order or receive a catalog call hours days orfax at notewhen i ordered the massager the item number was different and the pricewas not when i received it i glanced thru the newer catalogenclosed with it to see anything was different from the first one i was quite annoyed to see a difference in price i called them about itand the cust rep said that they had switched manufacturers although itlooks and works exactly the same he told me to go ahead and return thefirst one and order the cheaper one using the price difference as areason for return in fact since the newer ones might take a while toship from the factory i received this one in days he told me i could use the one i already have until the new one arrives then return the old one very reasonable peoplei have longterm neck shoulder and back pain if i were a building i would be described as structurally unsound i have stretches and exercises to do that help but the problem never really goes away if for whatever reason i do not exercise for a while illness not enoughtime lazy etc the muscles become quite stiff and painful and thus more prone to further strain even with exercise i sometimes require physical therapy to get back on track which st requires a doctor visit to get the prescription for pt the tension in my neck if not released eventually causes a headachesometimes confused with a sinus headache over my left eye when my physical therapist has massaged my neck and the suboccipital muscles in particular the knobby areas near the base of the skull the headache usually eased within a day although it hurts like hell to while it is being massagedi ordered this device because it seemed to be exactly what i was wishingsomeone would invent a machine that would massage not vibrate my neck and suboccipital muscles like my physical therapist has done in the past that i could use by myself no doctor visit or inconvenient pt appts for a week later would be needed to use it i could get up in the middle of the night and use it if necessaryi have been using it for about a week or so now and love it the baseunit is about a x rectangle about high with handles on eachside and it plugs into an average outlet the two metal thumbs are about in diameter and protrude about above the base the thumbs are covered with a gray cloth that is nonremovable they are located more toward one end rather than centered see figure below they move in either clockwise or counterclockwise directions depending on which side of the switch is pushed and are very quiet it can be used from eitherside for instance the thumbs can be positioned at the base of the neckor the top of the neck depending on which direction you approach it for the neckhead the user varies the amount of pressure used by if laying down allowing all or part of the full weight of the head andor neck to rest on the thumbs the handles can also be used if sitting orstanding applying pressure with the armswrists since my wrists arealso impaired im typing this over an extended period of time and i dont have someone living with me who can apply it laying down works well for mefor my back i sit in a highbacked kitchen chair position the massagerbehind me at whatever point i want massaged and lean back lightly ornot so lightly against it the pressure of leaning back holds it in place if i want to massage the entire spine i simply move it down a few inches whenever i feel like it for my back this machine is far superior to use than the commonly used homemade massager of tennis balls taped together with the balls position against a wall or door them over the spine and move the body up and down against them the tennis balls are better than nothing but difficult to use for very long especially if your quads are not in good shape and my long hair gets painfully in the way if i dont pin it up first as far as im concerned the easier something like this is to use the more likely ill usedo it if there are multiple considerationshassles im more likely to not bother with itnot only has this machine helped with my headaches but my range of motion for my neck and back are greatly increased the first time i used it on mynecksuboccipital muscles however i overdid it and pressed too hardagainst it which resulted in a very tender almost bruised area for afew days i laid off it for about days and applied ice which helped after that i was more gradual about applying pressure at this point the pain in the suboccipital area is now minimal while being massaged i also learned to use very light pressure on my lower back which is the most vulnerable point for meit also eased some painful knots of tension between my shoulder bladesalthough again it took a few days of massaging just a few minutes ata time to really work it outi highly recommend this product if you have similar problems although icannot vouch for its durability it seems pretty sturdy since ive hadit such a short time i plan to use it not only to ease tension but also to loosen the muscls before exercising and maybe after too i havebeen ill recently and not able to exercise much for a few weeks so this was very timely for methis is the st product ive ordered from this company and only recentlybecame aware of it thru a coworker the catalog states they have beenin business since it contains quite a few health care products andwhile they appear to be more expensive than the average health care catalogproducts they also appear to be of much higher quality with more thoughtput into what they actually do definitely a step above some other onesive seen such as dr leonards health care catalog or mature wisdomim only but have ended up on some geriatrictype mailing lists nobig surprise here i consider many of those products to be ripoffs particularly targeted toward the elderly with dubious health benefitsi apologize for the length of this but its the kind of info i would like to know before ordering something thru the mailrobin coutellier northern telecom mountain view cainternet robinntmtvcomuucpportalntmtvrobinfrom cashconvexcom peter cashsubject re need advice with doctorpatient relationship problemin article clqbyathenacsugaedu mcovingtaisunaiugaedu michael covington writessounds as though his hearts in the right place but he is not adept atexpressing it what you received was meant to be a profound apologyapologies delivered by overworked shy people often come out like thathis heart this jerk doesnt have a heart and it beats me why youreapologizing for him in my book behavior like this is unprofessionalinexcusable and beyond the pale if hes overworked its because hes toobusy raking in the bucks more likely he just likes to push women aroundid fire the sob and get myself another doctor die welt ist alles was zerfall ist peter cash apologies to ludwig wittgenstein cashconvexcomfrom danielprincefnzcalcomsocalcom daniel princesubject placebo effectsi know that the placebo effect is where a patient feels better or even gets better because of hisher belief in the medicine and the doctor administering it is there also an antiplacebo effect where the patient dislikesdistrusts doctors and medicine and therefore doesnt get better or feel better in spite of the medicineis there an effect where the doctor believes so strongly in a medicine that heshe sees improvement where the is none or sees more improvement than there is if so what is this effect called is there a reverse of the above effect where the doctor doesnt believe in a medicine and then sees less improvement than there is what would this effect be called have these effects ever been studied how common are these effects thank you in advance for all replies information is very valuable but disinformation is much more commonfrom gandersoncmutualcomau gavin andersonsubject help looking for a medical journal article whiplashcervical painhii am not sure where to post this message please contact me if im way offthe markon my wife went to her general practitioner doctor he mentionedan article from a medical journal that is of great interest to us he hadread it in the previous three months but has been unable to find it againthe article was about whiplash injurycervical pain it mentions the use ofa mri magnetic resonance imagery machine as a diagnostic tool and the workof a neurosurgeon who relived cervical painthis article is most likely in an australian medical journal i very muchwant to obtain the name of the article journal and author because the casematches my wife we would very much appreciate anyones help in this mattervia email preferablygavin anderson email gandersoncmutualcomauanalystprogrammer phone colonial mutual life aust acn fax some people never consciously discover their antipodesgavin anderson email gandersoncmutualcomauanalystprogrammer phone colonial mutual life aust acn fax from dhartungchinetchiilus dan hartungsubject the andromeda strainjust had the opportunity to watch this flick on ae some yearssince i saw it last i was very interested in the technology demonstrated in this filmfor handling infectious diseases and similar toxic substancesclearly they faked a lot of the computer robotic technologycertainly at the time it was made most of that was science fictionitself let alone the idea of a space germ quite coincidentally actually this is what got me wanted to seethe movie again i watched a segment on the otherwise awful howdthey do that dealing with a disease researcher at the cdcs toplab there was description of the elaborate security measures takenso that building will never be cracked so to speak by man ornature short of deliberate bombing from the air perhaps andthe researchers used spacesuits similar to that in the filmim curious what people think about this film short of sillyis such a facility technically feasible today as far as the plot and the crystalline structure that is not lifeas we know it thats a whole nother argument for recartssftechor something next a waco update an ohio prison update a bosnia update a russian update an abortion update and a congressional update here on snn the standoff news network all news all standoff all day daniel a hartung dhartungchinetchinetcom ask me about rotaractfrom lsalbnyvmsbitnet larry silverbergsubject re h e l p m e desperate with some vdi can probably buy the tools and this solution somewhere but i dont know how to do injection bymyselfyou may also want to buy a self injector or something like thatmy friend is diabetic you load the hyperdermic put it in a plastic caseand set a spring to automatically push the needle into the skin and depressthe plungerlive from new york its saturday nighttonights special guestlawrence silverberg from the state university of new york albanyakalsgeminialbanyedufrom markmchalcyoncom mark mcwigginssubject re barbecued foods and health riskalso dont forget that its better for your health to enjoy your steakthan to resent your sprouts mark mcwiggins hermes associates voicemarkmchalcyoncom box seattle wa faxfrom sandynmrptcyanamidcom sandy silvermansubject re barbecued foods and health riskfrom my reading of the popular and scientific literature i think that thebenzopyrenefromburnedfat problem is probably real but very small compared toother kinds of risks this type of problem also occurs with stovetop pangrilling one possible remedy i have read about is to take some vitamin c with your meal of barbecue or bacon eg this may make sense because vit cis an antioxidant which could counteract the adverse affect of some of the chemicals in question bon apetit sanford silverman opinions expressed here are my ownamerican cyanamid sandyptcyanamidcom silvermansptcyanamidcom yeast is bestfrom gmillerworldbankorg gene c millersubject immunotherapy for recurrent miscarriage following a series of miscarriages my wife was given a transfusion ofmy white cells the theory as i understand it is that there is some kindof immune blocking that prevents the body from attacking the pregnancy asit normally would a foreign body where this blocking is deficient thebody evicts the intruder resulting in a miscarriage the white cellsapparently enhance the blocking capability following the transfusion shesuccessfully carried the next pregnancy to term and jake is now an active monthold who cannot wait to walk were now thinking about having another child but no one includingthe obgyn who supervised the first transfusion really seems to knowwhether or not the transfusion process needs to be repeated for successivepregnancies is there anyone in netland who has experience with thisthanksgene and jane and jakeps ive also posted this in misckidsfrom harveyoasysdtnavymil betty harveysubject re is msg sensitivity superstitionin recfoodcooking packerdelphigsfcnasagov charles packer writesis there such a thing as msg monosodium glutamate sensitivityi saw in the ny times sunday that scientists have testified beforean fda advisory panel that complaints about msg sensitivity aresuperstition anybody here have experience to the contraryi know that there is msg sensitivity when i eat foods with msg i getvery thirsty and my hands swell and get a terrible itchy rash i firstexperienced this problem when i worked close to chinatown and ate chinesefood almost everyday for lunch now i cant tolerate msg at all i cannotice immediately when i have eaten any i try to avoid msg completelyinteresting fact though is that all three of my children started experiencingthe exact same rash on their hands i couldnt understand why because idont msg in cooking and we ask for no msg when we do eat chinese i stilllove it after some investigation i knew that oodles of noodles whereone of their favorite foods one of the main ingredients in the flavorpackets is msg now i look at all labels you would be surprised atplaces you find msgbetty harvey harveyoasysdtnavymil david taylor model basinadp networking and communication assessment carderock division branch naval surface warfarecode centerbethesda md dtmbcdnswc fax from sasghmtheseusunxsascom gary merrillsubject re science and methodology was homeopathy traditionin article aprcsrochesteredu fulkcsrochesteredu mark fulk writes im not familiar with the history of this experiment although arguably i should befor a brief but pretty detailed account try hempels philosophy ofnatural science i think that it is enough if his contemporaries found the result surprising thats not what id quibble about what id like to know are toricellis reasons for doing his experiment not the post hoc constructed reasons but the thoughts in his head as he considered the problem it may bethis smacks a bit of ideology the supposition being that toricellissubsequent descriptions of his reasoning are not veridical it gets dangerouslyclose to an unfalsifiable view of the history and methodology of science ifwe deny that no subsequent reports of experimenters are reliable descriptionsof their real reasons impossible to know much about toricellis thoughts thats too bad if it is so one of rootbernsteins services to science is that he has gone rooting about in pasteurs and flemings and other peoples notes and has discovered some surprising clues about their motivations pasteur never publicly admitted his plan to create mirrorimage life but the dreams are right there in his notebooks finally public after many years ready for anyone to read and i and my friends often have the most ridiculous reasons for pursuing results one of my best came because i was mad at a colleague for a poorlywritten claim i disproved the claim of course toricellis case may be an example of a rarety where the fantasy not only motivates the experiment but turns out to be right in the endbut my point is that this type of case is not a rarity in fact i wasgoing to point to pasteur as yet another rather common example particularlythe studies on spontaneous generation and fermentation i will readilyconcede that ridiculous reasons can play an important role in howscientists spend their time but one should not confuse motivation withmethodology nor suppose that ridiculous reasons provide the impetus in themajority of cases based on relatively infrequent anecdotal evidence gary h merrill principal systems developer c compiler developmentsas institute inc sas campus dr cary nc sasghmtheseusunxsascom mcncsassasghmfrom sbrennercbnewsbcbattcom scottdbrennersubject whats the difference between an md and a domy wife and i are in the process of selecting a pediatrician for ourfirst child due june th we interviewed a young doctor last weekand were very impressed with her however i discovered that she isactually not an medical doctor md but rather a doctor of osteopathy do whats the difference i believe the pediatriciani went to for many years was a do and he didnt seem different fromany other doctor ive seen over the yearsmy dictionary says that osteopathy is a medical therapy that emphasizesmanipulative techniques for correcting somatic abnormalities thoughtto cause disease and inhibit recoveryjeez this sounds like chiropractic i remember getting shots andmedicine from my pediatrician do and dont remember any manipulative techniques perhaps someone could enlighten me as tothe real practical difference between an md and a do also iminteresting in hearing any opinions on choosing a pediatrician whofollows one or the other medical philosophyreaders of scimed please respond directly to sbrennerattmailcomi do not read this group regularly and probably wont see your responseif you just post it here sorry for the crossposting but im hopingtheres some expertise herea t d h v a a n n k c s escott d brenner att consumer communications servicessbrennerattmailcom basking ridge new jerseyfrom davallenvmsmaccwiscedusubject re barbecued foods and health riskin article cupportalcom mmmcupportalcom mark robert thorson writesthis reminds me of the last graham kerr cooking show i saw today hesmoked meat on the stovetop in a big pot he used a strange techniqueid never seen before he took a big pot with lid and placed a tray in it made from aluminum foilthe tray was about the size and shape of a typical coffeetable ash traymade by crumpling a sheet of foil around the edges in the tray he placed a couple spoonfuls of brown sugar a similarquantity of brown rice he said any rice will do the contents of twoteabags of earl grey tea and a few cloves on top of this was placed an ordinary aluminum baskettype steamer withtwo chicken breasts in it the lid was put on and the whole assemblywent on the stovetop at high heat for or minutes later he removed what looked like smoked chicken breasts what surprisesand concerns me are no wood chips where does the smoke flavor come from about or years ago i remember hearing that carmel color obtained by caramelizing sugar a common coloring and flavoring agent had been found to be carcinogenic i believe they injected it under the skin of rats or something if the results were conclusive caramel color would not be legal in the us yet it is still being used was the initial research result found to be incorrect or what about or years ago i remember earl grey tea being implicated as carcinogenic because it contains oil of bergamot an extract from the skin of a type of citrus fruit does anyone know whatever happened with that story if it were carcinogenic earl grey tea could not have it as an additive yet it apparently continues to do so wrt natural wood smoke ive smoking a duck right now as it happensive noticed that a heavilysmoked food item will have an unpleasant tangytaste when eaten directly out of the smoker if the smoke has only recentlystopped flowing i find the best taste to be had by using dry wood chipsgetting lots of smoke right up at the beginning of the cooking processthen slowly barbequing for hours and hours without adding additional wood chips my theory is that the unpleasant tangy molecules are lowmolecular weightstuff like terpenes and that the smoky flavor molecules are some sortof larger molecule more similar to tar the long barbeque time afterthe initial intensive smoke drives off the lowmolecular weight stuffjust leaving the flavor behind does anyone know if my theory is correct i also remember hearing that the combustion products of fat drippingon the charcoal and burning are carcinogenic for that reason and becauseit covers the product with soot and some unpleasant tanginess i only grillnondrippy meats like prawns directly over hot coals i do stuff like thisduck by indirect heat i have a long rectangular weber and i put the coalsat one end and the meat at the other end the fat drops directly on thefloor below the meat and next time i use the barbeque i make the firein that end to burn off the fat and help ignite the coals and yet another reason ive heard not to smoke or barbeque meat is thatsmoked cured meat like pork sausage and bacon containsnitrosamines which are carcinogenic im pretty sure this claim actuallyhas some standing dont know about the others an amusing incident i recall was the duncan hines scandal when it wasdiscovered that the people who make duncan hines cake mix were puttinga lot of ethylene dibromide edb into the cake mix to suppress weevilsthis is a fumigant which is known to be carcinogenicthe guy who represented the company in the press conference defendedhimself by saying that the risk from eating duncan hines products every dayfor a year would be equal to the cancer risk from eating two charcoalbroiled steaks what a great analogy when i first heard that myimmediate reaction was we should make that a standard unit one charcoalbroiled steak would be equivalent to duncansi dont understand the assumption that because something is found tobe carcinogenic that it would not be legal in the us i think thatnaturally occuring substances excluding controlled substances arepretty much unregulated in terms of their use as food food additivesor other consumption its only when the chemists concoct sp aningredient that it falls under fda regulations otherwise if they really looked closely they would find a reason to ban almost everythinghow in the world do you suppose its legal to consume tobacco productswhich probably should be banneddave allenspace science engr ctruwmadisonfrom turpincsutexasedu russell turpinsubject re placebo effectsin article aacalcomsocalcom danielprincefnzcalcomsocalcom daniel prince writes is there an effect where the doctor believes so strongly in a medicine that heshe sees improvement where the is none or sees more improvement than there is if so what is this effect called is there a reverse of the above effect where the doctor doesnt believe in a medicine and then sees less improvement than there is what would this effect be called have these effects ever been studied how common are these effects thank you in advance for all replies these effects are a very real concern in conducting studies of newtreatments researchers try to limit this kind of effect by performing studies that are blind in various ways some of theseare o the subjects of the study do not know whether they receive a placebo or the test treatment ie whether they are in the control group or the test group o those administering the treatment do not know which subjects receive a placebo or the test treatment o those evaluating individual results do not know which subjects receive a placebo or the test treatmentobviously at the point at which the data is analyzed one has to differentiate the test group from the control group but the analysisis quasipublic the researcher describes it and presents the data onwhich it is based so that others can verify it it is worth noting that in biological studies where the subjects areanimals such as mice there were many cases of skewed results becausethose who performed the study did not blind themselves it is notconsidered so important to make mice more ignorant than they alreadyare though it is important that in all respects except the one testedthe control and test groups are treated alikerussellfrom gebcspittedu gordon bankssubject re eye dominancein article cegworldstdcom rsilverworldstdcom richard silver writesis there a righteye dominance eyedness as there is anoverall righthandedness in the population i mean do mostpeople require less lens corrections for the one eye than theother if so what kinds of percentages can be attached to thisthere is eye dominance same as handedness and usually for thesame side it has nothing to do with refractive error however gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re surgery of damaged tendons and median nervein article bhattaprwesleysrchoneywellcom bhattsrchoneywellcom writesi thought i will explore the net wisdom with the following questions is there any better way to control the pain than what the surgeon suggested how long will such pain last will the pain recur in the futureno one can answer that if she gets reflex sympathetic dystrophyit could last forever just hope she does not most dont do damaged partially cut tendons heal completely and is all of the finger strength regained how long does it take for the complete healing processsometimes they do and sometimes they dont you just have to do thebest job you can reattaching and hope you should know in a fewmonths gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from paulsontablarcnasagov sharon paulsonsubject re foodrelated seizuresin article aprspdcccom dyerspdcccom steve dyer writes newsgroups scimed path newslarcnasagovsaimiriprimatewisceduzaphodmpsohiostateeduuwmeducsutexaseduuunetthinkcomhsdndevspdccdyer from dyerspdcccom steve dyer organization sp dyer computer consulting cambridge ma references uupcbfactorycom cupportalcom date sat apr gmt lines in article cupportalcom mmmcupportalcom mark robert thorson writes i remember hearing a few years back about a new therapy for hyperactivity which involved aggressively eliminating artificial coloring and flavoring from the diet the theory which was backed up by interesting anecdotal results is that certain people are just way more sensitive to these chemicals than other people i dont remember any connection being made with seizures but it certainly couldnt hurt to try an allnatural diet yeah the feingold diet is a load of crap children diagnosed with add who are placed on this diet show no improvement in their intellectual and social skills which in fact continue to decline of course the parents who are enthusiastic about this approach lap it up at the expense of their childrens development so much for the value of interesting anecdotal results people will believe anything if they want to steve dyer dyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerthanks for all the interest in this problem of mine i dont think itis a reaction to sugar or junk food per se since kathryn has never shownany signs of hyperactivity or changes in behavior in response to foodshe has always been very calm and dare i say a neat smart kidthe fact that this happened while eating two sugar coated cereals madeby kellogs makes me think she might be having an allergic reaction tosomething in the coating or the cereals of the four of us in ourimmediate family kathryn shows the least signs of the hay fever runningnose itchy eyes etc but we have a lot of allergies in our family historyincluding some weird food allergies nuts mushrooms anyway our next trip is to an endocrinologist to check out the bodychemistry but so far no more sugar coated cereals and no more seizureseither every day that goes by without one makes me heave a sigh ofrelief thanks againsharon paulson sspaulsonlarcnasagovnasa langley research centerbldg d mailstop work hampton virginia home from gebcspittedu gordon bankssubject re organ donation and transplantation fact sheetin article aprlmpsbbscommmotcom dougbecscommmotcom writesmy wife cannot donate blood because she has been to a malarial regionin the past three years in fact she tried to have her bone marrowtyped and they wouldnt even do that whythe fda i believe rules say no blood or blood products donationsfrom anyone who has been in a malarial area for years i was a plateletdonor until my thailand trip and my blood bank was very disappointedto find out they couldnt use me for yearswhen the secretary of state asked me if i wanted to donate myorgans i said no because i figured that no one would want themgiven my history was i correctnot necessarily the same rules may not apply to organ donationas to blood donation in fact im sure they dont gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re mississippi river water and catfish safein article aprzeuscalpolyedu dfieldflutecalpolyedu infospunj dan field writesive been invited to spend a couple weeks this summer rafting down themississippi my journey partners want to live off of river water andcatfish along the route should i have any concerns about pollution orhealth risks in doing thisyoud have to purify the river water first im not sure how practicalthat is with the mississippi youd better check with health agenciesalong the way to see if there are toxic chemicals in the river ifit is just microorganisms those can be filtered or killed but youmay need activated charcoal or other means to purify from chemicalsbetter be same than sorry obviously drinking the river withoutprocessing it is likely to make you sick from bacteria and parasites gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re obgyn residencyin article aprcnsvaxuwecedu nyedacnsvaxuwecedu david nye writes i believe it is illegal for a residency to discriminate against fmgs iis that true i know some that wont even interview fmgs most programs discriminate in that given an fmg equallyqualified as an american they will take the american whatrights do they actually have does it matter if they areus citizens most are not we have had good luck with fmgsand bad luck some of our very best residents have been fmgsalso our very worst as it turns out the worst fmgs are oftenus citizens that studied in offshore medical schools of the residents fired for incompetence in the years ive been here in my department all have been fmgs were us citizens who studied in guadalajara was a us citizen but was trained in the soviet union and one was philipina unfortunately all are now practicing medicinesomewhere of them in neurology after having been picked up by other programs in psychiatry and the other in emergency medicine gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from cashconvexcom peter cashsubject liver spotswhat causes those little brown spots on older peoples hands are theycalled liver spots because theyre sort of livercolored or do theyindicate some actual liver dysfunction die welt ist alles was zerfall ist peter cash apologies to ludwig wittgenstein cashconvexcomfrom thomasdtpscom thomas w daysubject re the andromeda strainin article cpvplchinetchiilus dhartungchinetchiilus dan hartung writesjust had the opportunity to watch this flick on ae some yearssince i saw it last wow the wwii channel did something notwwiii was very interested in the technology demonstrated in this filmfor handling infectious diseases and similar toxic substancesclearly they faked a lot of the computer robotic technologycertainly at the time it was made most of that was science fictionitself let alone the idea of a space germ the graphics capabilities of the computers were very faked for movie audiences who have not ability or patience with numbers the book was more realistic in that respect in all respects actually the robotics are still out of range but not impossiblequite coincidentally actually this is what got me wanted to seethe movie again i watched a segment on the otherwise awful howdthey do that dealing with a disease researcher at the cdcs toplab there was description of the elaborate security measures takenso that building will never be cracked so to speak by man ornature short of deliberate bombing from the air perhaps andthe researchers used spacesuits similar to that in the filmsf and ive always wondered how crichton escapes this classification is usually ahead of science in both prediction and precaution nasas decontaimination processes were supposedly taken to prevent sf story disasters i mean nasa scientists were often sf readers and sometimes writers and felt prewarned by their readingim curious what people think about this film short of sillyis such a facility technically feasible today i think the film still holds up among the best of sf films but that isnt saying a whole lotas far as the plot and the crystalline structure that is not lifeas we know it thats a whole nother argument for recartssftechor somethingyepfrom calzoneathenamitedusubject re eumemics was eugenicsprobably within years it will be possible to disassemble andreassemble our bodies at the molecular level not only will flawlesscosmetic surgery be possible but flawless cosmetic psychosurgerywhat will it be like to store all the prices of shelfpriced barcodedgoods in your head and catch all the errors they make in the storesfavor at safeway what will it be like to mentally edit and spellcheck your responses to the questions posed by a phone caller sellingvacation timeshare optionsyou are absolutely daft no flame required you lack a brain sicmemes are the basic units of culture as opposed to geneswhich are the units of geneticswell at least youre educated it seems but give creditwhere credit is due to richard dawkins the meme is a meme he inventedzonefrom sheffnerencorecom steve heffnersubject herniaa bit more than a year ago a hernia in my right groin wasdiscovered it had produced a dull pain in that area the herniawas repaired using the least intrusive orthoscopic method and aplug and patchthe doctor considered the procedure a successa few months later the same pain returned the doctor said thathe could find nothing wrong in the area of the hernia repairnow the pain occurs more often my gp couldnt identify anyspecific problem the surgen who performed the original procedurenow says that yes there is a new hernia in the same area and hesaid that he has to cut into the area for the repair this timemy question to the net is there a nonintrusive method todetermine if in fact there is a hernia or if the pain is fromsomething elsesteve heffnerfrom davpaidaliuse david partainsubject candida albicans what is itsomeone i know has recently been diagnosed as having candida albicans a disease about which i can find no information apparently it has somethingto do with the bodys production of yeast while at the same time being highlyallergic to yeast can anyone out there tell me any more about itthanks david partain davpaidaliuseida university of linkoping work phone s linkoping sweden telefax from jildonutsuucp jamie lubinsubject re eye dominancein article pittuucp gebcspittedu gordon banks writesin article cegworldstdcom rsilverworldstdcom richard silver writesis there a righteye dominance eyedness as there is anoverall righthandedness in the population i mean do mostpeople require less lens corrections for the one eye than theother if so what kinds of percentages can be attached to thisthere is eye dominance same as handedness and usually for thesame side it has nothing to do with refractive error howeveri recall readingseeing that former baseball star chris chambliss hittingabilities were in part attributed to a combination of lefthandedness righteye dominancefrom donald mackie donaldmackiemedumichedusubject re barbecued foods and health riskin article aprclpdkodakcom rich youngyoungserumkodakcom writesstuff deleted have to consume unrealistically large quantities of barbecued meat at a timei have to confess that this is one of my few unfulfilled ambitionsno matter how much i eat it still seems realisticdon mackie his opinionfrom donald mackie donaldmackiemedumichedusubject re quality control in medicinein article bluecispittedu kenneth gilbertkxgstpittedu writessituation qa activities are a routine part of every hospitalsadministrative function and are required by accreditation agencies thereare even entire publications devoted to qa issuesindeed i spend about of my time dealing with quality stuff itis a hot number two journals worth looking at arequality review bulletin pubjoint commission on accreditation ofhealthcare organizations one renaissance boulevard oakbrookterrace il quality in health care bmj publishing group box no bkennebunkport me don mackie his opinionsum anesthesiology will disavowfrom turpincsutexasedu russell turpinsubject re science and methodology was homeopathy traditioni think that part of the problem is that i have proposed adefinition of science that i intended to be interpreted broadlyand that lee lady has interpreted fairly narrowly my definitionis this science is the investigation of the empirical that avoidsmistakes in reasoning and methodology discovered from previouswork lee lady writes i dont think that science should be defined in a way that some of the activities that lead to really important science namely thinking and informal exploration are not recognized as scientific work unless one classifies thinking and informal exploration as amistake they fall under my definition i hope no one wouldconsider speculation thinking and informal exploration asunscientific in article cnasfmhnewshawaiiedu ladyuhunixuhcchawaiiedu lee lady writes seriously im not sure whether i misjudged you or not in one respect i still have a major problem though with your insistence that science is mainly about avoiding mistakes here is where i think we are talking at crosspurposes it is notclear to me that the kind of definition i have proposed should betaken as describing what science is mainly about considerfor example a definition of invertebrates as all animals lackinga backbone this fairly tells what is an invertebrate andwhat is not an invertebrate but it hardly tells you whatinvertebrates are all about one can read this definition andstill not know that of all animal species are invertebratesthat invertebrates possess a remarkably broad range of form thatsome invertebrate groups such as insects and nematodes areubiquitous in all ecosystems etc in short knowing thedefinition of invertebrates does not tell one what they aremainly aboutthe misunderstanding here is my fault i did not give sufficientcontext for people to understand my proposed definition okay so lets see if we agree on this first of all there are degrees of certainty it might be appropriate for instance to demand carefully controlled trials before we accept as absolute scientific truth to the extent that there is any such thing the effectiveness of a certain treatment on the other hand highly favorable clinical experience even if uncontrolled can be adequate to justify a preliminary judgement that a treatment is useful secondly it makes sense to be more tolerant in our standards of evidence for a pronounced effect than for one that is marginal i agree on both counts as an example of the second it would onlytake a few cases of curing rabies to convince most veterinariansthat a treatment was effective despite a lack of controls as to the first i do not think it is useful to talk aboutabsolute scientific truth i think it is more useful to talkabout the kinds of evidence that various claims have and thekinds of evidence in particular fields that in the past haveproven faulty or reliable the latter is obviously a matter ofdegree and in each field practitioners try to discover therelevance of different kinds of evidence one of the primary mistakes that marks the advocacy of an idea aspsuedoscience is that the advocacy lacks any sense of proportionregarding the kinds of evidence related to the proposed claimthe kinds of evidence that are actually relevant to it and thehistorical reasons in the field that certain kinds of evidenceare given more weight than others it is perfectly alright tospeculate i have read quite a few refereed papers thatspeculated left and right but the authors were careful toidentify the notions as speculative to list what little evidencewas presently available for them and to describe how researchcould proceed to either put the notion on more firm footing or touncover its problems often what distinguishes whether a paperof this sort passes muster is the thoughtfulness with which theauthor sets the context and paves the way for future work itis in this area that many proponents of speculative ideas fail the folks over in scipsychology have a hundred and one excuses not to make this simple test they claim that only an elaborate outcome study will be satisfactory a study of the sort that nlp practitioners many of whom make a barely marginal living from their practice can ill afford to do most of them are also just plain not interested because the whole idea seems frivolous and since theyre not part of the scientific establishment they have no tangible rewards to gain from scientific acceptance i think a lot of scientists steer away from things that deserving or not garner a patina of kookiness whenproponents of some practice see no value in more carefulinvestigation of that practice that sets alarms ringing in manyresearchers minds this is unfortunate because there is undoubtedly someintersection between things that are worth investigating andthings that are advocated by those who seem careless orunreasonable in their advocacy on the other hand i canunderstand why many scientists would just as soon select otherdirections for research as gordon banks has pointed out no onewants to become this generations rhine one academic in scipsychology said that it would be completely unscientific for him to test the phobia cure since it hasnt been described in a scientific journal i think this is absurd actually at least one fairly careful academic study has been done with favorable results but its apparently not acceptable because its a doctoral dissertation and not published in a refereed journali wonder why the results were not published in my fielddissertation results are typically summarized in papers that aresubmitted to journals often the papers are accepted forpublication before the dissertation is finished this certainlyeases ones defensefinally i hope lee lady will forgive me from commenting eitheron nlp or the discussion of it in scipsychology i know littleabout either and so have nothing to offerrussellfrom probertsinformixcom paul robertssubject re too many mrisin article aprkestreledu kingreasoningcom dick king writesi recall reading somewhere during my youth in some science popularizationbook that whyle isotope changes dont normally affect chemistry a consumptionof only heavy water would be fatal and that seeds watered only with heavywater do not sprout does anyone know about thisi also heard this i always thought it might make a good eposide ofcolumbo for someone to be poisoned with heavy water it wouldntshow up in any chemical testfrom kutuzovavenusitebserpukhovsusubject the reseaching of starvationi am very interested in investigations of starvation for improving healthi am the young russian reseacher and have highest medical education and expierence in reseach work in biological field and would like to work on this problemcan anybody send me the adresses of the hospitals or medical centers where scientific problems of human starvation for the health are investigated also i would like to set scientific contacts with colleagues whodeals with investigations in this fieldi would be very appreciated anyone reply me pls contact by post russia moscow region puschino po box for kravchenko n or by email kutuzovavenusitebserpukhovsu thank you advance natalja kravchenko from wcsbeaualfredcarletonca opirgsubject re is msg sensitivity superstitionin article aprspdcccom dyerspdcccom steve dyer writesin article aprcunewscarletonca wcsbeaualfredcarletonca opirg writesthere has been no hard info provided about msg making people illthats the point after allwhy dont you just look it up in the merk or check out the medical dictionarycite which a doctor mentioned earlier in this threadthats because these peerreviewed studies are not addressingthe effects of msg in people theyre looking at animal modelsyou cant walk away from this and start ranting about gloom anddoom as if there were any documented deleterious health effectsdemonstrated in humans note that i wouldnt have any argumentwith a statement like noting that animal administration has produced the following blah blah we must be careful about itsuse in humans this is precisely not what you saidamong others see olneys excitotoxic food aditives relevance ofanimal studies to human safety neurobehav toxicol teratolvol im sure peta would love to hear your argumentstests have been done on rhesus monkeys as well i have never seen astudy where the mode of administration was intraventricular the gluand asp were administered orally some studies used iv and scintraventricular is not a normal admin method for food tox studiesfor obvious reasons you must not have read the peerreviewed worksthat i referred to or you would never have come up with this braininjection bunkit most certainly is for neurotoxicology you know studies ofglutamate involve more than food sciencewhose talking about food science what is this comment supposed tomean neurotoxicology and tratology brain research natureprogress in brain research all fine food science journals pardon me but where are you getting this from have you read thejournals have you done a thorough literature searchso point us to the studies in humans please im familiar withthe literature and ive never seen any which relate at all toolneys work in animals and the effects of glutamate on neuronsthen you would know that olney himself has casually referred tochinese restaurant syndrome in a few articles why dont you pointus to some studies maybe then this exchange could be productivethe point is exceeding the window of course theyre amino acidsnote that people with pku cannot tolerate any phenylalaninewell actually they have to tolerate some phenylalanine its aessential amino acid they just try to get as little as is healthywithout producing dangerous levels of phenylalanine and its metabolitesin the bloodtheyre unable to metabolise itolneys research compared infant human diets specifically the amountof freely available glu in mothers milk versus commercial baby foodsvs typical lunch items from the standard american diet such as packagedsoup mixes he found that one could exceed the projected safety marginfor infant humans by at least fourfold in a single meal of processedfoods mothers milk was well below the effective dosegoodness im not saying that its good to feed infants a lot ofglutamatesupplemented foods its just that this projected safetymargin is a construct derived from animal models and given thatyou can prove anything you like were talking prudent policy ininfant nutrition here yet youre misrepresenting it as received wisdomwho said anything about received wisdom there is no question thatorally administered doses of msg are capable of destroying nearly allneurons in the arcuate nucleus of the hypothalamus and the medianeminence these areas are responsible for the production ofhormones critical to normal neuroendocrine function and the normaldevelopment of the vertabrate organism humans are vertebrates nowwhat pray tell do you think will happen when the area of the brainnecessary for the normal rhythm of gonadotropin release is missingare you trying to say that humans have no need of their pituitaryanh and me of that part of the brain that is responsible forcontrolling the realease albeit indirectly of estradiol and testosterone how do you expect anyone to do the studies on this its unethical tosacrifice humans to check out what effects chronic acute etc dosesof these compounds are having on the brain tissue in humans the foodindustry knows this thats why the animal model is used in medicineand psych if youre talking about straight sensitivity it would beuseful to define the term there are plenty of studies onpsychoneuroimmunology showing the link between attitude andphysiologyi suspect we may be arguing about separate things only adult sensitivitiesyou and lateoccuring sequelae of childhood ingestion and itsimplication for adults me certainlythe doses for excitotoxicity in adults are considerably larger thanfor the young but the additivity of glu and asp and their copiousand increased presence in modern processed foods jointly and theirhidden presence in hvp necessitates extreme caution why would anyonewant to eat compounds which have been shown to markedly perturb theendocrine system in adults the main point is blood levelsattained and oral doses would likely have to be greater than sc between who over what i would be most interested in seeing youprovide peerreviewed nonfoodindustryfunded citations to articlesdisputing that msg has no effects whatsoever you mean asserting youre being intellectually dishonest or justplain confused because youre conflating reports which do not necessarilyhave anything to do with each other olneys reports would argue a potentialfor problems in human infants but thats not to say that this says anythingwhatsoever about the use of msg in most foods nor does he provide anystudies in humans which indicate any deleterious effects for obviousreasons it says nothing about msgs contribtion to the phenomenonof the chinese restaurant syndrome it says nothing about the frequentinability to replicate anecdotal reports of msg sensitivity in the labolneys work provides a putative causal mechanism for somesensitivities terry epelbaum and martin have shown that orallyadministered msg causes changes in normal gonadotropic hormonefluctutations in adults glu also was found to induce immediate and persistantsupression of rhythmic gh secretion and to induce rapid and transientrelease of prolactin in adults chronically exposed to msg gh isresponsible not only for control of growth during development butalso converts glycogen into glucose could this be the cause ofheadaches i dont knowdyerursamajorspdcccom hmm com why am i not surprised dianne murray wcsbeauccscarletoncaprobably one of the dumber remarks youve madeif you had read olneys review article especially the remarks ialready quoted in an earlier post you would know to what i wasalluding may i ask exactly for whom you do computer consulting from bebmzasruchvpkhchevroncom beverly m zalansubject re frequent nosebleedsin article aprfreenetcarletonca abfreenetcarletonca robert allison writes i have between and nosebleeds each week as a result of a genetic predisposition to weak capillary walls oslerweberrendu fortunately each nosebleed is of short duration does anyone know of any method to reduce this frequency my younger brothers each tried a skin transplant thigh to nose lining but their nosebleeds soon returned ive seen a reference to an herb called rutin that is supposed to help and id like to hear of experiences with it or other techniques my year son is so plagued lots of vaseline up his nose each night seems to keep it under control but let him get bopped there and hell recur for days also allergies colds dry air all seem to contribute but again the vaseline or ad ointment or neosporin all seem to keep them from recurringbev zalanfrom ronrothrosecom ron rothsubject selective placebok kingreasoningcom dick king writeskk rr ronrothrosecom ron roth wrotek rr otoh who are we kidding the new england medical journal in k rr ran the heading ninety percent of diseases are not treatable byk rr drugs or surgery which has been echoed by several other reportsk rr no wonder mds are not amused with alternative medicine sincek rr the magic of the placebo effect would award alternative k rr practitioners twice the success rate of conventional medicinek k of diseases is not the same thing as of patientsk k in a world with one curable disease that strikes people and ninek incurable diseases which strikes one person each medical science will curek of the patients and report that of diseases have no therapyk k a disease would be counted among the untreatable if nothing better thank a placebo were known of course mds are ethically bound to not knowinglyk dispense placebosk k dk hmmm even without the at the end i didnt think anyone was going to take the mathematics or statistics of my post seriously i only hope that you had the same thing in mind with your post otherwise you would need at least two s at the end to help anyone understand your calculations above ron rosereader p this mind intentionally left blank rosemail usenet rose media hamilton from rousseauaimmunexcomsubject re barbecued foods and health riskwhile in grad school i remember a biochemistry friend of mine working withheat shock proteins apparently burning protein will induce changes in hedna whether these changes survive the denaturing that occurs during digestioni dont know but i never eat burnt food because of this also many woods contain toxins as they are burnt it would seem logical thatsome may volatilise and get into the bbqed food again i dont know if thesetoxins antifungal and antiwoodeater compounds would survive the rather harshconditions of the stomach and intestine and then would they be able to crossthe intestinal mucosamaybe someone with more biochemical background than myself which is almostanyone can shed some light on heat shock proteins and the toxins thatmay be in the wood used to make charcoal and bbqannemarie rousseauemail rousseauaimmunexcomwhat i say has nothing to do with immunexfrom todamhypcharlesunlvedu brian m hueysubject krillean photographyi think thats the correct spellingi am looking for any informationsupplies that will allowdoityourselfers to take krillean pictures im thinkingthat education suppliers for schools might have a appartus forsale but i dont know any of the companies any info is greatlyappreciatedin case you dont know krillean photography to the best of myknowledge involves taking pictures of an most of the time organicobject between charged plates the picture will show energy patternsor spikes around the object photographed and depending on what typeof object it is the spikes or energy patterns will vary one mightextrapolate here and say that this proves that every object withinthe universe as we know it has its own energy signature disclaimer i can neither confirm nor deny any opinionsexpressed in this article directly reflect my own personal orpolitical views and furthermore if they did i would not be atliberty to yield such an explanation of these alleged opinionsfrom dyerspdcccom steve dyersubject re foodrelated seizuresmy comments about the feingold diet have no relevance to yourdaughters purported frostedflakesrelated seizures i cant imaginewhy you included it steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom pchurchswellactrixgennz pat churchillsubject re eye dominance in article cegworldstdcom rsilverworldstdcom richard silver writes is there a righteye dominance eyedness as there is an overall righthandedness in the population i mean do most people require less lens corrections for the one eye than the other if so what kinds of percentages can be attached to thisi have a long sighted eye and a short sighted eye my right eye tendsto cut out when i look at distant things my left eye when i am closeup i had specs to balance things up a bit but could do without themi thought that one way or another i would always be able to seeclearly unfortunately middle age is rearing its ugly head and i canno longer see close up objects clearly maybe its just that my armsare getting shorter the floggings will continue until morale improves pchurchswellactrixgennz pat churchill wellington new zealand from rindenterprisebihharvardedu david rindsubject re adult chicken poxin article cpmobdofeenixmetronetcom marcbgfeenixmetronetcom marc grant writesall over my bod at what point am i no longer infectious my physiciansoffice says when they are all scabbed over is this trueyesis there any medications which can promote healing of the pox speed uphealingacyclovir started in the first days probably speeds recovery anddecreases the formation of new pox david rindrindenterprisebihharvardedufrom wsunjeevesucsdedu fibermansubject re is msg sensitivity superstitioni have heard that epileptic patients go into seizures if theyeat anything with msg added this may have something to do withthe excitotoxicity of neuronsfmfrom menonbouldercoloradoedu ravi or deantha menonsubject re eye dominancenyedacnsvaxuwecedu david nye writesreply to rsilverworldstdcom richard silver is there a righteye dominance eyedness as there is an overallrighthandedness in the population i mean do most people require lesslens corrections for the one eye than the other if so what kinds ofpercentages can be attached to this thanks there is an eyedness analogous to handedness but it has nothing to dowith refractive error to see whether you are right or left eyed rollup a sheet of paper into a tube and hold it up to either eye like atelescope the eye that you feel more comfortable putting it up to isyour dominant eye refractive error is often different in the two eyesbut has no correlation with handedness david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellwhat do you mean more comfortable putting it up to that seems a bithard to evaluate at least for me it is stare straight point with both hands together and clasp so that only thepointer fingers are pointing straight forward to a a spot on the wall abouteight feet away first stare at the spot with both eyes open nowclose your left eye now open your left eye now close your right eyenow open your right eyeif the image jumped more when you closed your right eye you are righteye dominantif the image jumped more when you closed your left eye you are left eyedominantdeanthafrom lundbyrtsgmotcom walter f lundbysubject re is msg sensitivity superstitionas nobody in the food industry has even bothered to address my previousquestion why do you need to put msg in almost every food i must assumethat my wifes answer is closer to the truth than i hoped it wasshe believes that msg is added to food to cause people to eat more of itand not quit when they shoud be sated to put it a different way she believes that for some people msg causes them to act toward food like an addict eat all the chips chow down on several packages of noodle soup you get theidea if she is right then the moral and ethical standards of the food chemical and regulatory groups need to be addressed can msgbe considered a conditioning substance not addictive but sort of habitforming this brings up a side question of mine i have noticed that cats mychildrens and my parents seem to fixate on a particular brand of petfood the cat will eat any product within one brand and not any otherbrand i have wondered if this is not a case of preference but somesort of chemical training or addiction my questions for the net aredoes the fda regulate the contents of pet food is it allowed for petfood to contain addictive or conditioning substances is msg put in pet foodi speak for myself and not motorola walter lundbyfrom tarlswstratuscom tarl neustaedtersubject re krillean photographyin article aprunlvedu todamhypcharlesunlvedu brian m huey writes i think thats the correct spellingthe proper spelling is kirlian it was an effect discoverd bys kirlian a soviet film developer in as i recall the coronas visible are ascribed to static dischargesand chemical reactions between the organic material and the silverhalides in the films tarl neustaedter stratus computer tarlswstratuscom marlboro massdisclaimer my employer is not responsible for my opinionsfrom leisnerwrcxeroxcom marty leisner subject intravenous antibioticsi recently had a case of shingles and my doctors wanted to give meintravenous acyclovirit was a pain finding iv sites in my armscan i have some facts abouthow advantageous it is to give intravenous antibiotics rather than oralmartyfrom sppzabriskieberkeleyedu steve popesubject re is msg sensitivity superstitionbetty harvey writes i am not a researcher or a medical person but it amazes me that when they cant find a scientific or a known fact they automatically assume that the reaction is psychological it is mind bogglingthis simply stated is a result of the bankrupt ethics inthe healthcare and scientific medicine industriesamerica is fed up with the massive waste and fraud that is costingus of our gnp to support these industries while delivering marginal health care to the communityunfortunately the clinton plan in whatever form ittakes will probably cost us an even greater sum bleahstevefrom evanhscocom evan huntsubject re is msg sensitivity superstitionin article aprscocom evanhscocom evan hunt writes in article apriscnvxlmsclockheedcom shareniscnvxlmsclockheedcom sharen a rund writes restaurants advertize no msg many restaurants that feature saladbars use msg to keep the veggies looking fresh longer also a number this brings up an important question for me could premade salads thekind sold in supermarkets have msg added without mentioning it legallyi mean anyone know what the law is in this areasteve dyer points out that sharen was probably thinking of sulfites butthe question still stands evan hunt asst editor the webfor more information about the web email to evanhscocomfrom skiwpiwpiedu joseph mich krzeszewskisubject re krillean photographyi seem to recall that there was an article in radio electronics about thissubject in fact i have a copy of the article in front of me but i cantfind anywhere in the article a refrence as to what month it was in the systemthey describe uses an automobile ignition coil for the high voltage the article even includes some information on what kind of film to use and where to get it hope this helpsjoseph m krzeszewskiskiwpiwpiedufrom klieriscsvaxuniedusubject re how about a crash program in basic immunological researchin article kybuucp kmkybpghpaus ken mitchum writes as a physician i almost never get sick usually when something horrendous is going around i either dont get it at all or get a very mild case when i do get really sick it is always something unusual this was not the situation when i was in medical school particularly on pediatrics pediatrics for me was three solid months of illness and i had a temp of when i took the final exam i think what happens is that during training and beyond we are constantly exposed to new things and we have the usual reactions to them so that later on when challenged with something it is more likely a reexposure for us so we deal with it well and get a mild illness this is also commonly seen in new teachers the first few years theyresick a lot but gradually seem to build up immunities to almost everythingcommon come to think of it i was about my healthiest when i wasworking in a pathogens lab exposed to whoknowswhat all the time preoshaof coursekay klier biology dept uni from kxgstpittedu kenneth gilbertsubject re intravenous antibioticsin article aprspectrumxeroxcom leisneresomcxeroxcom writesi recently had a case of shingles and my doctors wanted to give meintravenous acyclovirit was a pain finding iv sites in my armscan i have some facts abouthow advantageous it is to give intravenous antibiotics rather than orali think some essential information must be missing here ie you must besuffering from a condition which has caused immunosuppression there isno indication for iv acyclovir for shingles in an otherwise healthyperson the oral form can help to reduce the length of symptoms and mayeven help prevent the development of postherpetic neuralgia but icertainly would not subject someone to iv therapy without a good reasonto address your more general question iv therapy does provide higher andmore consistently high plasma and tissue levels of a drug for treating aserious infection this is the only way to be sure that a patient isgetting adequate drug levels kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from mmmcupportalcom mark robert thorsonsubject re barbecued foods and health risk i dont understand the assumption that because something is found to be carcinogenic that it would not be legal in the us i think that naturally occuring substances excluding controlled substances are pretty much unregulated in terms of their use as food food additives or other consumption its only when the chemists concoct sp an ingredient that it falls under fda regulations otherwise if they really looked closely they would find a reason to ban almost everything how in the world do you suppose its legal to consume tobacco products which probably should be bannedno there is something called the delany amendment which makes carcinogenicfood additives illegal in any amount this was passed by congress in thes before stuff like mass spectrometry became available which increaseddetectable levels of substances by a couple orders of magnitudethis is why things like cyclamates and red were banned they are veryweakly carcinogenic in huge quantities in rats so under the act they arebannedthis also applies to natural carcinogens some of you might remember atime back in the s when root beer suddenly stopped tasting so goodand never tasted so good again that was the time when safrole was bannedthis is the active flavoring ingredient in sassafras leavesif it were possible to market a root beer good like the old days someonewould do it in order to make money the fact that no one does it indicatesthat enforcement is still in effectan odd exception to the rule seems to be the product known as gumbo filethis is nothing more than coarsely ground dried sassafras leaves thisis not only a natural product but a natural product still in its naturalform so maybe thats how they evade delany or maybe a special exemptionwas made to appease powerful louisiana democratsfrom twaincarsonuwashingtonedu barbara hlavinsubject re is msg sensitivity superstitionin article aprrtsgmotcom lundbyrtsgmotcom walter f lundby writesas nobody in the food industry has even bothered to address my previousquestion why do you need to put msg in almost every food i must assumethat my wifes answer is closer to the truth than i hoped it wasi dont mean to be disrespectful to your concerns but it seems to me that youre getting all wound up in a nonissue as many knowledgeable people have pointed out msg is a naturally occurring substance in a lot if not most foods when food manufacturers add it to a preparation they do so because its a known flavor enhancer your wifes theory that msg is added to food to stimulate appetite may well be true but i dont believe its always the reason its added people are largely for the most part in charge of their own appetites childrens and my parents seem to fixate on a particular brand of petfood the cat will eat any product within one brand and not any otherbrand i have wondered if this is not a case of preference but somesort of chemical training or addiction my questions for the net aredoes the fda regulate the contents of pet food is it allowed for petfood to contain addictive or conditioning substances is msg put in pet foodyou dont know much about cats do you cats will take advantage of you resign yourself you will never understand a cat their tastes are whimsical i also suspect though its been a while since ive checked ingredients on commercial cat food that there are much more stringent requirements on pet food additives than human see the fda has this stupid idea that human beings have the intelligence to look out after their own interests barbara wondering how her cat would take care of herfrom kaminskinetcomcom peter kaminskisubject re krillean photographynewsgroups mha added followups set to most appropriate groupsin aprunlvedu todamhypcharlesunlvedu brian mhuey writesi am looking for any informationsupplies that will allowdoityourselfers to take krillean picturesits kirlian krillean pictures are portraits of tiny shrimp one might extrapolate here and say that this proves that every objectwithin the universe as we know it has its own energy signaturei think its safe to say that anything thats not at degrees kelvinwill have its own energy signature the interesting questions arewhat kind of energy and what it signifiesid check places like edmund scientific are they still in business or i wonder if you can find exsoviet union equipment for sale somewherein the relcom hierarchysome expansion on kirlian photographyfrom the credulous side stanway andrew alternative medicine a guideto natural therapies isbn new york viking penguin p p a notoverly critical but still useful overview of alternative health therapies the russian engineer semyon kirlian and his wife valentina during the s using alternating currents of high frequency to illuminate their subjects they photographed them they found that if an object was a good conductor such as a metal the picture showed only its surface while the pictures of poor conductors showed the inner structure of the object even if it were optically opaque they found too that these high frequency pictures could distinguish between dead and living objects dead ones had a constant outline whilst living ones were subject to changes the objects life activity was also visible in highly variable colour patterns high frequency photography has now been practised for twenty years in the soviet union but only a few people in the west have taken it up seriously professor douglas dean in new york and professor philips at washington university in st louis have produced kirlian photographs and others have been produced in brazil austria and germany using kirlian photography it is possible to show an aura around peoples fingers notably around those of healers who are concentrating on healing someone normally blue and white rays emanate from the fingers but when a subject becomes angry or excited the aura turns red and spotty the soviets are now using kirlian photography to diagnose diseases which cannot be diagnosed by any other method they argue that in most illnesses there is a preclinical stage during which the person isnt actually ill but is about to be they claim to be able to foretell a disease by photographing its preclinical phase but the most exciting phenomenon illustrated by kirlian photography is the phantom effect during high frequency photography of a leaf from which a part had been cut the photograph gave a complete picture of the leaf with the removed part showing up faintly this is extremely important because it backs up the experiences of psychics who can see the legs of amputees as if they were still there the important thing about the kirlian phantoms though is that the electromagnetic pattern cant possibly represent a secondary phenomenon or the field would vanish when the piece of leaf or leg vanished the energy grid contained in a living object must therefore be far more significant than the actual object itself kirlian photography has shown how water mentally charged by a healer has a much richer energy field around it than ordinary waterfrom the incredulous side macrobert alan reality shopping aconsumers guide to new age hokum whole earth review autumn vnon p an excellent article providing commonsense guidelines forevaluating paranormal claims and some of the authors favorite examplesof hokum the crank usually works in isolation from everyone else in his field of study making grand discoveries in his basement many paranormal movements can be traced back to such people kirlian photography for instance if you pump highvoltage electricity into anything it will emit glowing sparks common knowledge to electrical workers and hobbyists for a century it took a lone basement crank to declare that the sparks represent some sort of spiritual aura in fact kirlian photography was subjected to rigorous testing by physicists john o pehek harry j kyler and david l faust who reported their findings in the october issue of science their conclusion the variations observed in kirlian photographs are due solely to moisture on the surface of the body and not to mysterious auras or even necessarily to changes in mood or mental state nevertheless television shows magazines and books many by famous parapsychologists continue to promote kirlian photography as proof of the unknown peter kaminskikaminskinetcomcomsubject what are knotsfrom nghuscharvardedu ho leung ng what exactly are knots those sore tight spots in your musclesin certain kinds of massage people try and break up these knots it thisreally helpfulho leung ngnghuscharvardedufrom kiranvillagecom kiran waglesubject re barbecued foods and health riskmark mcwiggins markmchalcyoncom reminds usmm also dont forget that its better for your health mm to enjoy your steak than to resent your sprouts yesi call this notion psychological health food and in fact havedetermined that the four food groups are ice cream pizza barbecue andchocolate ideally every meal should contain something from at least twoof these four groups food does serve functions other than nutrition andone of them is keeping the organism happy and thus aiding its immunesystem and i didnt spend a million bucks commissioning a study that told me toredraw my silly little pyramid in different colors and with a friendliertypeface either ref consumer reports back pageone of the bestthings ever to turn up thererich young youngserumkodakcom writes of one of six impossible thingsry to consume unrealistically large quantities of barbecued meat at a timedonald mackie donaldmackiemedumichedu confessesdm i have to confess that this is one of my few unfulfilled ambitionsdm no matter how much i eat it still seems realisticyeah i want to try one of those oz steaks cooked over applewood atwallys wolf lodge inn in coeur dalene that seems quiteunrealisticunrealistically small and a few slabs of ribs from the easttexas smoker rip again in louisville is not at all unrealistic either what say we have a recfoodcooking dinner at the moonlite barbque inn inowensboro its all you can eat including lamb ribs mutton for about we could invite julie kangas as guest of honor and see if themoonlites very hot sauce is too hot for her it is too hot for me and idont say that very often and she could bring ice cream with crusheddried chiltepins for dessert and we could see if there is such a thing as an unrealistically largequantity of barbecuethe owner of the moonlite estimates that theowensboro restaurants serve a hundred thousand pounds of meat a week in thesummer and forty thousand in the winterin a town of or so twopounds per person per week again sure sounds unrealistic to methatsjust too meager to be healthy kiran now a twopound slab of ribs a day thats realistic fuzzy pink nivens law never waste calories potato chips candywhipped cream or hot fudge sundae consumption may involve you yourdietician your wardrobe and other factors but fuzzy pinks law impliesdont eat soggy potato chips or cheap candy or fake whipped cream or aninferior hot fudge sundae larry niven nivens laws nspacefrom mcovingtaisunaiugaedu michael covingtonsubject re frequent nosebleedsin article aaseastarseashell bebmzasruchvpkhchevroncom beverly m zalan writesmy year son is so plagued lots of vaseline up his nose each night seems to keep it under control but let him get bopped there and hell recur for days also allergies colds dry air all seem to contribute but again the vaseline or ad ointment or neosporin all seem to keep them from recurringif you can get it you might want to try a canadian overthecounter productcalled secaris which is a watersoluble gel compared to vaseline or othergreasy ointments secaris seems more compatible with the moisture thatsalready there michael a covington associate research scientist artificial intelligence programs mcovingtaiugaedu the university of georgia phone athens georgia usa amateur radio ntmi from myerscsscarolinaedu daniel myerssubject re is msg sensitivity superstitionfrequently of late i have been reacting to something added torestaurant foods what happens is that the inside of my throat startsto feel puffy like i have a cold and also at times the inside of mymouth especially the tongue and lips also feel puffythe situations around these symptoms almost always involve restaurantsusually chinese the most notable cases a cheap chinese fast foodchain a japanese steak house i had the steak and another chinesefast food chain where i saw the cook put about a tablespoon or two ofwhat looked like sugar or salt into my fried ricei am under the impression that msg enhances flavor by causing thetaste buds to swell if this is correct i do not find it unreasonableto assume that high doses of msg can cause other mouth tissues to swellalso as the many of the occurances including two of the aboveinvolved beef and as beef is frequently tenderized with msg this iswhat i suspect as being the causei wouldnt be at all surprised if toxicity studies of msg in animalsshowed it as being harmless as it would be very startling to hear a labrat or rhesus monkey complain about their throats feeling funnyanyone who wishes to explain how the majority of food additives aretotally harmless is welcome to email me with the results of any studiedthey know of i will probably respond to them however with a reminderof how long it took to prove that smoking causes cancer which thetobacco companies still deny dmif i sound grumpy its because i had beef with broccoli for lunchtoday and now it hurts to swallowdan myers madman if the creator had intended us to walk myersusceastcsscarolinaedu upright he wouldnt have given us knucklessubject origin of morphinefrom chinszeiscalstateedu christopher hinszi am sorry to once again bother those of you on this newsgroup if you have any suggestions as to where i might find out about the subjectof this letter the origin of morphine ie who first isolsted it and whyheshe attempted such an experiment once agian any suggestion would beappreciatedcshps my instructer insists that i get rescources from this newsgroup soplease send me and info you think may be helpful facts that you knowbut dont know what book theyre from are okattention if you do not like seeing letters such as this one on yournewsgroup direct all complaints to my instructor at bshaylereiscalstatedu kilimanjaro is a pretty tricky climb most of its up until you reachthe very very top and then it tends to slope away rather sharplysir george head obe jclogic the point is frozen the beast is dead what is the differencegavin millarrrrrrrrrr jcfrom nyedacnsvaxuwecedu david nyesubject re obgyn residencyreply to gebcspittedu gordon banks i believe it is illegal for a residency to discriminate against fmgs is that true i know some that wont even interview fmgs i think a case could be made that this is discriminatory particularlyif an applicant had good board scores and recommendations but wasntoffered an interview but i dont know if it has ever gone to court david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom nyedacnsvaxuwecedu david nyesubject re krillean photographyreply to todamhypcharlesunlvedu brian m huey i think thats the correct spelling kirilian the picture will show energy patterns or spikes around the objectphotographed and depending on what type of object it is the spikes orenergy patterns will vary one might extrapolate here and say that thisproves that every object within the universe as we know it has itsown energy signature there turned out to be a very simple conventional explanation for thephenomenon i cant recall the details but i believe it had to do withthe object between the plates altering the field because of purelymechanical properties like capacitance the aura was caused by directexposure of the film from variations in field strength david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom msternlindsayprincetonedu marlene j sternsubject recurrent respiratory papillomatosiswe will be holding a bake and craft sale at communiversity in princeton on nassau street saturday april th pm to benefit the recurrent respiratory papillomatosis foundation a nonprofit foundation established to encourage research toward a cure for recurrent respiratory papillomatosis our three year old daughter suffers from this disease below is a press release that appeared in local newspapers hope you can join uson saturday april as part of communiversity in princeton a local family will be having a bake and craft sale to raise money for and create public awareness about a rare disease called recurrent respiratory papillomatosisbill and marlene sterns daughter lindsay is afflicted with this disease characterized by tumors attacking the inside of the larynx vocal cords and trachea caused by a virus the tumors grow block the air passages and would lead to death from suffocation without continual surgery to remove the growths three year old lindsay has undergone operations thus far since her diagnosis last year and faces the prospect of over a hundred operations throughout her lifetime even though the disease is hardly a household word it has affected the lives of enough people to inspire the formation of the recurrent respiratory papillomatosis foundation a nonprofit foundation whose goals are to provide support for patients and families by networking patients and publishing a newsletter enhance awareness of rrp at the local and national level and aid in the prevention cure and treatmentsince medical researchers know that the virus causing the disease is similar to those viruses causing warts they feel a cure would be within reach if money were available for research because rrp is rare it not only gets scant attention but also paltry funds to search for a cure part of the rrp foundations mission is to change that anyone interested in contributing items to the bake and craft sale please call marlene or bill at monetary donations can be made at the foundations booth during communiversity april th to pm in downtown princeton or sent directly tothe recurrent respiratory foundation wesleyan drive hamilton sq nj thanks msternlindsayprincetonedufrom mednusunixnussg wansaicheong khinlinsubject re morbus meniere is there a real remedyit would be nice to think that individuals can somehow beat the systemand like a space explorer boldly go where no man has gone before andreturn with a prize cure unfortunately too often the prize is limitedand the efficacy of the cure questionable when applied to allsufferersthis applies to both medical researchers and nonmedical individualsjust because it appears in an obscure journal and may be of some usedoes not make the next cureall what about the dozens of individualswho have courageously participated in clinical trials did they have anyguarentee of cures are they any less because they didnt trumpet theirstory all over the worldas a parting note wasnt there some studies done on gingko seeds formenieres to the original poster what about trying for a trial ofthat its probably not a final answer but it certainly may alleviatesome of the discomfort and youd be helping answer the question forfuture sufferersgervaisfrom doylepittedu howard r doylesubject re herniain article cqopxmqencorecom sheffnerencorecom steve heffner writesa bit more than a year ago a hernia in my right groin wasdiscovered it had produced a dull pain in that area the herniawas repaired using the least intrusive orthoscopic method and aplug and patchi suspect you mean laparoscopic instead of orthoscopicnow the pain occurs more often my gp couldnt identify anyspecific problem the surgen who performed the original procedurenow says that yes there is a new hernia in the same area and hesaid that he has to cut into the area for the repair this timemy question to the net is there a nonintrusive method todetermine if in fact there is a hernia or if the pain is fromsomething elseby far the still best method to diagnose a hernia is old fashionedphysical examination if you have an obvious hernia sac coming down into your scrotum or a bulge in your groin that is brought about byincreasing intraabdominal pressuresometimes is not that obvious the hernia is small and you can only detect it by putting your finger into the inguinal canal whether you have a recurrent hernia or this is related to the previousoperation i cant tell you the person that examined you is in the bestposition to make that determinationare there noninvasive ways of diagnosing a hernia every now and then folks write about ct scans and ultrasounds for this but these are fartoo expensive and unlikely to be better than a trained examining fingerhoward doyledoylepittedufrom mednusunixnussg wansaicheong khinlinsubject re lasers for dermatologistsit is not true that dermatologists gave not reached the laser age infact lasers in dermatological surgery is a very new and exciting fieldit probably wont be effective in tinea pedis because the laser isusually a superficial burn to avoid any deeper damage limited tineapedis can be cured albeit sometimes slowly by topical antifungals aswell as systemic medication ie tablets finally a selfdiagnosis isnot always reliable lichen simplex chronicus can look like a fungalinfection and requires very different treatmentgervaisfrom jerprefectccbellcorecom rathmannjanice esubject re eye dominancein article aprporthosccbellcorecom jildonutsuucp jamie lubin writes in article pittuucp gebcspittedu gordon banks writes in article cegworldstdcom rsilverworldstdcom richard silver writes is there a righteye dominance eyedness as there is an overall righthandedness in the population i mean do most people require less lens corrections for the one eye than the other if so what kinds of percentages can be attached to this there is eye dominance same as handedness and usually for the same side it has nothing to do with refractive error however i recall readingseeing that former baseball star chris chambliss hitting abilities were in part attributed to a combination of lefthandedness righteye dominance i was part of a study a few years ago at the university of arizona tosee whether cross dominant individuals those with a particular handednessbut who had dominance in the opposite eye were better hitters thanthose with same side dominance of hand and eye i was picked frommy softball class because i was cross dominant right hand left eyewhich put me in a small minority and the grad student was trying to getan equal number of cross dominant and same side dominant people tocontrol the study she used a pitching machine fast pitch sincei was used to slow pitch i didnt come close actually i thinki foul tipped a few to hitting the ball if there were a lot of peoplelike me in her study ie those who cant hit fast pitch or arenot used to hitting off a machine i would seriously question theresults of that study i think there have been some studies of majorleague players across a fairly large cross section of players to testwhether eye dominance being the same or opposite side was better but i dont know the results the woman who ran the study i was insaid that there was a higher incidence of crossdominance in majorleaguers than across the general population but im not surewhether id believe herjanice rathmannfrom plebrunminfminfvubacbe philippe lebrunsubject re bursitis and laser treatmentin article aprfreenetcarletonca abfreenetcarletonca robert allison writes my family doctor and the physiotherapist pt she sent me to agree that the pain in my left shoulder is bursitis i have an appointment with an orthpod i love that its short for orthopedic surgeon apparently but while im waiting the pt is treating me shes using hot packs ultrasound and lasers but theres no improvement yet in fact i almost suspect its getting worse my real question is about the laser treatment i cant easily imagine what the physical effect that could have on a deep tissue problem can anyone shed some light so to speak on the matterif it works its only due to the heat produced by the laserphilippefrom francisircamfr joseph francissubject re krillean photographyin article aprunlvedu todamhypcharlesunlvedu brian m huey writesi think thats the correct spellingcrulleriani am looking for any informationsupplies that will allowdoityourselfers to take krillean pictures im thinkingthat education suppliers for schools might have a appartus forsale but i dont know any of the companies any info is greatlyappreciatedcrullerian photography isnt educational except in a purely satiricsensein case you dont know krillean photography to the best of myknowledge involves taking pictures of an most of the time organicobject between charged plates the picture will show energy patternsor spikes around the object photographed and depending on what typeof object it is the spikes or energy patterns will vary one mightextrapolate here and say that this proves that every object withinthe universe as we know it has its own energy signaturecrullerian photography involves putting donuts between greasecoveredhot metal plates while illuminating them with a krypton stroboscopethrough a unique iteration involving the thdimensional projection ofa torus through the semistochastic interactions of hot monomolecularlipid layers covering the metal plates the best metal is iron sinceit repels vampires and succubi the donuts start developing flutesand within moments actually become polycrenellated hot greasybreadtubes some people believe that food is the way to a mans heartbut most psychics agree that there is nothing like hot crullers forbreakfast the chemical composition of crullers is a mystery somethought evidence of charles forts channeling in stevie wondersproduction of the secret life of plants when played backwards in thetheatre of unnaturally fertile findhorn farms has deduced that theyare complex carbohydrates ordinarily only found by spectoscopy in themagellenic clouds i called devi on my orgone box and asked her ifthis was really the case and she tm levitated me a letter across theatlantic to tell me it was indeed not just another case ofmisunderstanding tesla though the miskatonic university hasntconfirmed anything at all at least the crullers taste good i got therecipe from kaspar hauser le jojo fresh n clean speaking out to the way you want to live today american all american doing a bit so and even more sofrom swkirchsunnrlnavymil steve kirchoefersubject rd cfv and vote ack mischealthdiabetesthis is the third and final call for votes for the creation of thenewsgroup mischealthdiabetes a mass acknowledgement of valid votesreceived as of april th gmt appears at the end of thisposting please check the list to be sure that your vote has beenregistered read the instructions for voting carefully and followthem precisely to be certain that you place a proper vote instructions for voting to place a vote for the creation of mischealthdiabetes send anemail message to yessunnrlnavymil to place a vote against creation of mischealthdiabetes send anemail message to nosunnrlnavymil the contents of the message should contain the line i voteforagainst mischealthdiabetes as proposed email messages sent tothe above addresses must constitute unambiguous and unconditionalvotes foragainst newsgroup creation as proposed conditional voteswill not be accepted only votes emailed to the above addresses willbe counted mailed replies to this posting will be returned in theevent that more than one vote is placed by an individual only themost recent vote will be counted voting will continue until gmt apr votes will not be accepted after this date any administrative inquiries pertaining to this cfv may be made byemail to swkirchsunnrlnavymil the proposed charter appears below charter mischealthdiabetes unmoderated the purpose of mischealthdiabetes is to provide a forum for thediscussion of issues pertaining to diabetes management ie dietactivities medicine schedules blood glucose control exercisemedical breakthroughs etc this group addresses the issues ofmanagement of both type i insulin dependent and type ii noninsulindependent diabetes both technical discussions and general supportdiscussions relevant to diabetes are welcome postings to mischeathdiabetes are intended to be for discussionpurposes only and are in no way to be construed as medical advicediabetes is a serious medical condition requiring direct supervisionby a primary health care physician end of charter the following individuals have sent in valid votes bmuvmscsdmuedu bill satterleeawjlokiccpdxedu jim williamsacfreenetcarletonca colin heneinadcatde axel dunkelalacademmtyitesmmx jesus eugenio s nchez peaanugulabadlandsnodakedu ramakrishna reddy anugulaappssneakskodakcom robert w appsarperdmikukyedu alicia r perduebaindgovonca dave bainbalamutmorrishaccom morris balamutbchjulietcaltechedubgainesollamhucdie brian gainesbjornblarsendelabsintefnobobwhpsadwcsadhpcom bob waltenspielbruceuxbliverpoolacuk brucebspencerbinkleycsmcgillca brian spencerclineusceastcsscarolinaedu ernest a clinecolemantwintwinsuncom mike colemancompassdacomtomdcompassdacom thomas donnellycsccoastucsdedu charles coughrancurtechsbsunhedu stephanie bradleyswiftdebrummbrendamsgatecorpapplecom debrum brendadlbfannywashinmetcom david bartondlgmidwayuchicagoedu deborah lynn gillaspiedougbcommmotcom douglas bankedtitipuresuncom edward reidedmoorehpvclcvcdhpcom ed mooreejokajagialaskaedu eric j olsonemcguireintellectioncom ed mcguireewchplbhplhpcom enrico coierafeathrbluejayampakzenetdeccomfrankliggasuugarizonaedu gregory c franklin fsspracadalaskaedu hardcore alaskangabeangusmiorg gabe helougaspmedglcsmitedu isaac kohanegaspmedglcsmitedu isaac kohanegeirmillsteintftelenoggurmancoryberkeleyedu gail gurmanggwwolvesdurhamncus gregory g woodburygreenlawoasysdtnavymil leila thomasgrmandrewcmuedu gretchen millerhalderccsrpieduhandelapduvmbitnetpuccprincetonedu phil handelhansenrohsueduhcnyongwacamorg hcheddingschrisconrlnavymil hubert heddingsherbisonlassieucxlkgdeccom bjhmpetromosaicunccedu herbert m petrohoschiscsvaxunieduhrubinpopstatpurdueedu herman rubinhudsoibauducadmducauburnedu ingrid b hudsonhuffmcclbmednyuedu edward j huffhuffmaningrescom gary huffmanhuynhestdnrlnavymil minh huynhishbeldcixcompulinkcouk ishbel donkinjameslangdellengsuncom james langdelljamyersnetcomcom john a myersjccrosfieldcouk jerry cullingfordjesupcbmvaxcbmcommodorecom randell jesupjjmorrisgandalfrutgersedu joyce morrisjoepdapcsiroau joe petranovicjohnburtonacenetauburnedu john e burton jrjohnchacommmotcomjorgensonkeccuvccedujpsummikukyedu joey p sumjtmucsfvmucsfedu john maynardjulienskclamonsantocomkaminskinetcomcom peter kaminskikerrycitruqozau kerry raymondkieranworldstdcom aaron l dickeyknauercsuiucedu rob knauerhasekolarspotcoloradoedu jennifer lynn kolarkriguertcscom marc kriguerlauaisricom stephen lauleehalcom lee boylanlmtpocwruedulunielehighedulusgrchilicclehighedu stephen g rosemanmbeamishinsgueduau marilyn beamishmrichensgueduau maurice h richmaascdfsgafnalgov peter maasmacridisgkosmoswccgovtnz gerry macridismarkvhpvcivmvcdhpcom mark vanderfordmaschlervmshujiacilmcbnetbionet michael c berchmcdayuxcsouiucedumcooksonflutecalpolyedumfcisrharvardedu mauricio f contrerasmgwpiedu martha gunnarsonmhollowalibservicsunysbedu michael hollowaymishaabacusconcordiaca misha glouberman mjbcsbrownedu manish buttemoflnganvaxtcdiemuiridiomberkeleycaus david muir sharnoffnancyblockengsuncom nancy blockndallenrnodehuborg nigel allennlrbneinihgov rohrer nathanowenscookiemonsterccbuffaloedu bill owenspamshpfcmpfchpcom pam sullivanpaprescoundergradmathuwaterlooca paul prescodpaslowpcsrpiedupillincgovonca christopher pillingpkaneciscocom peter kanepopelkaodysseusuchicagoedu glenn popelkapulkkacswashingtonedu aaron pulkkapwatkinsmeduncedu pat watkinsrbnsnmosaicshearsoncom ken robinsonrickcrickssctrbcmtmcedu richard h millerrobynmediamitedu robyn kozierokrolfgreenmathematikunistuttgartde rolf schreibersagemancupportalcomsasjcsunxsascom joan stoutscottjordelphicomscrlhplbhplhpcomscsvectisdemoncouk stuart c squibbshantechopscraycom sharan kalwanishareniscnvxlmsclockheedcom sharen a rundshazamunhedu matthew t thompsonshipmancsablarcnasagov floyd s shipmanshoppaerincaltechedu tim shoppaslilliecsbradleyedu susan lilliesteveoworldstdcom steven w orrsurendarivywpiedu surendar chandraswkirchsunnrlnavymil steven kirchoefersfagantwuedutarynarizvmccitarizonaedu taryn l westergaardthomasetaylorgagmechiilus thomas e taylortimacfsmohoneywellcom timothy d aanerudtsamuelgollumrelaynswcnavymil tony samueluuicvmuicedu m jacobs vsterngtecom vanessa sternwahlgrenhaidavanwticom james wahlgrenwaterfalpyrseaseapyramidcom douglas waterfallweinejateomailjhuapleduwgrantinformixcom william grantyeagermscfmedupenneduyozzowatsonibmcom ralph e yozzozbeachutmbedu molly hamilton steve kirchoefer code kirchoeferestdnrlnavymilnaval research laboratory microwave technology branchwashington dc electronics sci and tech divisionfrom bmdelanemidwayuchicagoedu brian manning delaneysubject result scilifeextension passes the vote to create the proposed group scilifeextension wasaffirmativeyes votes no votes what follows is a list of the people who voted by vote no or yeshere are the people who voted nobaileyutpapaphutexasedu ed baileybarkdolllepomispsychupennedu edwin barkdollmsbsqcom mark bradercarracsubuffaloedu dave carrdesjccrpidaorg david desjardinsjbhanatumsmededu james b hutchinsrskgynkocircupennedu rich kulawiecstuvalinormythicalcom stu labovitzlauaisricom stephen lauplebrunminfvubacbe philippe lebrunjmaynardnyxcsduedu jay maynardemcguireintellectioncom ed mcguirerickcrickssctrbcmtmcedu richard h millersmarryzooidguildorg marc moorcroftdmoshernyxcsduedu david mosherejokajagialaskaedu eric j olsonhmpetromosaicunccedu herbert m petrosmithunayaleedu una smithmmtredbrickcom maxime taksar kczpsurlichssmurfsuborg matthias urlichsacumbcedu a francis uywernersoeberkeleyedu john wernerwicknetcomcom potter wickwareggwwolvesdurhamncus gregory g woodburydwwrightbnrcouk d wrightyarvinnormancsyaleedu norman yarvinaskcblphattcomspmdopalcsvirginiaeduhere are the people who voted yesfsspracadalaskaedu hardcore alaskankalexeecsumichedu ken alexanderphfhtsdccucsdedu alex aumannfranklinballuffsyntexcom franklin balluffbarashumbcedu mr steven barashbuildalanbingrcom alan barksdale buildliontheratkludgecom john h barlowpbartoucengucedu paul bartoryanbaynecanremcom ryan baynemignonshannonjplnasagov mignon belongiebeaudottirfgrenetfr william beaudotlavbliseunitno olav benumrossbrysondemoncouk ross beresfordbenbestcanremcom ben bestlevihappymancom levi bitanskyjsbdagdaengsuncom james blomgrengbloomnyxcsduedu gregory bloommbradernetcomcom mark braderebrandtjarthurclaremontedu eli brandtdoomlelandstanfordedu joseph brennerrcposapanaorgau robert cardwelljeffjcbinkleycsmcgillca jeffrey chancesashacsumbedu alexander chislenkomclarkworldstdcom maynard s clarkcompuservecom aj cliffordcolemantwinsuncom mike colemansteveconstellationecnuoknoredu steve coltrincollierivoryrtsgmotcom john t colliercomptonplainsnodakedu curtis m compton bobcmastercnatekcom bob cookcordellshamannexagencom bruce cordellcormierjereumontrealca cormier jeanmarcdjcoylemaccwiscedu douglas j coyledassstudenttcumnedu john r dassowbddonionenghoucompaqcom bruce davisdemonnemunixemichedu kenneth jubal demonndesiletssjateslbcom mark desiletsmarkdscocom mark diekhanskariteraconsteraconscom kari dubbelmanlhdsycyberiahouchevroncomhwdubuunetuunet dub dublinwilldyeheliosunledu will dyeyeganjovednetmeasurexcomjunomeasurexcom terry eganederhsvaicboeingcom dani ederglennemagentahqileafcom glenn ellingsonfarraradaclabscom richard farrarghsvaxhaluunetuunet hal finneylxfogelsrvpacbellcom lee fogelafoxxfoxxjacbaingrcom foxxidiscdlamil sam frajermansppbxmpfmedglcsmitedu michael p frankmartinfranklincorpsuncom martin franklintiffcsuclaedu tiffany frazierailingzhufreemanuergocscmuedu ailing freemantimothyfreemanuergocscmuedu tim freemangtcprismgatechedu geoff georgemtvdjgrivmnl daniel gijsbersexusagexuericssonse serena gilbertrlglendenetcomcom robert lewis glendenninggoetzcsbuffaloedu phil goetzgoolsbydgrtpdgcom chris goolsbydgordoncrowomnicojp david gordonbgrahameerisdemoncouk robert d grahamesascsgunxsascom cynthia grantgreensrilankaislandcom robert greensteinjohngoceorstedu john a gregorrogernetcomcom roger gregoryevansroncsyaleedu ron haleevansbrentvpnetchiilus brent hansenronghaymedumichedu ron g hayakhempressgvgtekcom anna k haynesclarisqmbobhearnamesarcnasagov robert hearnfheylighvnetvubacbe francis heylighenhinmidwayuchicagoedu p hindmanfishecasbahacnsnwuedu carwil jamesjanzenmprgatemprca martin janzenkarpskclamonsantocom jeffery m karprkelsegundocancrcom richard kellymerklingnuaimitedu ed kemokessnerrintintincoloradoedu kessner eric mmapamcsvwarwickacuk mr r a khwajakoskisunsetcsutahedu keith koskikathibridgecom kathi kramerbenkrugjupiterfnbccom ben krugfarifeskimocom david kunzedsredsdrdseluunetuunet steve langspahclmecengcoenortheasternedu henry leongslintonpmmscamacuk steve lintonalopezcseputexasedu alejandro lopez kflaccessdigexcom keith f lynchkamcharmsuedu charles macdonaldrobvistorontoedu robert c majkaphilstarconncom phil markscamjackatakraidernet cameron marshallmmaymcdintelcom mike may dracuumemechiilus bruce maynardidiscgdiscdlamil john mccarrickxyzzyimagencom david mcintyrecuhescsvwarwickacuk malcolm mcmahonmcphersomacvaxucsdedu john mcphersonmerkleparcxeroxcom ralph merkleericsynopsyscom eric messickpmetzgershearsoncom perry e metzgergmichaelvmdcsouiucedu gary r michaeldatmasludatlthse asker mikaelmillerlwilmawhartonupennedu loren j millerminskymediamitedu marvin minskypmorrislamarcolostateedu paul morrismarkmuhlesteinnovellcom mark muhlesteindavidstaffudcupennedu r david murraygananneymosaicunccedu glenn a nanneyanthonymeaddatacom anthony napierdnimanpantherwinnet donald e nimannistukunixgubcca richard nistukjonathanrmiteduau jonathan odonnellmartinogomezjplnasagov martin r olahcpatillelandstanfordedu christopher kashina patilcrperfsysboeingcom chris paynesharonacrifr sharon pelegphprhihiis petur henry petersenchrispeficom chris phoenixpiercecsuclaedu brad piercejuliusmathutahedu julius piercedplattcellarorg doug plattmitchellporterlambadaoituncedu mitchell portercpressonjidobingrcom craig pressonpricepricedemoncouk michael clive priceuuicvmbitnet edward s proctorstevepdeckardworksticom steve pruittmjquinnpuccbitnet michael quinnraussnvlarmymil patrick raussremkecstuberlinde jan k remkeagyfnysuedu barry h rodinksackettcsuahedu karl r sackettrcscsarizonaedu richard schroeppelfschulzpyramidcom frank schulzkwsthunderislandkalamazoomius karel w sebekbseewaldgozeridbsuedu brad seewaldshapardmantanoscmil thomas d shapardhabspanixcom harry shapiromuiridiomberkeleycaus david muir sharnoffdasherwellsfcaus d anton sherwoodzeronetcomcom richard shiflettapbrownvmbitnet elaine shinerrobshorobshoautotrolcom robert shockrshverngmuvaxgmuedu rob shvernwesiegelcieuoregonedu william siegelggyyggmixcommixcomcom kenton sinnerbsmartbsmarttticom bob smarttonysarielucsunimelbeduau anthony david smithsgccsnscitecuccitecozau shayne noel smithdsniderbetatricitywsuedu daniel l snidersnydergspotcoloradoedu snyder gary edwin jrbluperuthfullfeedcom brian arthur stewartlhdsyusmimidlandchevroncomtsfsiuunetuunet sigridstewartnatnetcomcom nathaniel stitttpsbiosymcom tom stockfischstodolskandromedarutgersedu david stodolskygadgetdcswarwickacuk steve strongcareycsuclaedu carey sublettejsuttornetcomcom jeff suttorswaincernapocernch john swainszabotechbookcom nick szaboptheriaunetcomcom p chris theriaultakyfnysuedu chris thompsongunnarthoresenbiouiono gunnar thoresendreameruxacsouiucedu andrew trappjerrycselblgov jerry tunismusicparcomernetin rajeev upadhyetreonuwashingtonedu treon verderyevoremagnusacsohiostateedu eric j voreuuicvmbitnet howard wachtelsusanwpiwpiedu susan c wadecompuservecom paul wakferewalkeritberkleeedu elaine walkerjewrtsunquestcom james wardjeremyaimitedu jeremy m wertheimerbwwstorreypinescancrcom bruce white weedsstrobeatcolivetticom mark wiedmanwieselelishacsyaleedu elisha wieselwillingpgarunionedu willing paulsmwalcorconcordiaca steven winikoffwrighthicombhicom david wrightebusewanahericssoncom stephen wright liquidxcnexusctscom liquidxxakellisuivlsislcsluiucedu michael g xakelliscscsbrownedu ion yannopoulosyazzlccsdsdlocuscom bob yazzlnzlucidcom leonard n zubkoffrsenpdufpebradwyermasongmueduartemblhamburgdeatfurmancupportalcombillwattmailattcomcarlreddragonumbceducarlfaimiteducccbbschristhompsonucenguceduccgarciamizzoubitnetclaybcellarorgdackpermanetorgdaedalusnetcomcomdanielgautodeskcomdavemcupportalcomfgriffithccsvaxsfasuedugarciahuscharvardedugavhouxaattcomhammarcsunmeduherbisonlassieucxlkgdeccomhhuangathenamiteduhkhensoncupportalcomirvinghappymancomjeckelamugwaichimeduacjpjgsmeritedujmerittmentalmitreorgjonasmartenfjallstamcupportalcomkqbwhscadattcomlpomeroyvelarasimescomlubkinapollohpcomkunertwustlbwustledulinyardmxenosalogicacoukmmichellewrightwatsonattcommoselecweleccanterburyacnznaourslaeosncsuedunghuscharvardedupasedchapmanuwmedupocockmathutahedurudihsduviccascottjordelphicomstantonidecomstevehamicrosoftcomstudiscoverwrightedusyangesaexeroxcomtimhrubyhiscomtoddkaufmannfussenmtcscmuedutomgenieslhsudeleduucmizzoubitnetwmillerclustclemsoneduyostmvusadobecomthe group still passes if you dont count the people forwhom i just have email addressbrian bmdelanemidwayuchicagoedufrom filipevxcrnacernch vincisubject re krillean photographyin article aprircamfr francisircamfr joseph francis writesin article aprunlvedu todamhypcharlesunlvedu brian m huey writesi think thats the correct spelling crullerian how about kirlian imaging i believe the faq for sciskeptics sp has a nice writeup on this they would certainly be most supportive on helping you to build such a device and connect to a kvolt supply so that you can take a serious look at your aura filipe santos cern european laboratory for particle physics switzerlandfrom rindenterprisebihharvardedu david rindsubject re candida albicans what is itin article apridaliuse davpaidaliuse david partain writessomeone i know has recently been diagnosed as having candida albicans a disease about which i can find no information apparently it has somethingto do with the bodys production of yeast while at the same time being highlyallergic to yeast can anyone out there tell me any more about itcandida albicans can cause severe lifethreatening infections usuallyin people who are otherwise quite ill this is not however the sortof illness that you are probably discussingsystemic yeast syndrome where the body is allergic toyeast is considered a quack diagnosis by mainstream medicine thereis a book the yeast connection which talks about this illnessthere is no convincing evidence that such a disease exists david rindrindenterprisebihharvardedufrom marcosdflonestarorg steve giammarcosubject re is msg sensitivity superstitionin article qktainnmrcalamarihicom rogerscalamarihicom andrew rogers writesin article aprwalterbellcorecom jchencttbellcorecom writeschinese and many other asians japanese koreans etc have usedmsg as flavor enhancer for two thousand years do you believe thatthey knew how to make msg from chemical processes not they justextracted it from natural food such sea food and meat brothand to add further fuel to the flame war i read about years ago thatthe natural msg extracted from the sources you mention above does notcause the reported aftereffects its only that nasty artificial msg extracted from coal tar or whatever that causes chinese restaurantsyndrome i find this pretty hard to believe has anyone else heard iti was under the possibly incorrect assumption that most of the msg onour foods was made from processing sugar beets is this not true are there other sources of msgi am one of those folx who react sometimes strongly to msg howeveri also react strongly to sodium chloride table salt in excess eachcauses different symptoms except for the common one of rapid heartbeatand an uncomfortable feeling of pressure in my chest upper left quadrant steve giammarco peterson lanedallas tx marcosdflonestarorgloveyameanitfrom donald mackie donaldmackiemedumichedusubject re obgyn residencyin article aprcnsvaxuwecedu david nyenyedacnsvaxuwecedu writes i believe it is illegal for a residency to discriminate againstfmgs is that true i know some that wont even interview fmgs i think a case could be made that this is discriminatoryparticularlyif an applicant had good board scores and recommendations but wasntoffered an interview but i dont know if it has ever gone to courtfmgs who are not citizens are like all aliens in a difficultsituation only citizens get to vote here so noncitizens are oflittle or no interest to legislators also the noncitizen may wellbe in the middle of processing for resident alien status there is astron sense that rocking the boat eg suing a residency programwill delay the granting of that status perhaps for everdon mackie his opinionsfrom dyerspdcccom steve dyersubject re is msg sensitivity superstitionin article myerspeachcsscarolinaedu myerscsscarolinaedu daniel myers writesi am under the impression that msg enhances flavor by causing thetaste buds to swellno thats not how it worksif this is correct i do not find it unreasonableto assume that high doses of msg can cause other mouth tissues to swellthis may be through a different mechanismalso as the many of the occurances including two of the aboveinvolved beef and as beef is frequently tenderized with msg this iswhat i suspect as being the causetenderizing beef involves sprinking or marinading it in papain an enzymemeat tenderizer packets might contain papain and msg and seasonings butmsg doesnt act as a tenderizer steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom dstockhpqmocasqfhpcom david stocktonsubject re krillean photographyvinci filipevxcrnacernch wrote how about kirlian imaging i believe the faq for sciskeptics sp has a nice writeup on this they would certainly be most supportive on helping you to build such a device and connect to a kvolt supply so that you can take a serious look at your aura filipe santos cern european laboratory for particle physics switzerland this has to be the only generally accepted method of using common physics lab equipment to find certain answers to all the questions aboutafterlifes heavens hells purgatory gods etc krillean photographywill probably be ignored as insignificant compared to these largereternal verities publishing your results could be a bit of a problemthough cheers davidfrom michaeliastateedu michael m huangsubject re is msg sensitivity superstitionmsg is common in many food we eat including chinese though some orientalrestaurants might put a tad too much in them ive noticed that when igo out and eat in most of the chinese food restaurants i will usually geta slight headache and an ununsual thirst afterwards this happens to manyof my friends and relatives too and heh we eat chinese food all thetime at home but we dont use msg when were cooking for ourselvesso when we put one and one together it can be safely assumed thatmsg may cause some allergic reactions in some peoplestick with natural things msg doesnt do body any good and possiblyharms for that matter so why bother with it taste food as it shouldbe tasted and dont cloud the flavor with an imaginary cloak of msgmichael michael m huang dont believe what your eyes are telling youicemt iowa state univ all they show is limitation look with yourmichaeliastateedu understanding find out what you already knowinclude standarddisclaimer and youll see the way to fly j l seagull from carlsolgpscaltechedu carl j lydicksubject re krillean photographyin article aprunlvedu todamhypcharlesunlvedu brian m huey writesi think thats the correct spellingi am looking for any informationsupplies that will allowdoityourselfers to take krillean pictures im thinkingthat education suppliers for schools might have a appartus forsale but i dont know any of the companies any info is greatlyappreciatedin case you dont know krillean photography to the best of myknowledge involves taking pictures of an most of the time organicobject between charged plates the picture will show energy patternsor spikes around the object photographed and depending on what typeof object it is the spikes or energy patterns will vary one mightextrapolate here and say that this proves that every object withinthe universe as we know it has its own energy signaturego to the library and look up corona dischargecarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itfrom starkdwovaxenetdeccom todd i starksubject re ocdin article crnfgnewshawaiiedu sharynkhawaiiedu writesi recently heard of a mental disorder called obsessive compulsivedisorder what is it what causes it could it be caused by anervous breakdown obesssive compulsive disorder not to be confused with obsessive compulsivepersonality disorder is an acute anxiety disorder characterized byeither obsessions persistent intrusive thoughts that cause anxiety whennot entertained or compulsions repetitive ritualistic actions thatsimilarly cause intense psychological discomfort when resisted ocd is often associated with certain forms of depression examples of obsessive thoughts are repeated impulses to kill a lovedone though not accompanied by anger or a religious person having recurrent blasphemous thoughts generally the individual attempts to ignoreor suppress the intrusive thoughts by engaging in other activities the individual realizes that the thoughts originate from the own mind ratherthan being from an external sourceexamples of compulsive actions are constant repetitive hand washingor other activity that is not realistically related to alleviating asource of the anxietyin ocd the obsessions or compulsions are highly distressing to theindividual take an hour or more per day and significantly impair theirdaily routine and social relationshipstreatments include psychotherapy behavioral methods and sometimescertain antidepressants which have recently been found effective in alleviatingobsessions and compulsionsthe standard diagnostic code for ocd if you want to look it up in thedsmiii manual of psychiatric diagnosis is kind regardstodd todd i stark starkdwovaxenetdeccom digital equipment corporation philadelphia pa usa a word is the skin of a living thought olliver wendell holmes jr from julieeddiejplnasagov julie kangassubject re is msg sensitivity superstitionin article michaelvislabmeiastateedu michaeliastateedu michael m huang writesmsg is common in many food we eat including chinese though some orientalrestaurants might put a tad too much in them ive noticed that when igo out and eat in most of the chinese food restaurants i will usually geta slight headache and an ununsual thirst afterwards this happens to manyof my friends and relatives too and heh we eat chinese food all thetime at home but we dont use msg when were cooking for ourselvesso when we put one and one together it can be safely assumed thatmsg may cause some allergic reactions in some peoplestick with natural things msg doesnt do body any good and possiblyharms for that matter so why bother with it taste food as it shouldbe tasted and dont cloud the flavor with an imaginary cloak of msgas i understood it msg is natural isnt it found in tomatoesanyway lots of people are terribly allergic to lots of naturalthings peanuts onions tomatoes milk etc just because somethingis natural doesnt mean it wont cause problems with some folksas for how foods taste if im not allergic to msg and i likethe taste of it why shouldnt i use it saying i shouldnt useit is like saying i shouldnt eat spicy food because my neighborhas an ulcerpeople have long modified the taste of food by additives whetherthey be chiles black pepper salt cream sauces etc all of thesethings cloud the flavor of the food why do we bother with themhow should food be tasted isnt it better left to the dinerjuliedisclaimer all opinions here belong to my cat and no one elsefrom jhoskinsmagnusacsohiostateedu james m hoskinssubject cost of roxonaldoes anyone know the approximate prescription costof a ml bottle of roxonal morphinethanksfrom dufaultlftfldenetdeccom mdsubject seizures infantile spasms the reason im posting this article to this newsgroup is to gather any information about this disorder from anyone who might have recently been effected by it from being associated with it or actually having this disorder and help me find out where i can access any medical literature associated with seizures over the internetrecently i had a baby boy born with seizures which occured hoursafter birth he was immediately transferred to a major hospital in bostonand has since been undergoing extensive drug treatment for his conditionthis has been a major learning experience for me and my wife not only inlearning the medical problems that faced our son but also in dealing withhospitals proceduresetci dont want to go into a lot of detail but his condition was termed quite severe at first then slowly he began to grow and put on weightas a normal baby would he was put on the standard anticonvulsion drugsand that did not seem to help out his mri ekg catscans are all normalbut the eegs show alot of seizure activity after many metabolic testsbody structure tests and infectionvirus tests the doctors still do notknow quite what type of siezures he is having although they do have alotof evidence that it is now pointing to infantile spasms this is wherewe stand right nowif anyone knows of any database or newsgroup or as i mentioned up aboveany information relating to this disorder i would sure appreciate hearingfrom you i am not trying to play doctor here but only trying to gatherinformation about it as i know now these particular types of disordersare still not really well understood by the medical community and so imgoing to see nowif somehow the internet can at least give me alittleinsight thanks from noringnetcomcom jon noringsubject good grief was re candida albicans what is itin article rindenterprisebihharvardedu david rind writesin article davpaidaliuse david partain writessomeone i know has recently been diagnosed as having candida albicans a disease about which i can find no information apparently it has somethingto do with the bodys production of yeast while at the same time being highlyallergic to yeast can anyone out there tell me any more about itcandida albicans can cause severe lifethreatening infections usuallyin people who are otherwise quite ill this is not however the sortof illness that you are probably discussingsystemic yeast syndrome where the body is allergic toyeast is considered a quack diagnosis by mainstream medicine thereis a book the yeast connection which talks about this illnessthere is no convincing evidence that such a disease existstheres a lot of evidence it just hasnt been adequately gathered andpublished in a way that will convince the diehard melancholic skepticswho quiver everytime the word anecdote or empirical is usedfor example dr ivker who wrote the book sinus survival always givesbefore any other treatment a systemic antifungal such as nizoral to hisnew patients if theyve been on braodspectrum antibiotics or more timesin the last two years hes kept a record of the results and for over patients found that over of his patients get significant reliefof allergicsinus symptoms of course this is only the beginning for hisprogramin my case as i reported a few weeks ago i was developing the classicsymptoms outlined in the yeast connection i agree it is a poorly written book eg extreme sensitivity to plastics vapors etc whichi never had before started in november within one week of full dosageof sporanox the sensitivity to chemicals has fully disappeared i cannow sit on my couch at home without dying after two minutes im alsogreatly improved in other areas as wellof course i have allergy symptoms etc i am especially allergic tomolds yeasts etc it doesnt take a rocket scientist to figure out thatif one has excessive colonization of yeast in the body and you have anatural allergy to yeasts that a threshold would be reached where youwould have perceptible symptoms also yeast do produce toxins of varioussorts and again you dont have to be a rocket scientist to realize thatsuch toxins can cause problems in some people in my case it was sinussince thats the center of my allergic response of course the question is whether a person who is immune compromised as tests showed i wasfrom over years of antibiotics nutritionallydeficiencies because of thestress of infections and allergies etc can develop excessive yeastcolonization somewhere in the body it is a tough question to answer sincetesting for excessive yeast colonization is not easy one almost has totake an empirical approach to diagnosis fortunately sporanox is relativelysafe unlike past antifungals still have to be careful however so theresno reason any longer to withhold sporanox treatment for empirical reasonsbtw some would say to try nystatin unfortunately most yeast grows hyphaetoo deep into tissue for nystatin to have any permanent affect youll finda lot of people who are on nystatin all the timein summary i appreciate all of the attempts by those who desire to keepmedicine on the right road but methinks that some who hold too firmlyto the party line are academics who havent been in the trenches long enoughactually treating patients if anybody doctors included said to me to myface that there is no evidence of the yeast connection i cannot guaranteetheir safety for their incompetence ripping off their lips is justified asfar as i am concernedjon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom rickysubysuedu rick marsicosubject proventil inhalerdoes the proventil inhaler for asthma relief fall into the steroidor nonsteroid category looking at the product literature itsnot clear rickysuedufrom sfegusubvmccbuffaloedusubject re barbecued foods and health riskin article cupportalcommmmcupportalcom mark robert thorson writes i dont understand the assumption that because something is found to be carcinogenic that it would not be legal in the us i think thatno there is something called the delany amendment which makes carcinogenicfood additives illegal in any amount this was passed by congress in thes before stuff like mass spectrometry became available which increaseddetectable levels of substances by a couple orders of magnitudethis is why things like cyclamates and red were banned they are veryweakly carcinogenic in huge quantities in rats so under the act they arebannedthis also applies to natural carcinogens some of you might remember atime back in the s when root beer suddenly stopped tasting so goodand never tasted so good again that was the time when safrole was bannedthis is the active flavoring ingredient in sassafras leavesif it were possible to market a root beer good like the old days someonewould do it in order to make money the fact that no one does it indicatesthat enforcement is still in effectan odd exception to the rule seems to be the product known as gumbo filethis is nothing more than coarsely ground dried sassafras leaves thisis not only a natural product but a natural product still in its naturalform so maybe thats how they evade delany or maybe a special exemptionwas made to appease powerful louisiana democrats i think what we have to keep in mind is that even though it may be illegal tocommercially producesell food with carcinogenic substances it is not illegalfor people to do such to their own food smoking etc is this true from gebcspittedu gordon bankssubject re my new diet it works great in article apromenuucp cafomenuucp chuck forsberg wakgx writesweight rebound is a term used in the medical literature onobesity to denote weight regain beyond what was lost in a dietcycle there are any number of terms which mean one thing tocan you provide a reference to substantiate that gaining backthe lost weight does not constitute weight rebound until itexceeds the starting weight or is this oral tradition thatis shared only among you obesity researchers gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re how to diagnose lyme reallyin article aprnscclehighedu mcgnscclehighedu marc gabriel writesnow im not saying that culturing is the best way to diagnose its veryhard to culture bb in most cases the point is that dr n has developed afeel for what is and what isnt ld this comes from years of experienceno serology can match that unfortunately some would call dr n a quackand accuse him of trying to make a quick buckwhy do you think he would be called a quack the quacks dont do culturesthey poopoo doing more lab tests this is lyme believe me iveseen it many times the lab tests arent accurate well treat itnow also is dr ns practice almost exclusively devoted to treatinglyme patients i dont know any orthopedic surgeons who fit thispattern they are usually gps gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re could this be a migrainein article uupcbfactorycom jimzisfeinfactorycom jim zisfein writesheadaches that seriously interfere with activities of daily livingaffect about of the population doesnt that sound likesomething a primary care physician should know something about itend to agree with hmo administrators family physicians shouldlearn the basics of headache managementabsolutely unfortunately most of them have had weeks of neurologyin medical school and month maybe in their residency mostof that is done in the hospital where migraines rarely are seenwhere are they supposed to learn those who are diligent andread do learn but most dont unfortunatelysometimes i wonder what tensiontype headaches have to do withneurology anywaywe are the only ones sometimes who have enough interest in headachesto spend the time to get enough history to diagnose them too oftenthe primary care physician hears headache and loses interest inanything but giving the patient analgesics and getting them out ofthe office so they can get on to something more interestingi am excepting migraine which is arguably neurologic headachesi hope you meant inarguably gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re cause of mental retardationin article aprccuvccedu harrisjiccuvccedu writeschromosome studies have shown no abnormalities enzyme studies andurine analyses have not turned up anything out of the ordinary mri images of the brain show scar tissue in the white matter subsequent mri analysis has shown that the deterioration of thewhite matter is progressivebecause neither family has a history of anything like this andbecause two of our four children are afflicted with the disorderwe believe that it is an autosomal recessive metabolic disorder ofsome kind naturally we would like to know exactly what thedisease is so that we may gain some insight into how we can expectthe disorder to progress in the future we would also like to beable to provide our normal children with some information aboutwhat they can expect in their own childrenit could be one of the leukodystrophies not adrenal onlyboys get that surely youve been to a university pediatricneurology department if not that is the next step biopsiesmight help especially if peripheral nerves are also affectedthere are so many of these diseases that would fit the symptomsyou gave that more cant be said at this timei agree with your surmise that it is an autosomal recessiveif so your normal children wont have to worry too much unlessthey marry near relatives most recessive genes are rareexcept in inbred communities eg lithuanian jews gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from sdragonacadiauca james r skinnersubject re paxil requestsdragonacadiauca james r skinner writesi have seen a couple of postings refering to an sri called paxil ihave been on prozac for a number of years and recently switched to zolf ihave seen a bit of comparsion of prozac to paxil but none on zolft to prozaccan some one enlight me on the differences side effect profile etcdoes anyone know james robie skinner jodrey school of computer science jamesskinnerdragonacadiauca acadia university wolfville ns canadafrom sandynmrptcyanamidcom sandy silvermansubject re barbecued foods and health riskheat shock proteins are those whose expression is induced in response toelevated temperature some are also made when organisms are subjected toother stress conditions eg high salt they have no obvious connectionto what happens when you burn proteinssanford silverman opinions expressed here are my ownamerican cyanamid sandyptcyanamidcom silvermansptcyanamidcom yeast is bestfrom dougbcommmotcom doug banksubject do we need a radiologist to read an ultrasoundmy wifes obgyn has an ultrasound machine in her office whenthe doctor couldnt hear a fetal heartbeat weeks she usedthe ultrasound to see if everything was ok it wason her next visit my wife asked another doctor in the office ifthey read the ultrasounds themselves or if they had a radiologistread the pictures the doctor very vehemently insisted that theywere qualified to read the ultrasound and radiologists were notmy wife is concerned about this she saw a tv show a couple monthsback something like or dateline nbc etc where an experton fetal ultrasounds a radiologist was showing all the differentdeffects that could be detected using the ultrasoundshould my wife be concerned should we take the pictures to a radiologist for a second opinion and if so where would we findsuch an expert in chicago we dont really have any special medicalreason to be concerned but if a radiologist will be able to seethings the obgyn cant then i dont see why we shouldnt use oneany thoughts doug bank private systems divisiondougbecscommmotcom motorola communications sectordougbnwuedu schaumburg illinoisdougbcasbahacnsnwuedu from lsalbnyvmsbitnet larry silverbergsubject re good grief was re candida albicans what is itin article noringcsnsxkmonetcomcom noringnetcomcom jon noring writesin article rindenterprisebihharvardedu david rind writesin article davpaidaliuse david partain writessomeone i know has recently been diagnosed as having candida albicans a disease about which i can find no information apparently it has somethingto do with the bodys production of yeast while at the same time being highlyallergic to yeast can anyone out there tell me any more about iti have a lot of info about this disease i am posting a small amount ofit that i extracted if more is required email me lsgeminialbanyedu please it takes me some time to upload it sobe advised only request it if you really want ithere is some info from infotrac health reference centeralso check you local of univeristy library they most likely have theinfotrac cdrom this info was taken frominfotrac health reference center oct oct heading candida albicans dictionary definition mosbys medical and nursing dictionary nd edition copyright the cv mosby company candida albicans a common budding yeastlike microscopic fungal organism normally present in the mucous membranes of the mouth intestinal tract and vagina and on the skin of healthy people under certain circumstances it may cause superficial infections of the mouth or vagina and less commonly serious invasive systemic infection and toxic reaction see also candidiasisinfotrac health reference center oct oct the material contained in health reference center oct oct is provided only for informational purposes and should not be construed as medical advice or instruction consult your health professional for advice relating to a medical problem or condition heading candida albicans yogurt cure for candida acidophilus il v east west natural health julyaugust p text available text copyright east west partners another folk remedy receives the blessing of medical study researchers have found that eating a cup of yogurt a day drastically reduces a womans chances of getting vaginal candida a yeast infection for the yearlong study researchers at long island jewish medical center in new hyde park new york recruited women who suffered from chronic yeast infections for the first months the women each day ate ounces of yogurt containing lactobacillus acidophilus for the second months the women did not eat yogurt the researchers examined the women each month and found that incidents of colonization and infection were significantly lower during the period when the women ate yogurt the fungus candida albicans can live in the body without doing harm it is an overproliferation of the fungus that leads to infection the researchers concluded that the l acidophilus bacteria found in some brands of yogurt retard overgrowth of the fungus streptococcus thermophilus and l bulgaricus are the two bacteria most commonly used in commercial yogurt production neither one appears to exert a protective effect against candida albicans however women who want to try yogurt as a preventive measure should choose a brand that lists acidophilus in its contents end infotrac health reference center oct oct the material contained in health reference center oct oct is provided only for informational purposes and should not be construed as medical advice or instruction consult your health professional for advice relating to a medical problem or condition heading candida albicans candida monilia infections caused by fungi infectious diseases by harold c neu the columbia univ coll of physicians surgeons complete home medical guide edition p text available text copyright crown publishers inc candida monilia this disease is usually caused by candida albicans a fungus that we all carry at one time or another in some circumstances though the organisms proliferate producing symptomatic infection of the mouth intestines vagina or skin when the mouth or vagina are infected the disease is commonly called thrush vaginitis caused by candida often afflicts women on birth control pills or antibiotics there is itching and a white cheesy discharge among narcotic addicts candida infections can lead to heart valve inflammation diagnosis of candida infections is confirmed by cultures and blood tests treatment can be with amphotericin b or orally with ketoconazolethere is no evidence that candida in the intestine of normal individualsleads to disease all people at one time or another have candida in their intestines claims for any benefit from special diets or chronic antifungal agents is not based on any solid evidence end i hope this is informativelarrylive from new york its saturday nighttonights special guestlawrence silverberg from the state university of new york albanyakalsgeminialbanyedufrom yozzowatsonibmcom ralph yozzosubject re how to diagnose lyme reallyin article pittuucp gebcspittedu gordon banks writesin article aprnscclehighedu mcgnscclehighedu marc gabriel writesnow im not saying that culturing is the best way to diagnose its veryhard to culture bb in most cases the point is that dr n has developed afeel for what is and what isnt ld this comes from years of experienceno serology can match that unfortunately some would call dr n a quackand accuse him of trying to make a quick buckwhy do you think he would be called a quack the quacks dont do culturesthey poopoo doing more lab tests this is lyme believe me iveseen it many times the lab tests arent accurate well treat itnow also is dr ns practice almost exclusively devoted to treatinglyme patients i dont know any orthopedic surgeons who fit thispattern they are usually gps are you arguing that the lyme lab test is accuratethe books that ive read say that in general the testshave a chance of being correct the testsresult in a large number of both false positives andfalse negatives i am in the latter casewe could get those same odds by rolling the dice ralph yozzo yozzowatsonibmcom from the beautiful and historic new york state midhudson valleyfrom bhjellecarinaunmedu subject re barbecued foods and health riskin article csqvedbacsubuffaloedu sfegusubvmccbuffaloedu writesin article cupportalcommmmcupportalcom mark robert thorson writes no there is something called the delany amendment which makes carcinogenicfood additives illegal in any amount this was passed by congress in the i think what we have to keep in mind is that even though it may be illegal tocommercially producesell food with carcinogenic substances it is not illegalfor people to do such to their own food smoking etc is this true whoa what did you say your name was address ssn smoking foods ehi think the govt would like to know about thisbrian from drapergndwtpgtefsdcom pam drapersubject any info on vasomotor rhinitisi recently attended an allery seminar steroid nasal sprays were discussed afterward on a oneonone basis i asked the speaker what if none of the vancanese beconase nasalide nasalcort or nasalchrom work nor do any oral decongestants work she replied that she saw an article on vasomotor rhinitis that this is not an allergic reaction and that nothing other than the afrins and such would work which in my case is truei want to find out as much as possible about this since i am going to see my allergist in may and want to be armed to the hilt with information since nothing he has done with me has helped me at all and i have had no relief for monthsplease respond if you know anything about this andor please let me know what articles might be helpful that i could look up in the libraryfrom linysunscrifsuedu nemosubject bates method for myopiadoes the bates method work i first heard about it in this newsgroup several years ago and i have just got hold of a book how to improve yoursight simple daily drills in relaxation by margaret d corbett authorized instructor of the bates method published in it talks about vision improvement by relaxation and exercise has there beenany study on whether this method actually works if it works is it by actually shortening the previously elongated eyeball or by increasing the lenss ability to flatten itself in order to compensate for the toolong eyeballsince myopia is the result of eyeball elongation seems to me the mostlogical approach for correction is to find a way to reverse the processie shorten it somehow preferably nonsurgically has there beenany recent studies on this where can i find them i know rk works by changing the curvature of the cornea to compensate for the shape of eyeball but if there is a way to train the muscles to shorten the eyeball back to its correct length that would be even better batess idea rightthanks for any informationfrom dyerspdcccom steve dyersubject re good grief was re candida albicans what is itin article noringcsnsxkmonetcomcom noringnetcomcom jon noring writesthere is no convincing evidence that such a disease existstheres a lot of evidence it just hasnt been adequately gathered andpublished in a way that will convince the diehard melancholic skepticswho quiver everytime the word anecdote or empirical is usedsnort ah there go my sinuses againfor example dr ivker who wrote the book sinus survival always givesoh wow a classic textbook hey they laughed at einstein toobefore any other treatment a systemic antifungal such as nizoral to hisnew patients if theyve been on braodspectrum antibiotics or more timesin the last two years hes kept a record of the results and for over patients found that over of his patients get significant reliefof allergicsinus symptoms of course this is only the beginning for hisprogramyeah ill bet tomorrow the worldlisten uncontrolled studies like this are worthlessin my case as i reported a few weeks ago i was developing the classicsymptoms outlined in the yeast connection i agree it is a poorly written book eg extreme sensitivity to plastics vapors etc whichi never had before started in november within one week of full dosageof sporanox the sensitivity to chemicals has fully disappeared i cannow sit on my couch at home without dying after two minutes im alsogreatly improved in other areas as wellim sure you are you sound like the typical hysterichypochondriac whoresponds to miracle curesof course i have allergy symptoms etc i am especially allergic tomolds yeasts etc it doesnt take a rocket scientist to figure out thatif one has excessive colonization of yeast in the body and you have anatural allergy to yeasts that a threshold would be reached where youwould have perceptible symptomsyeah it makes sense to me so of course it should be taken seriouslysnortalso yeast do produce toxins of varioussorts and again you dont have to be a rocket scientist to realize thatsuch toxins can cause problems in some peopleyeah it sounds reasonable to meof course the question is whether a person who is immune compromised as tests showed i wasfrom over years of antibiotics nutritionallydeficiencies because of thestress of infections and allergies etcoh really what tests immunecompromised my assmore like credulous malingerer this is a psychiatric syndromecan develop excessive yeastcolonization somewhere in the body it is a tough question to answer sincetesting for excessive yeast colonization is not easy one almost has totake an empirical approach to diagnosis fortunately sporanox is relativelysafe unlike past antifungals still have to be careful however so theresno reason any longer to withhold sporanox treatment for empirical reasonsyou know its a shame that a drug like itraconazole is being misusedin this way its ridiculously expensive and potentially toxicthe trouble is that it isnt toxic enough so it gets abused by quacksbtw some would say to try nystatin unfortunately most yeast grows hyphaetoo deep into tissue for nystatin to have any permanent affect youll finda lot of people who are on nystatin all the timethe only good thing about nystatin is that its relatively cheapand when taken orally nontoxic but oral nystatin is without anysystemic effect so unless it were given iv it would be withoutany effect on your sinuses i wish these quacks would first useiv nystatin or amphotericin b on people like you that would solvethe yeast problem once and for allin summary i appreciate all of the attempts by those who desire to keepmedicine on the right road but methinks that some who hold too firmlyto the party line are academics who havent been in the trenches long enoughactually treating patients if anybody doctors included said to me to myface that there is no evidence of the yeast connection i cannot guaranteetheir safety for their incompetence ripping off their lips is justified asfar as i am concernedperhaps a little haldol would go a long way towards amelioratingyour symptomsare you paying for this treatment out of your own pocket id hateto think my insurance premiums are going towards this steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyersubject star gartds sp info wantedfrom kmcvayonebalmanacbcca ken mcvaya friends daughter has been diagnosed with an eye disease called stargartds or something close it is apparently genetic according to herand affects every fourth generationshe would appreciate any information about this condition if anything isavailable via ftp please point me in the right direction the old frogs almanac a salute to that old frog hissef ryugen fisher v x sco xenix gt ladysmith british columbia canada serving central vancouver island with public access usenet and internet mail home to the holocaust almanacfrom nyedacnsvaxuwecedu david nyesubject re seizures infantile spasms reply to dufaultlftfldenetdeccom md after many metabolic tests body structure tests and infectionvirustests the doctors still do not know quite what type of siezures he ishaving although they do have alot of evidence that it is now pointingto infantile spasms this is where we stand right nowas i knownow these particular types of disorders are still not really wellunderstood by the medical community infantile spasms have been well understood for quite some time now youare seeing a pediatric neurologist arent you if not i stronglyrecommend it there is a new anticonvulsant about to be released calledfelbamate which may be particularly helpful for infantile spasms asfor learning more about seizures ask your doctor or his nurse about alocal support group david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom alicebteatwoengsuncom alice taylorsubject accupuncture and aidsa friend of mine is seeing an acupuncturist andwants to know if there is any danger of gettingaids from the needlesthanksalicefrom mcovingtaisunaiugaedu michael covingtonsubject re any info on vasomotor rhinitisdisclaimer im a sufferer not a doctorim not sure theres a really sharp distinction between allergic andvasomotor rhinitis basically vasomotor rhinitis means your nose isstuffy when it has no reason to be not even an identifiable allergydecongestants and steroid sprays work for vasomotor rhinitis alsoi can get surprising relief from purely superficial measures such assaline moisturizing spray and moisturizing gel michael a covington associate research scientist artificial intelligence programs mcovingtaiugaedu the university of georgia phone athens georgia usa amateur radio ntmi subject ovarian cancer treatment centersfrom rbprmarohvmrohmhaascoma relative of mine has recently been diagnosed with stage papillary cellovarian cancer we are urgently seeking the best place in the country fortreatment for thisdoes anyone have any suggestionsas you might suspect time is of the essencethanks for your help bobfrom euclidmrcnextcsouiucedu euclid ksubject re accupuncture and aidsalicebteatwoengsuncom alice taylor writesa friend of mine is seeing an acupuncturist andwants to know if there is any danger of gettingaids from the needlesask the practitioner whether he uses the presterilized disposableneedles or if he reuses needles sterilizing them between use in theformer case theres no conceivable way to get aids from the needles inthe latter case its highly unlikely though many practitioners use thedisposable variety anywayeuclideuclid k standard disclaimers applyit is a bit ironic that we need the wave model of light to understand thepropagation of light only through that part of the system where it leaves notrace hudson nelson universityphysicsfrom kjivlrcedusubject hismanal et alside effectscan someone tell me whether or not any of the following medications has been linked to rapidexcessive weight gain andor a distorted sense of taste or smell hismanal azmacort a topical steroid to prevent asthma vancenasealsoyou may have guessed im an allergy suffererbut im beginning to suspect im also the victim of a dr toliberal with the prescription p the allergist i went to last oct simply inquired about my symptons i was suffering chronic asthma attacks gave me a battery of allergy tests and went down a checklist of drugs a photocopied sheet ive gained out lbs since then though i havent eaten more or much differently than before ivsuffered depression fatigue and ive experienced a foul smell and sense of taste for about the last two months i mentioned the lack of smell and taste to this dr in feb and he said my sinuses did look a bit swollen he just looked up my nose with his little lightthe same one used for ears and prescribed prednisone and sulfatrim ds severe headaches and a rash resulted particularly after my weeks worth of prednisone ran out now he wants to do a rhinoscopy to see if i have a bleeding ulcer or polyps in my sinus cavities im considering seeing another doctor any suggestionsadvice id really appreciate itfrom taspegasuscom len howardsubject re endometriosisin article aprrockconcertnet naomirockconcertnet naomi t courter writescan anyone give me more information regarding endometriosis i heardits a very common disease among women and if anyone can provide namesof a specialistsurgeon in the north carolina research triangle parkarea raleighdurhamchapel hill who is familiar with the conditioni would really appreciate itthanks naominaomi your best bet is to look in the yellow pages and find a listingfor obgyn doc in the area you wish any obgyn doc is familiar withendometriosis and its treatmentsshalom len howard mdfrom eliezerphysicsllnlgov david a eliezersubject questions about spect imagingi have become involved in a project to further develop and improve the performance of spect single photon emissioncomputerized tomography imaging we will eventually haveto peddle this stuff somewhere and so as i move this thingalong i would like to know what is the current resolution of spect imaging what kindsof jobs is spect used for specifically what kind of specific jobscould i hopethat spect could be used for if its resolution improvedsay to close to that of pet positron emission tomographyand how much does a spect machine cost how much does a singlespect image cost if anyone knows the answer to any or all of these questions orwhere i could find that answer i would be very grateful indeed thanks in advance for any repliesdave eliezereliezerphysicsllnlgovfrom homertriposcom webster homersubject mind machinesi recently learned about these devices that supposedly induce specific brain wave frequencies in their users simply by wearing them mind machinesconsist of led gogles head phones and a microprocessor that controls themthey strobe the closed eye and send sound pulses in sync with the flashingleds i understand that these devices are experimental but they are availableive heard claims that they can induce sleep and light trance states forrelaxation essentially they are supposed to work without aid of drugs etci would think that if they work as reported they would be incredibly usefulthe few sources ive seen are biased they are selling the things and afriend who has tried them claims that every home should have one so do these mind machines aka light and sound machines work can they inducealpha theta andor delta waves in a person wearing them what research ifany has been done on them could they be used in lieu of a tranquilizeror are they just another bit of quackeryweb homerhomertriposcom from mmatusevradfordvakededu melissa n matusevichsubject re paxil requesti dont know much and in fact have asked questions heremyself my doctor told me that paxil is a cleaner sri in thatit produces fewer side effects as to a comparison betweenzoloft and prozac im not able to remember what he said aboutthe differences between those two drugs sorrysubject burzynskis antineoplastonsfrom jschwimmerwccnetwccwesleyanedu josh schwimmerive recently listened to a tape by dr stanislaw burzynski in which he claims to have discovered a series naturally occuring peptides with anticancer properties that he names antineoplastons burzynski says that his work has met with hostility in the united states despite the favorable responses of his subjects during clinical trialswhat is the generally accepted opinion of dr burzynskis research he paints himself as a lone researcher with a new breakthrough battling an intolerant medical establishment but i have no basis from which to judge his claims two weeks ago however i read that the nihs department of alternative medicine has decided to focus their attention on burzynskis work their budget is so small that i imagine they wouldnt investigate a treatment that didnt seem promisingany opinions on burzynskis antineoplastons or information about the current status of his research would be appreciatedjoshua schwimmerjschwimmereaglewesleyanedufrom kxgstpittedu kenneth gilbertsubject re do we need a radiologist to read an ultrasoundin article aprlmpsbbscommmotcom dougbecscommmotcom writesmy wifes obgyn has an ultrasound machine in her office whenthe doctor couldnt hear a fetal heartbeat weeks she usedthe ultrasound to see if everything was ok it wason her next visit my wife asked another doctor in the office ifthey read the ultrasounds themselves or if they had a radiologistread the pictures the doctor very vehemently insisted that theywere qualified to read the ultrasound and radiologists were notstuff deletedthis is one of those sticky areas of medicine where battles frequentlyrage with respect to your ob i suspect that she has been certified inultrasound diagnostics and is thus allowed to use it and bill for itsuse many cardiologists also use ultrasound echocardiography and arein fact considered by many to be the experts i am not sure where obsstand in this regard but i suspect that they are at least as good as theradioligists flameretardant suit ready kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from vidamdavcrmdaca vida morkunassubject altitude adjustmenti live at sealevel and am calledupon to travel to highaltitude citiesquite frequently on business the cities in question are at to feet of altitude one of them especially is very pollutedoften i feel faint the first two or three days i feel lightheaded andmy heart seems to pound a lot more than at sealevel also it is verydry in these cities so i will tend to drink a lot of water and keepaway from dehydrating drinks such as those containing caffeine or alcoholthing is i still have symptoms how can i ensure that my short trips thereno i dont usually have a week to acclimatize are as comfortable as possibleis there something else that i could doa long time ago possibly two years ago there was a discussion here aboutaltitude adjustment has anyone saved the messagesmany thanksvidafrom kxgstpittedu kenneth gilbertsubject re any info on vasomotor rhinitisin article rtanjqeuropaenggtefsdcom drapergndwtpgtefsdcom writesi recently attended an allery seminar steroid nasal sprays were discussed afterward on a oneonone basis i asked the speaker what if none of the vancanese beconase nasalide nasalcort or nasalchrom work nor do any oral decongestants work she replied that she saw an article on vasomotor rhinitis that this is not an allergic reaction and that nothing other than the afrins and such would work which in my case is truethere has been some recent research on vasomotor rhinitis that shows thatipratroprium bromide atrovent inhaled nasally is an effective treatmentfor many sufferers it has been approved for this use and is availablewith a nasal adaptor in canada in the us the fda has yet to approve thisuse of the drug but it is available as an oral inhaler for copd andthese can be adapted for intranasal use kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from vgwludunsellcalgarychevroncom greg w luftsubject relief of pain caused by cancer i am not sure if this is the proper group to post this to but here goes anyway about five years ago my mother was diagnosed with having cancer in the lymph nodes under one of her arms after the doctors removed the cancerous area she had full movement of her arm with only slight aching under her arm when she moved it over the course of the next two years the aching got more severe and her complaining to the doctors produced the explanation that it was scar tissue causing the pain at this time her doctor suggested that some physiotherapy should be employed to break up the scar tissue while attending one of her therapy sessions while her arm was being manipulated some damage occured nerve which caused the level of pain to permanently increase severly controlled by tylenol s and some loss of use of the arm palsied wrist and almost no outward lateral movement with great persistence on her part the doctors looked further into the issue and discovered that not all of the cancer had been removed and another tumor had grown under the arm this was removed also but the pain in the arm has not decreased the doctors are not sure exactly why the pain is persisting but feel some sort of nerve damage has occured and they have employed tylenol and soon morphine to relieve the pain she has tried acupuncture by this only provides minor reductions in pain and is only short term my questions are has anyone has heard of similar cases and what if anything was done to reduce the levels of pain are their methods to block nerves so that the pain can be reduced are their methods to restore nerves so that loss of arm function can be restored any general suggestions on pain reduction would be greatly appreciated please respond by email because i do not always get chance to read this group if anyone knows of some literature that may be useful to this case or another newsgroup that i should be posting this to it would also be appreciated gregory w luft internet vgwlucalgarychevroncomchevron petroleum techonology company tel fifth ave sw fax calgary alberta canada tp lfrom danielprincefnzcalcomsocalcom daniel princesubject acutane fibromyalgia syndrome and cfs to nyedacnsvaxuwecedu david nyethere is a person on the fido cfs echo who claims that he was cured of cfs by taking accutane he also claims that you are using it in the treatment of fibromyalgia syndrome are you using accutane in the treatment of fibromyalgia syndrome have you used it for cfs have you gotten good results with it are you aware of any double blind studies on the use of accutane in these conditions thank you in advance for all replies i think they should rename waco tx to wacko txfrom berryhhueyudeledu john berryhill phdsubject re krillean photographyi think he means girlie photography a good place to find it is innondescript little places that usually just say books on theoutside of the building in black and white john berryhillfrom aldridgenetcomcom jacquelin aldridgesubject re good grief was re candida albicans what is itdyerspdcccom steve dyer writesin article noringcsnsxkmonetcomcom noringnetcomcom jon noring writesthere is no convincing evidence that such a disease existstheres a lot of evidence it just hasnt been adequately gathered andpublished in a way that will convince the diehard melancholic skepticswho quiver everytime the word anecdote or empirical is usedsnort ah there go my sinuses againfor example dr ivker who wrote the book sinus survival always givesoh wow a classic textbook hey they laughed at einstein toobefore any other treatment a systemic antifungal such as nizoral to hisnew patients if theyve been on braodspectrum antibiotics or more timesin the last two years hes kept a record of the results and for over patients found that over of his patients get significant reliefof allergicsinus symptoms of course this is only the beginning for hisprogramyeah ill bet tomorrow the worldlisten uncontrolled studies like this are worthlessin my case as i reported a few weeks ago i was developing the classicsymptoms outlined in the yeast connection i agree it is a poorly written book eg extreme sensitivity to plastics vapors etc whichi never had before started in november within one week of full dosageof sporanox the sensitivity to chemicals has fully disappeared i cannow sit on my couch at home without dying after two minutes im alsogreatly improved in other areas as wellim sure you are you sound like the typical hysterichypochondriac whoresponds to miracle curesof course i have allergy symptoms etc i am especially allergic tomolds yeasts etc it doesnt take a rocket scientist to figure out thatif one has excessive colonization of yeast in the body and you have anatural allergy to yeasts that a threshold would be reached where youwould have perceptible symptomsyeah it makes sense to me so of course it should be taken seriouslysnortalso yeast do produce toxins of varioussorts and again you dont have to be a rocket scientist to realize thatsuch toxins can cause problems in some peopleyeah it sounds reasonable to meof course the question is whether a person who is immune compromised as tests showed i wasfrom over years of antibiotics nutritionallydeficiencies because of thestress of infections and allergies etcoh really what tests immunecompromised my assmore like credulous malingerer this is a psychiatric syndromecan develop excessive yeastcolonization somewhere in the body it is a tough question to answer sincetesting for excessive yeast colonization is not easy one almost has totake an empirical approach to diagnosis fortunately sporanox is relativelysafe unlike past antifungals still have to be careful however so theresno reason any longer to withhold sporanox treatment for empirical reasonsyou know its a shame that a drug like itraconazole is being misusedin this way its ridiculously expensive and potentially toxicthe trouble is that it isnt toxic enough so it gets abused by quacksbtw some would say to try nystatin unfortunately most yeast grows hyphaetoo deep into tissue for nystatin to have any permanent affect youll finda lot of people who are on nystatin all the timethe only good thing about nystatin is that its relatively cheapand when taken orally nontoxic but oral nystatin is without anysystemic effect so unless it were given iv it would be withoutany effect on your sinuses i wish these quacks would first useiv nystatin or amphotericin b on people like you that would solvethe yeast problem once and for allin summary i appreciate all of the attempts by those who desire to keepmedicine on the right road but methinks that some who hold too firmlyto the party line are academics who havent been in the trenches long enoughactually treating patients if anybody doctors included said to me to myface that there is no evidence of the yeast connection i cannot guaranteetheir safety for their incompetence ripping off their lips is justified asfar as i am concernedperhaps a little haldol would go a long way towards amelioratingyour symptomsare you paying for this treatment out of your own pocket id hateto think my insurance premiums are going towards thissteve dyerdyer youre rude medicine is not a totallly scientific endevour itsoften practiced in a disorganized manner most early treatment ofnonlife threatening illness is done on a guess hazarded after anecdotalevidence given by the patient its an educated guess by a trained personbut its still no more than a guessits cheaper and simpler to medicate first and only deal further with thosepeople who dont respondthere are diseases that havent been described yet and the root cause of manydiseases now described arent known read a book on gastroenterologysometime if you want to see a lot of them after scientific methods haverun out then its the patients freedom of choice to try any experimentalmethod they choose and its well recognized by many doctors that medicinedoesnt have all the answersthis person said that they had relief by taking the medicine maybe its amiracle cure maybe its valid how do you know you might argue with the reasoning the conclusions but your disparagingattack is unwarranted why dont you present an convincing argument for your beliefs instead of wasting our time in an ad hominem attackjackie from dyerspdcccom steve dyersubject re hismanal et alside effectsin article aprlrcedu kjivlrcedu writescan someone tell me whether or not any of the following medications has been linked to rapidexcessive weight gain andor a distorted sense of taste or smell hismanal azmacort a topical steroid to prevent asthma vancenasehismanal astemizole is most definitely linked to weight gainit really is peculiar that some antihistamines have this effectand even more so an antihistamine like astemizole which purportedlydoesnt cross the bloodbrain barrier and so tends not to causedrowsiness steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom wcsbeausuperiorcarletonca opirgsubject re is msg sensitivity superstitionin article aprwalterbellcorecom jchencttbellcorecom writesthe funny thing is the personaly stories about reactions to msg vary sogreatly some said that their heart beat speeded up with flush face someclaim their heart skipped beats once in a whileboth of these symptoms are related tachycardia getting a flushedface is due to the heart pumping the blood faster than a regularpulse i suspect this is related to an increase in sodium levels inthe blood since note sodium chloride monosodium glutamate both aresodium compounds our bodies require sodium but like everything elseone can get too much of a good thingsome reacted with headache again this could be related to increased blood flow from increasedheart rate from the sodium in the msg distended crainial arteriesessentially one of many causes of headaches there is no discrepencyher necessarilysome stomach achewell stomache ache and vomiting tend to be related again notnecessarily a discrepency more likely a related reaction vomitingoccurs as a response to get rid of a noxious compound an organism haseaten if a person cant digest the stuff entirely possible thelist of stuff people are allergic to is quite long and lacks anenzyme to break it down gastrointestinal distress stomach or bellyache would be expected some had watery eyes or running nosethese are respiratory reactions and are now considered to be similarto vomitting they are a way for the body to dispose of noxiouscompounds they are adaptiove responses of course it is possiblesome other food or environmental compound could be responsible for thesymptoms but its important to remember that a lot opf these effetscan be additive synergystic subtractive etc etc it would benecessary to know exactly what was in a dish and what else the personwas exposed to respiratory does sound suspicious but resopirationand heart rate are connected things in the body are far fromsimplevery inetractive place the vertebrate body somehad itchy skin or rashes people respond in a myriad of ways to the same compound it dependsupon what it is about the compound that pisses off their bodypollen for example of some plants aggrivates breathing in manypeople because when inhaled it sets of the immune system and anhistamine attack is launched the immune system goes overboardcausing the allergic person a lot of misery and someone with anallergy to some pollens will have trouble with some herb teas thatcontain pollens chamomile linden etc drinking the substance canperturb that persons system as much as inhaling it more serious accusations include respiration difficulty see above and dont think that heart rate changes and circulatoryproblems are not serious they can be deadlyand brain damage the area of the brain effected is the neuroendocrine systemcontrolling the release of gonadotropin the suprahormone controllingthe cyclical release of testosterone and estradiol as well as somatostatinand other steroids testing for effective dose would be uh a wee bit unethicalnow here is a new one vomiting my guess is that msg becomes the number onesuspect of any problem in this case it might be just foodpoisoning absolutely but it could also be some synergystic mess from eating say undetected shrimp or mushrooms to which many are allergic plustoo much alcohol and inhaling too much diesel fumes biking homeplus lets say having contracted flu from ones sig other daysbefore from drinking out of the same glass could be all sorts ofthingsbut it might be the msg if you heard things about msg you may think it must be itif noone else got sick its likely not food poisoning probablystomach flu or an undetected thing the guys allergic toanyway the human bodys not a machine people vary widely in theirresponses and a lot of reactions are due to combinations of things dianne murray wcsbeauccscarletoncafrom mmmcupportalcom mark robert thorsonsubject re eumemics was eugenicsa person posted certain stuff to this newsgroup which were highlyselected quotes stripped of their context here is the completeposting which was quoted lacking the context of other postings in which it was made probably within years a new type of eugenics will be possible maybe even sooner we are now mapping the human genome we will then start to work on manipulation of that genome using genetic engineering we will be able to insert whatever genes we want no breeding no hybrids etc the ethical question is should we do this should we make a race of diseasefree longlived arnold schwartzeneggermuscled supermen even if we canprobably within years it will be possible to disassemble andreassemble our bodies at the molecular level not only will flawlesscosmetic surgery be possible but flawless cosmetic psychosurgerywhat will it be like to store all the prices of shelfpriced barcodedgoods in your head and catch all the errors they make in the storesfavor at safeway what will it be like to mentally edit and spellcheck your responses to the questions posed by a phone caller sellingvacation timeshare optionsindeed we are today a nation at risk the threat is not from bad genesbut bad memes memes are the basic units of culture as opposed to geneswhich are the units of geneticswe stand on the brink of new memeamplification technologies harmfulmemes which formerly were restricted in their destructive power willrun rampant over the countryside laying waste to the real benefits thatfuture technology has to offerfor example jeremy rifkin has been busy trying to whip up emotionsagainst the new genetically engineered tomatoes under development atcalgene this guy is inventing harmful memes a virtual memetic typhoidmarywe must expand the publichealth laws to include quarantine of peoplewith harmful memes they should not be allowed to infect other peoplewith their memes against geneticallyengineered food electromagneticfields and the space shuttle solid rocket boostersfrom brianquakesylmarcaus brian k yodersubject re is msg sensitivity superstitionhave you ever met a chemist a food industry businessman you mustpersonally know a lot of them for you to be able to be so certain that theyare evil mosters whose only goal is to inflict as much pain and diseaseas possible into the general public gimme a break in article aprrtsgmotcom lundbyrtsgmotcom walter f lundby writesis there such a thing as msg monosodium glutamate sensitivitysuperstition anybody here have experience to the contrary person who is very sensitive to msg and whose wife and kids aretoo i want to know why the food industry wants to put msg in food because it makes the food taste better why does it put salt in foodsame reasoni really dont understandobviously somebody in the industry give me some reasons whyis it an industrial byproduct that needs getting get rid of of course not although i would think that a person like you would be abig fan of such recycling if that were the caseis it to cover up the fact that the recipes are not very good or the food is poor quality on occasion thats probably the case but in general the idea is that msgimproves the flavor of certain foods do some of you get a sadistic pleasure out of making some of us sick no do the taste testers have some defect in their flavor sensors mouth etc that msg corrects no i really dont understand obviously also nitrosiamines sp as i recall these are natural byproducts of heating up certain foodsthey dont put it in there have a number of criteria in choosing how to process food they want tomake it taste good look good sell for a good price etc the fact that theyuse it tells me that they think that it contributes to those goals they areinterested in one of those goals is not making people sick such a goalwoud quickly drive them out of business and for no benefit i think outlaw the use of these substances without warning labels aslarge as those on cig packages warning of what in california there is a law requiring that anything whichcontains a carcinogen be labeled that includes every gasline pump mostfoods and even money cleaning machines because nickel is a mild carcinogenthe result is that now nobody pays any attention to any of the warnings require of comparable products on the market to be free of thesesubstances and state that they are free of msg dyes nitrosiamines andsulfites on the package why what if not of people wanted to buy this ugly rotten notastastyfood i guess it will just be wasted huh how terribly efficient while at it outlaw yellow dye for that matter why dye food because it makes food look better i like food that looks goodif vitamin companies want to do that it is fine but who are you totell them how to make vitamins who are you to tell me whether i shouldbuy flavored vitamins for my kids who cant swallow the conventional oneswhole keep food food quit putting in junk how do you define junk is putting salt in food bad what aboutpepper what about alcohol as a preservative what about sealing jarswith wax what about vinegar you seem to think that chemicals aresomehow different than food the fact is that all foods are chemicalsyou are just expressing an irrational prejudice against food processing brianfrom blskeatinganueduau the new improved brian scearcesubject re krillean photographyinreplyto todamhypcharlesunlvedus message of mon apr gmtnewsgroups scienergysciimageprocessingscianthropologyaltsciphysicsnewtheoriessciskepticscimedaltalienvisitorssubject re krillean photographyreferences aprunlvedudistribution text follows this linetodamhypcharlesunlvedu brian m huey writes i am looking for any informationsupplies that will allow doityourselfers to take krillean pictures im thinking that education suppliers for schools might have a appartus for sale but i dont know any of the companies any info is greatly appreciated in case you dont know krillean photography to the best of my knowledge involves taking pictures of an most of the time organic object between charged plates the picture will show energy patterns or spikes around the object photographed and depending on what type of object it is the spikes or energy patterns will vary one might extrapolate here and say that this proves that every object within the universe as we know it has its own energy signaturethere have been a number of scientific papers in peerreviewed journalspublished about kirlian photography in the early s sorry i cant bemore specific but it is a long time since i read them they would describewhat is needed and how to set up the apparatus these papers demonstrate that the auras obtained by kirlian photography canbe completely explained by the effect of the electric currents used on themoisture in the object being photographed it has nothing to do with theenergy signature of organic objectsi did a science project on kirlian photography when i was in high schooli was able to obtain wonderful auras from rocks and pebbles and the like byfirst dunking them in waterbarbarablssysenganueduaui generally avoid temptation unless i cant resist it mae west from bjclevelandfreenetedu mike e romanosubject home medical testsi am looking for current sources for lists of all the homemedical tests currently legally availablei believe this trend of allowing tests at home wherefeasible decreased medical costs by a factor of ormore and allows the patient some time and privacy toconsider the best action from the results of such testsin fact i believe home medical tests and certain basictests for serious diseases such as cancer heart diseaseshould be offered free to the american publicthis could actually help to reduce national medical costssince many would have an earlier opportunity to knowabout and work toward recuperation or curemike romano sir i admit your genral rulethat every poet is a foolbut you yourself may serve to show itthat every fool is not a poet a popefrom ronrothrosecom ron rothsubject selective placebojb romdasuclinkberkeleyedu ella i baff writesjb jb ron roth recommends once you have your hypoglycemia confirmed through thejb proper channels you might consider the followingjb diet omittedjb jb ronwhat do you consider to be proper channelsthis sounds suspiciously im glad it caught your eye thats the purpose of this forum to educate those eager to learn about the facts of life that phrase is used to bridle the frenzy of all the wouldbe respondents who otherwise would feel being left out as the proper authorities to be consulted on that topic in short it means absolutely nothingjb like a blood chemistryglucose tolerance and the likesuddenly chemistryjb exists you know perfectly well that this person can be saved needless troublejb and expense with simple muscle testing and hair analysis to diagnosenojb confirm any aberrant physiologybut then againmaybe thats what you mean muscle testing and hair analysis eh so what other fascinating spaceage medical techniques do you use do you sit under a pyramid over night as well to shrink your brain back to normal after a mind expanding day at your save the earth clinicjb were you able to understand dick kings post that of diseases is not thyjb evaluate the statistic you cited from the new england journal of medicine coul once i figure out what you are trying to say ill still have to wrestle with the possibility of you conceivably not being able to understand my answer to your questionjb ronhave you ever thought about why you never post in mischealthalternajb tiveand insist instead upon insinuating your untrained nonmedical oftenjb delusional notions of health and disease into this forum i suspect from yourjb apparent anger toward mds and heteropathic medicine that there may be an you little psychoanalytical rascal you got me all figured out ja jb underlying father problemof course i can confirm this by surrogate musclejb testing one of my patients while they ponder my theory to see if one of theirjb previously weak indicator muscles strengthensor do you have reservationsjb about my unique methods of diagnosis jb jb john badanes dc cajb romdasuclinkberkeleyedu oh man when are you going to start teaching all this stuff ill bet everyone on this net must be absolutely dying to learn more about going beyond spinal adjustments and head straight for the mind for some freudian subluxation ron rosereader p in the next world youre on your own rosemail usenet rose media hamilton from cafomenuucp chuck forsberg wakgxsubject re my new diet it works great in article pittuucp gebcspittedu gordon banks writesin article apromenuucp cafomenuucp chuck forsberg wakgx writesweight rebound is a term used in the medical literature onobesity to denote weight regain beyond what was lost in a dietcycle there are any number of terms which mean one thing tocan you provide a reference to substantiate that gaining backthe lost weight does not constitute weight rebound until itexceeds the starting weight or is this oral tradition thatis shared only among you obesity researchersnot one but twoobesity in europe proceedings of the st european congress on obesityannals of ny acad sci gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon chuck forsberg wakgx tektronixreedomencaf author of ymodem zmodem professionalyam zcomm and dsz omen technology inc the high reliability softwarev nw sauvie is rd portland or from doylepittedu howard r doylesubject re broken ribin article dzbbwwonebalmanacbcca jconebalmanacbcca writesfell about weeks ago down into the hold of the boat and broke orcracked a rib and wrenched and bruised my back and left arm my question i have been to a doctor and was told that it was best to do nothing and it would heal up with no long term effect and indeed i am about better however the work i do is very hard and i am still not able to go back to work the thing that worries meis the movement or clunking i feel and hear back there when i move certain ways i heard some one talking about the rib they broke years ago and that it still bothers them any opinionsyour doctor is right it is best to do nothing besides taking some painmedication initially some patients dont like this and expect or demandto have something done in these cases some physicians will tape the patient put a lot of heavy adhesive tape around the chest or prescribean elastic binder all this does is make it harder to breath but thepatient doesnt feel cheated because soemthing is being done about theproblem either way the end results are the samehoward doyledoylepittedufrom balicknynexstcom daphne balicksubject re altitude adjustmentin article mdavcrmdaca vidamdavcrmdaca vida morkunas writesi live at sealevel and am calledupon to travel to highaltitude citiesquite frequently on business the cities in question are at to feet of altitude one of them especially is very pollutedmexico city bogota la pazoften i feel faint the first two or three days i feel lightheaded andmy heart seems to pound a lot more than at sealevel also it is verydry in these cities so i will tend to drink a lot of water and keepaway from dehydrating drinks such as those containing caffeine or alcoholthing is i still have symptoms how can i ensure that my short trips thereno i dont usually have a week to acclimatize are as comfortable as possibleis there something else that i could doan unconventional remedy that you might try for altitude sickness in the andes ischewing coca leaves or taking teas made from coca leaves you might notice thatmany of the natives have wads in their mouths the tea can be obtained in samerican pharmacies this remedy alleviates some of the lightheadedness anddizziness but dont try to jog with it ive tried this when travelling andhiking in peru and ecuador the amount of cocaine you would ingest are too minuteto cause any highsalso it is a good idea to eat lightly and dress warm while adjusting to high altitudesfrom pkwvnvmswvnetedusubject help for kidney stones my girlfriend is in pain from kidney stones she says that because she has nomedical insurance she cannot get them removedmy question is there any way she can treat them herself or at least mitigatetheir effects any help is deeply appreciated advice referral to literatureetcthank youdave carvellpkwvnvmswvnetedusubject stargardts diseasefrom kmcvayonebalmanacbcca ken mcvaythanks to aldridgenetcomcom i now know a bit more about stargardtsdisease aka juvenile macular distrophy but i would like to learn morefirst what is the general prognosis is blindness the resultsecond what treatments if any are available the old frogs almanac a salute to that old frog hissef ryugen fisher v x sco xenix gt ladysmith british columbia canada serving central vancouver island with public access usenet and internet mail home to the holocaust almanacfrom levinbbncom joel b levinsubject re selective placeboronrothrosecom ron roth writesjb romdasuclinkberkeleyedu ella i baff writesjb jb ron roth recommends once you have your hypoglycemia confirmed through thejb proper channels you might consider the followingjb diet omittedjb jb ronwhat do you consider to be proper channelsthis sounds suspiciously im glad it caught your eye thats the purpose of this forum to educate those eager to learn about the facts of life that phrase is used to bridle the frenzy of all the wouldbe respondents who otherwise would feel being left out as the proper authorities to be consulted on that topic in short it means absolutely nothingan apt description of the content of just about all ronroths posts todate at least theres entertainment value though it isdiminishingfrom molnarbiscocanetca tom molnarsubject sudden numbness in armi experienced a sudden numbness in my left arm this morning just afteri completed my th set of deep squats today was my weight trainingday and i was just beginning my routine all of a sudden at the end ofthe th set my arm felt like it had gone to sleep it was cold turned paleand lost of its strength the weight i used for squats wasnt thatheavy i was working hard but not at effort i waited for a few minutes trying to shake the arm back to life and then continued withchest exercises flyes with lighter dumbells than i normally use buti dropped the left dumbell during the first set and experienced continuedarm weakness into the second so i quit training and decided not to do myusual hour on the ski machine either ill take it easy for the rest ofthe daymy arm is still somewhat numb and significantly weaker than normal my hand still tingles a bit down to the thumb color has returned to normaland it is no longer cold horrid thoughts of chunks of plaque blocking a major artery course throughmy brain im vegetarian and pretty fit from my daily exerciseregimen so that cant be it could a pinched nerve from the barcause these symptoms i hopehas this happened to anyone elsenothing like this has ever happened to me before does it come with agethankstom tom molnarunix systems group university of toronto computing communicationsfrom romdasuclinkberkeleyedu ella i baffsubject re good grief was re candida albicans what is it if anybody doctors included said to me to my face that there is no evidence of the yeast connection i cannot guarantee their safety for their incompetence ripping off their lips is justified as far as i am concernedthis doesnt sound like candida albicans to mejohn badanes dc caromdasuclinkberkeleyedufrom noringnetcomcom jon noringsubject re good grief was re candida albicans what is itin article dyerspdcccom steve dyer writesin article noringnetcomcom jon noring writesgood grief againwhy the anger i must have really touched a raw nervelets see i had symptoms that resisted all other treatments sporanoxtotally alleviated them within one week hmmm i must be psychotic yesssthats it my illness was all in my mind thanks steve for your correctdiagnosis you must have a lot of experience being out there in trenchestreating hundreds of patients a week thank you im forever in yourdebtjonoops gotta run the men in white coats are ready to take me away hahato the happy home where i can go twiddle my thumbs basket weave andmoan about my sinuses charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom lungerhelixenetdeccom dave lungersubject modified sense of taste in cancer ptwhat does a lack of taste of foods or a sense of taste that seems offwhen eating foods in someone who has cancer mean what are the possiblecauses of this why does it happenpt has stage ii breast cancer and is taking tamoxifin also has stage ivlung cancer with known cna metastasis and is taking klonopin also hadcranial radiation treatmentsthanksnot a doctor but trying to understand family members illnessfrom mryanstsciedusubject should i be angry at this doctoram i justified in being pissed off at this doctorlast saturday evening my year old son cut his finger badly with a knifei took him to a local urgent and general care clinic at pm the clinic was open till pm the receptionist went to the back and told the doctor that we were there and came back and told us the doctor would not see us because she had someplace to go at and did not want to be delayed here during the next few minutes in response to my questions with several trips to the back room the receptionist told me the doctor was doing paperwork in the back the doctor would not even look at his finger to advise us on going to the emergency room the doctor would not even speak to me she would not tell me the doctors name or her own name when asked who is in charge of the clinic she said i dont knowi realize that a private clinic is not the same as an emergency room buti was quite angry at being turned away because the doctor did not want tobe bothered my son did get three stitches at the emergency room im still trying to find out who is in charge of that clinic so i can write them a letter we will certainly never set foot in that clinic againmary ryanmryanstscieduspace telescope science institutebaltimore marylandfrom billccolhpcom bill claussensubject re altpsychoactivesfyii just posted this on altpsychoactives as a response towhat the group is fora note to the users of altpsychoactivesthis group was originally a takeoff from scimed the reason forthe formation of this group was to discuss prescription psychoactivedrugssuch as antidepressentstricyclics prozac lithiumetcantipsychoticsmelleralsp etc ocd drugsanafranil etc andso on and so forth it didnt take long for this group to degenerateinto a psudo altdrugs atmosphere thats to bad for most of theserious folks that wanted to start this group in the first place haveleft and gone back to scimed where you have to cypher throughhundreds of unrelated articles to find psychoactive datait was also to discuss reallife experiences and side effects ofthe above mentionedoh well i had unsubscribed to this group for some time and i decidedto check it today to see if anything had changednopesame oldnine or ten crap articles that this group was never intended fori think it is very hard to have a meaningfull group without itbeing moderatedtoo badoh well obviously no one really caresbill claussenwould anyone be interested in starting a similar moderated groupbill claussenfrom billccolhpcom bill claussensubject re should i be angry at this doctorreport them to your local bbb better business bureaubill claussenfrom rayengrlatechedu bill raysubject re acutane fibromyalgia syndrome and cfsdaniel prince danielprincefnzcalcomsocalcom wrote i think they should rename waco tx to wacko txi know it is just a joke but please remember the people of wacodid not ask david koresh to be a lunatic there he just happenedwaco is a lovely town i would think someone living in the homeof flakes and nut would be more sensitive from noringnetcomcom jon noringsubject re good grief was re candida albicans what is itin article romdasuclinkberkeleyedu ella i baff writes if anybody doctors included said to me to my face that there is no evidence of the yeast connection i cannot guarantee their safety for their incompetence ripping off their lips is justified as far as i am concernedthis doesnt sound like candida albicans to meno just a little anger normally i dont rip peoples lips off exceptwhen my candida has overcolonized and i become fungus man jon charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom dyerspdcccom steve dyersubject re thrush was good grief was re candida albicans what is itin article aprucsvaxsdsuedu mccurdyucsvaxsdsuedu mccurdy m writesdyer is beyond rude yeah yeah yeah i didnt threaten to rip your lips off did isnortthere have been and always will be people who are blinded by their own knowledge and unopen to anything that isnt already established given what the medical community doesnt know im surprised that he has this outlookduhfor the record i have had several outbreaks of thrush during the several past few years with no indication of immunosuppression or nutritional deficiencies i had not taken any antobiotics listen thrush is a recognized clinical syndrome with definitecharacteristics if you have thrush you have thrush because you cansee the lesions and do a culture and when you treat it it generallyresponds well if youre not otherwise immunocompromised noringsanalretentive idee fixe on having a fungal infection in his sinusesis not even in the same category here nor are these walking neurasthenicswho are convinced they have candida from reading a quack bookmy dentist who sees a fair amount of thrush recommended acidophilousafter i began taking acidophilous on a daily basis the outbreaks ceasedwhen i quit taking the acidophilous the outbreaks periodically resumed i resumed taking the acidophilous with no further outbreaks since thenso steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom noringnetcomcom jon noringsubject need reference multiple personalities disorders and allergiesi heard thirdhand not the best form of information that there was recentlypublished results of a study on multiplepersonalitydisorder syndromepatients revealing some interesting clues that the root cause of allergy mayhave a psychological trigger or basis what i heard about this study was thatin one personality a mpds patient exhibited no observable or clinical signsof inhalant allergy scratch tests were used according to what i heardwhile in other personalities they showed obvious allergy symptoms includingtesting a full on scratch tests for particular inhalantsif this is true it is truly fascinatingbut id like to know if this study was ever done and if so what the studyreally showed and where the study is published any help out therejon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom bhjellecarinaunmedu subject re my new diet it works great in article apromenuucp cafomenuucp chuck forsberg wakgx writesin article pittuucp gebcspittedu gordon banks writescan you provide a reference to substantiate that gaining backthe lost weight does not constitute weight rebound until itexceeds the starting weight or is this oral tradition thatis shared only among you obesity researchersnot one but twoobesity in europe proceedings of the st european congress on obesityannals of ny acad sci hmmm these dont look like references to me is passiveaggressivebehavior associated with weight rebound brianfrom gebcspittedu gordon bankssubject re foodrelated seizuresin article buedu dozonoffbuedu david ozonoff writesmany of these cereals are cornbased after your post i looked in theliterature and located two articles that implicated corn containstryptophan and seizures the idea is that corn in the diet mightpotentiate an already existing or latent seizure disorder not cause itcheck to see if the two kellog cereals are corn based id be interestedyears ago when i was an intern an obese young woman was brought intothe er comatose after having been reported to have grand mal seizureswhy attending a corn festival we pumped her stomach and obtainedwhat seemed like a couple of liters of corn much of it intact kernals after a few hours she woke up and was fine i was tempted to sign her out asacute corn intoxication gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re help for kidney stones in article aprwvnvmswvnetedu pkwvnvmswvnetedu writesmy girlfriend is in pain from kidney stones she says that because she has nomedical insurance she cannot get them removedmy question is there any way she can treat them herself or at least mitigatetheir effects any help is deeply appreciated advice referral to literaturemorphine or demerol is about the only effective way of stopping painthat severe obviously shell need a prescription to get such drugscant she go to the county hospital or something gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from romdasuclinkberkeleyedu ella i baffsubject getting aids from acupuncture needles someone wrote in expressing concern about getting aids from acupuncture needlesunless your friend is sharing fluids with their acupuncturist who themselves has aidsit is unlikely not impossible they will get aids from acupuncture needles generally even if accidently inoculated the normalimmune response should be enough to effectively handle the minimal contaminant involved with acupuncture needle insertion most acupuncturists use disposable needlesuse once and throw away they do this because you are not the only one concerned about transmission of diseases via this routeso its good business to advertise disposable needlesused here these needles tend to be of a lower quality however being poorly manufactured and too sharp in my opinion they tend to snag bloodvessels on insertion compared to higher quality needles if i choose to use acupuncture for a given complaint that patient will get their own set of new needles which are sterilized between treatments the risk here for hepatitis hiv etc transmission is that i could mistakenly use an infected persons needles accidently on the wrong patientbut clear labelling and paying attention all but eliminates this risk better quality needles tend to slide past vessels and nerves avoiding unpleasant painful snagsand hematomasso i use them acupuncture needles come in many lengths and thicknessesbut they are all solid when compared to their injectionstyle cousins in china herbal solutionsand western pharmaceuticals are occasionally injected into meridian points purported to have tcm physiologic effects and so require the same hollow needles used for injecting fluid medicine this meansthinkingtinythat a samll amount of tissue the diameter of the needle bore will be injected into the body as it would be in a typical shot when the skin is puntured on the other hand when the solid acupuncture needle is inserted the skin tends to squeeze the needle from the tip to the level of insertion such that any cooties that havent been schmeared away with alcohol before insertion tend to remain on the surface of the skin minimizing invasion from the exterior of course in tcmthe bodys exterior is protected by the wei protective qiso infection is unlikelyor in other wordsthere is a normal inflammatory and immune response that accompanies tissue damage incurred at the puncture sitewhile im fairly certain your friend will not have a transferable disease transmitted to them via acupuncture needle insertion i would like to know for what complaint they have consulted the acupuncturistnot to know if it would be harmful but to know if it would be helpful john badanes dc caromdasuclinkberkeleyedu from ej draper draperodinmdauthtmcedusubject re do we need a radiologist to read an ultrasoundin article bluecispittedu kenneth gilbert kxgstpitteduwritesthis is one of those sticky areas of medicine where battles frequentlyrage with respect to your ob i suspect that she has been certified inultrasound diagnostics and is thus allowed to use it and bill for itsuse many cardiologists also use ultrasound echocardiography and arein fact considered by many to be the experts i am not sure where obsstand in this regard but i suspect that they are at least as good as theradioligists flameretardant suit readyif it were my wife i would insist that a radiologist be involved in theprocess radiologist are intensively trained in the process ofinterpreting diagnostic imaging data and are aware of many things thatother physicians arent aware of would you want a radiologist todeliver your baby if you wouldnt then why would you want a obgyn toread your ultrasound studyin my opinion the process should involve a obgyn and a radiologist ej ed draper repard radiologicpathologic institute the university of texas md anderson cancer center draperodinmdauthtmcedufrom mrlpfcmitedu mark londonsubject corneal erosionabrasionsfor several years i have been dealing with reccurring corneal erosion theredoes not seem to be much known about the cause of such a problem my currentepisode is pretty bad since it is located in the middle of the cornea if itsbad enough the usual treatment for it is puncture therapy however my doctorthis time is trying to let it heal by itself by putting a contact lens toprotect the area apparently the problem is not that common but id be curiousif anyone else out there has a similar problem perhaps to see if a cause can befound mark londonmrlneruspfcmitedufrom russpmafireinelgov russ brownsubject re altitude adjustmentin article mdavcrmdaca vidamdavcrmdaca vida morkunas writesi live at sealevel and am calledupon to travel to highaltitude citiesquite frequently on business the cities in question are at to feet of altitude one of them especially is very pollutedmexico city bogota la pazoften i feel faint the first two or three days i feel lightheaded andmy heart seems to pound a lot more than at sealevel also it is verydry in these cities so i will tend to drink a lot of water and keepaway from dehydrating drinks such as those containing caffeine or alcoholthing is i still have symptoms how can i ensure that my short trips thereno i dont usually have a week to acclimatize are as comfortable as possibleis there something else that i could dogo three days early preliminary acclimatization takes days ittakes weeks or months for full acclimatization could you beexperiencing some jet lag toofrom rindenterprisebihharvardedu david rindsubject re good grief was re candida albicans what is itin article noringcsnsxkmonetcomcom noringnetcomcom jon noring writesin article rindenterprisebihharvardedu david rind writesthere is no convincing evidence that such a disease existstheres a lot of evidence it just hasnt been adequately gathered andpublished in a way that will convince the diehard melancholic skepticswho quiver everytime the word anecdote or empirical is usedno theres no evidence that would convince any but the most credulousthe evidence is identical to the sort of evidence that has beenused to justify all sorts of quack treatments for quack diseasesin the pastmedicine on the right road but methinks that some who hold too firmlyto the party line are academics who havent been in the trenches long enoughactually treating patientsi like the implication here it must not be that the quacks makingmillions off such diseases are biased rather that those whodoubt their existence dont understand the real world it seemseasy to picture a th centure snake oil salesman saying the samethinghowever i have been in the trenches long enough to have seen multiplequack diseases rise and fall in popularity systemic yeast syndomeseems to be making a resurgence it had fallen off a few years agothere will be new such diseases im sure with bestselling booksand expensive therapiesif anybody doctors included said to me to myface that there is no evidence of the yeast connection i cannot guaranteetheir safety for their incompetence ripping off their lips is justified asfar as i am concernedwell this of course is convincing i guess id better start diagnosingany illnesses that people want so that i can keep my lips david rindrindenterprisebihharvardedufrom icglnasuacadbitnetsubject re burzynskis antineoplastonsa good source of information on burzynskis method is in the cancer industryby pulitzerprize nominee ralph moss also a nonprofit organization calledpeople against cancer which was formed for the purpose of allowing cancerpatients to access information regarding cancer therapies not endorsed by thecancer industry but which have shown highly promising results all of whichare nontoxic anyone interested in cancer therapy should contact this organization asap people against cancer po box otho ia fax peacegreg nighfrom gmarkcbnewsecbattcom gilbertmstewartsubject oxaprozinanyone have any information on the effectsorigin of oxaprozinits marketed under the name daypro and appears to be anantiinflammatory is it similar to naproxin strongertiagmsfrom mccurdyucsvaxsdsuedu mccurdy msubject thrush was good grief was re candida albicans what is itin article aldridgecthyanetcomcom aldridgenetcomcom jacquelin aldri writesdyerspdcccom steve dyer writes etc dyer youre rude medicine is not a totallly scientific endevour itsoften practiced in a disorganized manner most early treatment ofnonlife threatening illness is done on a guess hazarded after anecdotalevidence given by the patient its an educated guess by a trained personbut its still no more than a guessits cheaper and simpler to medicate first and only deal further with thosepeople who dont respond dyer is beyond rude there have been and always will be people who are blinded by their own knowledge and unopen to anything that isnt already established given what the medical community doesnt know im surprised that he has this outlookfor the record i have had several outbreaks of thrush during the several past few years with no indication of immunosuppression or nutritional deficiencies i had not taken any antobiotics my dentist who sees a fair amount of thrush recommended acidophilousafter i began taking acidophilous on a daily basis the outbreaks ceasedwhen i quit taking the acidophilous the outbreaks periodically resumed i resumed taking the acidophilous with no further outbreaks since then mike mccurdy university computing services disclaimer san diego state university mccurdyucsvaxsdsuedu everything i say may be wrongfrom jasonablarcnasagov jason austinsubject re barbecued foods and health riskin article cmvvoworldstdcom rsilverworldstdcom richard silver writes some recent postings remind me that i had read about risks associated with the barbecuing of foods namely that carcinogens are generated is this a valid concern if so is it a function of the smoke or the elevated temperatures is it a function of the cooking elements wood or charcoal vs lava rocks i wish to know more thanks ive read mixed opinions on this singed meat can containcarcinogens but unless you eat barbecued meat every meal youreprobably not at much risk i think i will live life on the edge andgrill my foodive also read that using petroleum based charcoal starter canput some unwanted toxins in your food or at least unwanted odorive been using egg carton cups dipped in paraffin for fire startersand it actually lights faster and easier than lighter fluid severalpeople have told me that they have excellent results with a chimneybasically a steel cylinder with wholes punched in the side ive beenmeaning to get one of these but one hasnt presented itself whileive been out shopping you can make one from a coffee can but i buymy coffee as whole beans in a bag so i havent had a big enough canlaying aroundjason c austinjcaustinlarcnasagovfrom gebcspittedu gordon bankssubject re seizures infantile spasms in article aprdbasednuodeccom dufaultlftfldenetdeccom md writesif anyone knows of any database or newsgroup or as i mentioned up aboveany information relating to this disorder i would sure appreciate hearingfrom you i am not trying to play doctor here but only trying to gatherinformation about it as i know now these particular types of disordersare still not really well understood by the medical community and so imgoing to see nowif somehow the internet can at least give me alittleinsight thanks there is no database for infantile spasms nor a newsgroup that iknow of the medical library will be the best source of informationfor you gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re how to diagnose lyme reallyin article csylfwatsonibmcom yozzowatsonibmcom ralph yozzo writeswhy do you think he would be called a quack the quacks dont do culturesthey poopoo doing more lab tests this is lyme believe me ive are you arguing that the lyme lab test is accurateif you culture out the spirochete it is virtually certainthe patient has lyme i suppose you could have contaminationin an exceptionally sloppy lab but normally not there are nofalse positives gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re obgyn residencyin article rbveterminatorrsitdumichedu donaldmackiemedumichedu donald mackie writesfmgs who are not citizens are like all aliens in a difficultsituation only citizens get to vote here so noncitizens are oflittle or no interest to legislators also the noncitizen may wellbe in the middle of processing for resident alien status there is astron sense that rocking the boat eg suing a residency programwill delay the granting of that status perhaps for everone should be aware that foreign doctors admitted for trainingare ineligible to apply for resident alien status in orderto get the green card they have to return to their country andapply at the embassy there of course many somehow get aroundthis problem often it is by agreeing to practice in a townwith a need and then the congressman from that district tacksa rider onto a bill saying dr x will be allowed to have permanentresidency in the us a lot of bills in congress have such ridersattached to them marrying a us citizen is the most common althoughnow they are even cracking down on that and trying to tell uscitizens they must follow their spouse back to the phillipines orwhereever gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re liver spotsin article aprnewsengconvexcom cashconvexcom peter cash writeswhat causes those little brown spots on older peoples hands are theycalled liver spots because theyre sort of livercolored or do theyindicate some actual liver dysfunctionsenile keratoses have nothing to do with the liver gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from karlanasazicom karl dussiksubject re danafaber cancer institute in article apretekchalmersse esalimetekchalmersse salim chagan writescan anyone send me the adress to danafaber cancer institute in boston usa missing rdanafarber cancer institute binney streetboston ma karl dussikalumnus department of biostatistics and epidemiology from dozonoffbuedu david ozonoffsubject re foodrelated seizuressharon paulson paulsontablarcnasagov wrote much deleted the fact that this happened while eating two sugar coated cereals made by kellogs makes me think she might be having an allergic reaction to something in the coating or the cereals of the four of us in our immediate family kathryn shows the least signs of the hay fever running nose itchy eyes etc but we have a lot of allergies in our family history including some weird food allergies nuts mushrooms many of these cereals are cornbased after your post i looked in theliterature and located two articles that implicated corn containstryptophan and seizures the idea is that corn in the diet mightpotentiate an already existing or latent seizure disorder not cause itcheck to see if the two kellog cereals are corn based id be interesteddavid ozonoff md mph boston university school of public healthdozonoffmeditvaxbuedu east concord st tc boston ma from laugerssdgwymdccom john laugersubject imitrex and heart attacksmy girlfriend just started taking imitrex for her migraine headaches herneurologist diagnosed her as having depression and suffering from reboundheadaches due to daily doses of analgesics she stopped taking allanalgesics and caffine as of last thursday the weekend was prettybad but she made it through with the help of imitrex about every hours her third injection of imitrex during the worst of the withdrawl onfriday and six hours after the first of the day left her very sick skinwas flushed sweating vomiting and had severe headache pain it subsidedin an hour or so since then she has been taking imitrex as needed tocontrol the pain immediately after taking it she has increased head painfor ten minutes dizziness and mild nausea and mild chest pains a friendof hers mentioned that her doctor was wary of imitrex because it had causedheart attacks in several people apparently the mild chest pains werecommon in these other people prior to there attacks is this just rumor has anyone else heard of these symptoms my girlfriend also has mitralvalve prolapseopinions are mine or others but definately not mdaslaugerssdgwymdccommcdonnell douglas aerospace huntington beach california usafrom nashbiologysxlannrcca john nashsubject re is msg sensitivity superstitionin article aprlmpsbbscommmotcom dougbcommmotcom doug bank writesfrom dougbcommmotcom doug banksubject re is msg sensitivity superstitiondate thu apr gmtin article aprtmsmicroticom davidtmsmicroticom david thomas writeslots of editing out of previuos postshere is another anecdotal story i am a picky eater and never wanted to try chinese food however i finally tried some in order to please agirl i was seeing at the time i had never heard of chinese restaurantsyndrome a group of us went to the restaurant and all shared differentdishes it didnt taste great but i decided it wasnt so bad we wenthome and went to bed early i woke up at am and puked my guts outsi threw up for so long that im not kidding i pulled a muscle inmy tongue dry heaves and everything no one else got sick and imnot allergic to anything that i know of suffice to say that i wont go into a chinese restaurant unless i am physically threatened the smell of the food makes me ill and that isa psycholgical reaction when i have been dragged in to sufferthrough beef and broccoli without any sauces i insist on no msg i havent gotten sick yetfunny about that my wife my girlfriend at the time used to get sick after eating certain foods at various asian restaurants and never knew why shed go pale and sweaty and then vomit copiously a couple of us ventured a connection with msg and her response was msg whats that it also happened when she pigged out on some brands of savoury crackers and chips which i noticed later had msg on the label dont know about double blinds but avoiding msg has stopped her being sick at restaurantscheers johnjohn nash email nashbiologysxlannrccainstitute for biological sciences national research council of canadacell physiology group ottawa ontario canada disclaimer all opinions are mine not nrcs from kingreasoningcom dick kingsubject how to interview a doctormy insurance company encourages annual physicals and at my age imthinking that biannual physicals at least might be a good idea thereforeim shopping for a gp might as well get a good onecould the assembled net wisdom suggest things i should look for or point me tothe faq archive if on this topic if there is one please email i suspect that this topic is real net clutter baitdkfrom gebcspittedu gordon bankssubject re sudden numbness in armin article culgcggpuutccutorontoca molnarbiscocanetca tom molnar writesi experienced a sudden numbness in my left arm this morning just afteri completed my th set of deep squats today was my weight trainingday and i was just beginning my routine all of a sudden at the end ofthe th set my arm felt like it had gone to sleep it was cold turned paleand lost of its strength the weight i used for squats wasnt thatheavy i was working hard but not at effort i waited for a few minutes trying to shake the arm back to life and then continued withchest exercises flyes with lighter dumbells than i normally use buti dropped the left dumbell during the first set and experienced continuedarm weakness into the second so i quit training and decided not to do myusual hour on the ski machine either ill take it easy for the rest ofthe daymy arm is still somewhat numb and significantly weaker than normal my hand still tingles a bit down to the thumb color has returned to normaland it is no longer cold horrid thoughts of chunks of plaque blocking a major artery course throughmy brain im vegetarian and pretty fit from my daily exerciseregimen so that cant be it could a pinched nerve from the barcause these symptoms i hopeit likely has nothing to do with chunks of plaque but it sounds likeyou may have a neurovascular compromise to your arm and you need medicalattention before doing any more weight lifting gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from dfieldflutecalpolyedu infospunj dan fieldsubject re too many mrisin article aprinformixcom probertsinformixcom paul roberts writesin article aprkestreledu kingreasoningcom dick king writesi recall reading somewhere during my youth in some science popularizationbook that whyle isotope changes dont normally affect chemistry a consumptionof only heavy water would be fatal and that seeds watered only with heavywater do not sprout does anyone know about thisi also heard this i always thought it might make a good eposide ofcolumbo for someone to be poisoned with heavy water it wouldntshow up in any chemical testthat would be a very expensive toxin indeed daniel r field aka infospunj joe are you late dfieldoboecalpolyedu dan no but im working on it biochemistry biotechnology california polytechnic state u from ghicafigcitibcom renato ghicasubject seek sedative informationhas any one heard of a sedative called rhoepnol made by larouchei believe any info as to side effects or equivalent tranquillizersthanks this will just take a minuteim doneit worked on my machinefrom jnielsenmagnusacsohiostateedu john f nielsensubject re good grief was re candida albicans what is itin article noringcubvynetcomcom noringnetcomcom jon noring writesin article dyerspdcccom steve dyer writesin article noringnetcomcom jon noring writesgood grief againwhy the anger i must have really touched a raw nervelets see i had symptoms that resisted all other treatments sporanoxtotally alleviated them within one week hmmm i must be psychotic yesssthats it my illness was all in my mind thanks steve for your correctdiagnosis you must have a lot of experience being out there in trenchestreating hundreds of patients a week thank you im forever in yourdebtjonoops gotta run the men in white coats are ready to take me away hahato the happy home where i can go twiddle my thumbs basket weave andmoan about my sinusesever heard of something called the placebo effect i think dyer isreacting because it looks to be yet another case of the same oldquackery over and over againit true that current medical knowledge is limited but do you realizejust how many quacks exist eager to suck your its playing thelottery at bestif the results you got were so clear and obvious would you mindtrying a little experiment to see if it is true it would be quitesimple have sugar pills and have real pills take one set for oneweek and the other set for another week without knowing which ones arethe real pills then at the end of the weeks compare the resultslets say youre wife would know which are the real ones if what youare experiencing is true there should be a marked difference betweeneach week john john nielsen magnus consultant to you baldrick the renaissance was just something that happened to other people wasnt it the black adder subject re bates method for myopiafrom jconebalmanacbccadr willian horatio bates born and graduated from med school medical career hampered by spells of total amnesia published in his great work the cure of imperfect eyesight by treatment without glasses he made claims about how the eye actually works that aresimply not true aldous huxley was one of the more high profilebeleivers in his system mr huxley while giving a lecture on bates systemforgot the lecture that he was supposedely reading and had to put thepaper right up to his eyes and then resorted to a magnifying glass fromhis pocket book have been written debunking this technique howeverthey remain less read than the original fraud cheers jconebalmanacbcca john cross the old frogs almanac home of the almanac unix users group v public access usenet x vancouver island british columbia waffle xenix from kelleyvetvetpurdueedu stephen kelleysubject re should i be angry at this doctorin article aprstsciedu mryanstsciedu writes am i justified in being pissed off at this doctor last saturday evening my year old son cut his finger badly with a knife i took him to a local urgent and general care clinic at pm the story deleted be bothered my son did get three stitches at the emergency room im still trying to find out who is in charge of that clinic so i can write them a letter we will certainly never set foot in that clinic again the people in charge already know what kind of care they are providing and they dont give a rats ass about your repeat businessyou are much more likely to do some good writing to local newspapersand broadcast news shows if you do keep the letter short and to the pointso they dont discard it out of hand and emphasize exactly what youare upset aboutits possible that the local health department can help you complain to someone official but really that clinic exists for the sole purpose of generating walkin income through advertising and nothing you can do will change them all you can hope for is to help someone else avoid themim glad it sounds like your son did ok anywaymy opinion only of coursestevefrom sbrunoregonuoregonedu sarah anne brundagesubject re krillean photographyi did a science project on kirlian photography when i was in high schooli was able to obtain wonderful auras from rocks and pebbles and the like byfirst dunking them in water i know this is a little weird but i know that world magazine you knownational geo for children did a very simple and concise article on kirlianphotography they had some neat pictures too a friend of mines mother hada book on kirlian photography only its photographs took a radiologist to interpret they world magazine warned us all that it was very dangerousprobably to stop curious children from experimenting with it mind you thiswas years ago at least and boy does that say something about my agesarah brundagesbrunoregonuoregonedufrom davidstatcom david dodellsubject hicn medical newsletter part cut here hicnet medical newsletter page volume number april gonorrhea colorado source mmwr date apr the number of reported cases of gonorrhea in colorado increased from to after declining steadily during the s in comparison in the united states reported cases of gonorrhea in continued an overall decreasing trend this report summarizes an analysis of the increase in gonorrhea in colorado in and characterizes trends in the occurrence of this disease from through in cases of gonorrhea were reported to the colorado department of health cdh compared with cases reported in during reported cases increased and among females and males respectively table similar increases occurred among blacks whites and hispanics and respectively however the number of reported cases with race not specified increased from to and constituted of all reported cases in although the largest proportional increases by age groups occurred among persons aged years and greater than or equal to years these age groups accounted for only of all reported cases in persons in the year age group accounted for the largest number of reported cases of gonorrhea during and the highest age groupspecific rate per reported cases of gonorrhea increased in the fivecounty denver metropolitan area population but decreased elsewhere in the state table half the cases of gonorrhea in the denver metropolitan area occurred in of the census tracts these represent neighborhoods considered by sexually transmitted diseases stdsacquired immunodeficiency syndrome aids field staff to be the focus of gang and drug activity when compared with the number of gonorrhea cases diagnosed among men in the denver metro health clinic dmhc the primary public std clinic in the denver metropolitan area increased in and the number of visits by males to the clinic increased concurrently the number of cases diagnosed among women increased by among selfidentified heterosexual men the number of gonorrhea cases diagnosed at dmhc increased and comprised of all cases diagnosed in males while the number of cases diagnosed among selfidentified homosexual men remained low and in and respectively four selected laboratories in the metropolitan denver area ie hmo university hospital nonprofit family planning and commercial were contacted to determine whether gonorrhea culturepositivity rates increased gonorrhea culturepositivity rates in three of four laboratories contacted increased from to while the rate was virtually unchanged in the fourth ie nonprofit family planning from through reported cases of gonorrhea among whites and hispanics in colorado decreased in comparison reported cases among blacks hicnet medical newsletter page volume number april increased since figure during the population in colorado increased for blacks for hispanics and for whites in the gonorrhea rate for blacks per persons was times that for whites per and times that for hispanics per table among black females reported cases of gonorrhea increased from through in the year age group among black males cases increased from through in both the and year age groups reported by ka gershman md jm finn ne spencer msph stdaids program re hoffman md state epidemiologist colorado dept of health jm douglas md denver dept of health and hospitals surveillance and information systems br div of sexually transmitted diseases and hiv prevention national center for prevention svcs cdc editorial note the increase in reported gonorrhea cases in colorado in may represent an overall increase in the occurrence of this disease or more complete reporting stimulated by visitations to laboratories by cdh surveillance staff during the increases in confirmed gonorrhea cases at dmhc and in culturepositivity rates in three of four laboratories suggest a real increase in gonorrhea rather than a reporting artifact however the stable culturepositivity rate in the nonprofit family planning laboratory which serves a network of clinics statewide indicates that the gonorrhea increase did not uniformly affect all segments of the population one possible explanation for the increased occurrence of gonorrhea in colorado may be gang and drugrelated sexual behavior as implicated in a recent outbreak of drugresistant gonorrhea and other stds in colorado springs although the high morbidity census tracts in the denver metropolitan area coincide with areas of gang and drug activity this hypothesis requires further assessment to examine the possible role of drug use implicated previously as a factor contributing to the national increase in syphilis the cdh stdaids program is collecting information from all persons in whom gonorrhea is diagnosed regarding drug use exchange of sex for money or drugs and gang affiliation the gonorrhea rate for blacks in colorado substantially exceeds the national health objective for the year per objective a race is likely a risk marker rather than a risk factor for gonorrhea and other stds risk markers may be useful for identifying groups at greatest risk for stds and for targeting prevention efforts moreover racespecific variation in std rates may reflect differences in factors such as socioeconomic status access to medical care and highrisk behaviors in response to the increased occurrence of gonorrhea in colorado interventions initiated by the cdh stdaids program include targeting partner notification in the denver metropolitan area to persons in groups at increased risk eg yearold black females and yearold black males implementing a media campaign eg public service radio hicnet medical newsletter page volume number april announcements signs on city buses newspaper advertisements and posters in schools and clinics to promote awareness of std risk and prevention targeted primarily at highrisk groups and developing teams of peer educators to perform educational outreach in highrisk neighborhoods the educational interventions are being developed and implemented with the assistance of members of the target groups and with input from a forum of community leaders and healthcare providers references cdc table ii cases of selected notifiable diseases united states weeks ending december and december nd week mmwr cdc gangrelated outbreak of penicillinaseproducing neisseria gonorrhoeae and other sexually transmitted diseases colorado springs colorado mmwr cdc relationship of syphilis to drug use and prostitution connecticut and philadelphia pennsylvania mmwr rolfs rt goldberg m sharrar rg risk factors for syphilis cocaine use and prostitution am j public health andrus jk fleming dw harger dr et al partner notification can it control epidemic syphilis ann intern med gershman ka rolfs rt diverging gonorrhea and syphilis trends in the s are they real am j public health public health service healthy people national health promotion and disease prevention objectivesfull report with commentary washington dc us department of health and human services public health service dhhs publication no phs hicnet medical newsletter page volume number april effectiveness in disease and injury prevention impact of adult safetybelt use on restraint use among children less than years of age selected states and source mmwr date apr motorvehicle crashes are the leading cause of death among children and young adults in the united states and account for more than million years of potential life lost before age annually child safety seats and safety belts can substantially reduce this loss from through all states passed legislation requiring the use of child safety seats or safety belts for children although these laws reduce injuries to young children by an estimated motorvehicle crashrelated injuries remain a major cause of disability and death among us children while the use of occupant restraints among children decreases inversely with age usage for those aged years aged years and aged years in addition parents who do not use safety belts themselves are less likely to use restraints for their children to characterize the association between adult safetybelt use and adultreported consistent use of occupant restraints for the youngest child aged less than years within a household cdc analyzed data obtained from the behavioral risk factor surveillance system brfss during and this report summarizes the findings from this study data were available for respondents aged greater than or equal to years in states that participated in brfss a populationbased randomdigitdialed telephone survey and administered a standard injury control and child safety module developed by cdc of these respondents had a child aged less than years in their household each respondent was asked to specify the childs age and the frequency of restraint use for that child the two categories of child restraint and adult safetybelt use in this analysis were consistent use ie always buckle up and less than consistent use ie almost always sometimes rarely or never buckle up data were weighted to provide estimates representative of each state software for survey data analysis sudaan was used to calculate point estimates and confidence intervals statistically significant differences were defined by p values of less than each of the states had some type of child restraint law of these six arizona kentucky maine nebraska rhode island and west virginia had no law requiring adults to use safety belts four idaho maryland pennsylvania and washington had a secondary enforcement mandatory safetybelt law ie a vehicle had to be stopped for a traffic violation before a citation for nonuse of safety belts could be issued and one state new york had a primary enforcement mandatory safetybelt law ie vehicles could be stopped for a safetybelt law violation alone in nine states childpassenger protection hicnet medical newsletter page volume number april laws included all children aged less than years but the other two states used both age and size of the child as criteria for mandatory restraint use the analysis in this report subgrouped states into those having a law requiring adult safetybelt use law states and those without such a law nolaw states overall of children aged less than years reportedly were not consistently restrained during automobile travel both child restraint use and adult restraint use were significantly higher p less than chisquare test in law states than in nolaw states versus and versus respectively high rates of restraint use for children aged less than or equal to year were reported by both adults indicating consistent and less than consistent safetybelt use figure adults with consistent use reported high rates of childoccupant restraint use regardless of the childs age range for yearolds to for yearolds in comparison for adults reporting less than consistent safetybelt use the rate of childoccupant restraint use declined sharply by the age of the child range for yearolds to for yearolds when comparing children of consistent adult safetybelt users with children of less than consistent adult safetybelt users confidence intervals overlap for the two youngest age groups ie aged less than and year reported childoccupant restraint use in law states generally exceeded that in nolaw states regardless of age of child table in addition higher adult educational attainment was significantly associated with increased restraint use for children a factor that has also been associated with increased adult safetybelt use reported by national center for injury prevention and control national center for chronic disease prevention and health promotion cdc editorial note the findings in this report are consistent with others indicating that adults who do not use safety belts themselves are less likely to employ occupant restraints for their children because these nonbelted adults are at increased risk of crashing and more likely to exhibit other risktaking behaviors children traveling with them may be at greater risk for motorvehicle injury educational attainment of adult respondents was inversely associated with child restraint use in this report accordingly occupantprotection programs should be promoted among parents with low educational attainment because low educational attainment is often associated with low socioeconomic status such programs should be offered to adults through healthcare facilities that serve lowincome communities or through federal programs ie head start that are directed at parents with young children injuryprevention programs emphasize restraining young children in addition however efforts must be intensified to protect child occupants as hicnet medical newsletter page volume number april they become older parents especially those with low educational attainment those who do not consistently wear safety belts and those from states that do not have mandatory safetybelt use laws should be encouraged to wear safety belts and to protect their children by using approved child safety seats and safety belts finally the increased use of restraints among children may increase their likelihood of using safety belts when they become teenagers the age group characterized by the lowest rate of safetybelt use and the highest rate of fatal crashes references cdc childhood injuries in the united states am j dis child partyka sc papers on child restraints effectiveness and use washington dc us department of transportation national highway traffic safety administration report no doths guerin d mackinnon d an assessment of the california child passenger restraint requirement am j public health hall w orr b suttles d et al progress report on increasing child restraint usage through local education and distribution programs chapel hill north carolina university of north carolina at chapel hill highway safety research center national highway traffic safety administration occupant protection trends in cities washington dc us department of transportation national highway traffic safety administration wagenaar ac molnar lj margolis lh characteristics of child safety seat users accid anal prev shah bv barnwell bg hunt pn lavange lm software for survey data analysis sudaan version software documentation research triangle park north carolina research triangle institute lund ak voluntary seat belt use among us drivers geographic socioeconomic and demographic variation accid anal prev margolis lh wagenaar ac molnar lj use and misuse of automobile child restraint devices am j dis child hunter ww stutts jc stewart jr rodgman ea characteristics of seatbelt users and nonusers in a state with a mandatory use law health education hicnet medical newsletter page volume number april research arizona idaho kentucky maine maryland nebraska new york pennsylvania rhode island washington and west virginia hicnet medical newsletter page volume number april publication of cdc surveillance summaries source mmwr date apr since cdc has published the cdc surveillance summaries under separate cover as part of the mmwr series each report published in the cdc surveillance summaries focuses on public health surveillance surveillance findings are reported for a broad range of risk factors and health conditions summaries for each of the reports published in the most recent march issue of the cdc surveillance summaries are provided below all subscribers to mmwr receive the cdc surveillance summaries as well as the mmwr recommendations and reports as part of their subscriptions surveillance for and comparison of birth defect prevalences in two geographic areas united states problemcondition cdc and some states have developed surveillance systems to monitor the birth prevalence of major defects reporting period covered this report covers birth defects surveillance in metropolitan atlanta georgia and selected jurisdictions in california for the years description of system the california birth defects monitoring program and the metropolitan atlanta congenital defects program are two populationbased surveillance systems that employ similar data collection methods the prevalence estimates for diagnostic categories were based on data for for births in california and births in metropolitan atlanta the prevalences in the two areas were compared adjusting for race sex and maternal age by using poisson regression results regional differences in the prevalence of aortic stenosis fetal alcohol syndrome hip dislocationdysplasia microcephalus obstruction of the kidneyureter and scoliosislordosis may be attributable to general diagnostic variability however differences in the prevalences of armhand limb reduction encephalocele spina bifida or trisomy down syndrome are probably not attributable to differences in ascertainment because these defects are relatively easy to diagnose interpretation regional differences in prenatal diagnosis and pregnancy termination may affect prevalences of trisomy and spina bifida however the reason for differences in armhand reduction is unknown but may be related to variability in environmental exposure heterogeneity in the gene pool or random variation actions taken because of the similarities of these data bases several collaborative studies are being implemented in particular the differences in the birth prevalence of spina bifida and down syndrome will focus attention on the impact of prenatal diagnosis authors jane schulman phd nancy hicnet medical newsletter page volume number april jensvold mph gary m shaw drph california birth defects monitoring program march of dimes birth defects foundation larry d edmonds msph anne b mcclearn division of birth defects and developmental disabilities national center for environmental health cdc influenza united states problemcondition cdc monitors the emergence and spread of new influenza virus variants and the impact of influenza on morbidity and mortality annually from october through may reporting period covered this report covers us influenza surveillance conducted from october through may description of system weekly reports from the vital statistics offices of cities provided an index of influenzas impact on mortality who collaborating laboratories reported weekly identification of influenza viruses weekly morbidity reports were received both from the state and territorial epidemiologists and from sentinel family practice physicians nonsystematic reports of outbreaks and unusual illnesses were received throughout the year results during the influenza season influenza ahn and b viruses were identified in the united states with essentially equal frequency overall although both regional and temporal patterns of predominance shifted over the course of the season throughout the season increases in the indices of influenza morbidity in regions where influenza ahn predominated were similar to increases in regions where influenza b predominated only of identified viruses were influenza ahn but isolations of this subtype increased as the season waned and it subsequently predominated during the season during the season outbreaks in nursing homes were reported in association with influenza b and ahn but not influenza ahn interpretation the alternating temporal and geographic predominance of influenza strains ahn and b during the season emphasizes the importance of continual attention to regional viral strain surveillance since amantadine is effective only for treatment and prophylaxis of influenza a actions taken weekly interim analyses of surveillance data produced throughout the season allow physicians and public health officials to make informed choices regarding appropriate use of amantadine cdcs annual surveillance allows the observed viral variants to be assessed as candidates for inclusion as components in vaccines used in subsequent influenza seasons authors louisa e chapman md msph epidemiology activity office of the director division of viral and rickettsial diseases national center for infectious diseases margaret a tipple md division of quarantine national center for prevention services cdc suzanne gaventa folger mph health investigations branch division of health studies agency for toxic substances and disease registry maurice harmon phd connaught hicnet medical newsletter page volume number april laboratories pasteurmirieux company swiftwater pennsylvania alan p kendal phd european regional office world health organization copenhagen denmark nancy j cox phd influenza branch division of viral and rickettsial diseases national center for infectious diseases lawrence b schonberger md mph epidemiology activity office of the director division of viral and rickettsial diseases national center for infectious diseases cdc reference cdc cdc surveillance summaries march mmwr no sshicnet medical newsletter page volume number april clinical research news clinical research news for arizona physicians vol no april tucson arizonapublished monthly by the office of public affairs at the university of arizona health sciences center copyright the university of arizona high tech assisted reproductive technologiesfollowing the birth of the first in vitro fertilizationembryo transfer ivfet baby in a host of assisted reproductive technologies have been developed that include ivfet gamete intrafallopian tube transfer gift embryo cryopreservation freezing and gamete micromanipulation together these technologies are referred to as the hightech assisted reproductive technology art procedures ovulation induction sperm insemination and surgery for tubal disease andor pathology still are the mainstays of the therapies available for infertility management however when these fail it almost always is appropriate to proceed with one of the art procedures therefore in addition to a comprehensive basic and general infertility service at the university of arizona center for reproductive endocrinology and infertility there is a program of assisted reproduction that specializes in art procedures this program serves as a tertiary provider for those patients in the state of arizona whose infertility problems cannot be resolved by the traditional therapies the following article on back describes the art procedures available in our center clarifies appropriate applications for each and considers the realistic expectations for their success procedures included are o in vitro o fertilization embryo transfer ivfet gamete intrafallopian tube transfer o gift cryopreservation of human embryos and gamete micromanipulation this article also considers ongoing research in our program that is directed towards improved success of these technologies hicnet medical newsletter page volume number april future areas of researchin addition to ongoing research that is directed exclusively toward the management of infertile couples we are developing the technology to assist couples who are at risk for producing embryos with a serious hereditary disease this technology involves biopsying the preimplantation human embryo and then subjecting the biopsied cells to genetic analysis using either dna amplification or fluorescent in situ hybridization there are recent reports of the successful application of dna amplification by other centers for example for diagnosis of the genes for cystic fibrosis and hemophilia we hope to apply and further focus fluorescent in situ hybridization technology for probing the x chromosome the identification of which will provide a scientific basis for counselling patients who exhibit sexlinked disorders the considerable clinical application of such technology lies in the fact that it circumvents the need for prenatal diagnosis in addition to the possibility of a subsequent termination of affected fetuses in order to avoid the birth of affected children catherine racowsky phdassociate professor and director of researchdepartment of obstetrics and gynecologycollege of medicine university of arizonatucson arizona applications success rates and advances for the management of infertilitythe following are the art procedures available at the university of arizona center for reproductive endocrinology and infertility in vitro fertilization embryo transfer is the core art procedure of our assisted reproduction program this procedure involves retrieval of unfertilized eggs from the ovary their insemination in vitro in a dish and the culture of resultant embryos for or days before they are transferred to the patients uterus all cultures are maintained in an incubator under strictly controlled atmospheric and temperature conditions before being processed for use in insemination semen samples are evaluated in our andrology laboratory using both subjective light microscopy and computerhicnet medical newsletter page volume number april assisted semen analyses to ensure an adequate number of eggs with which to perform ivfet or indeed gift follicular development is typically stimulated with gonadotropins perganol metrodin gonadotropin releasing hormone gnrh factrel lutrepulse andor gnrh analogues lupron depo lupron synarel occasionally however ivfet is accomplished with eggs obtained in nonstimulated cycles while some programs utilize laparoscopic egg retrieval in the operating room with the patient under general anesthesia we undertake the less costly approach of ultrasoundguided retrieval in our infertility unit with the patient sedated couples who resort to ivfet exhibit such pathologies as tubal deficiencies ovulatory dysfunction endometriosis andor mild forms of male factor infertility according to the united states ivf registry the overall success rate for ivfet nationwide has stabilized at about percent per cycle results from our program involving patients who have undergone ivfet cycles reflect a comparable success rate nevertheless the overall incidence of success with this procedure is disconcertingly low and emphasizes the need to address those physiological factors that limit achievement of a higher percentage of pregnancies well recognized predictors of outcome include patient age response to exogenous ovarian stimulation quality of sperm and number of repeated ivfet cycle attempts however among these age is the single most significant determinant of conception therefore it is critical that such patients are referred to an assisted reproduction program at the earliest opportunity following failure of traditional therapies the underlying basis for the negative effect of age on fertility has not been clearly delineated beyond recognition that the number of eggs available for retrieval declines markedly with age fertilization rates significantly decrease in eggs retrieved from patients who are over years and provided the appropriate hormonal background is present age is unrelated to uterine competency to sustain pregnancy ongoing research in our center therefore is investigating physiological changes in the egg that may be impacted by age we have determined that more than percent of eggs that fail to fertilize in vitro are chromosomally abnormal and that a significant proportion of these abnormalities are accountable to patient age currently the only recourse for such patients is to use eggs obtained from a donor our program has initiated recruitment of volunteer egg donors to satisfy the needs of a list of recipients interested in this form of therapy gift this hightech art procedure is performed in the operating room usually with the use of a laparoscope and in contrast to ivfet involves introducing sperm and freshly retrieved eggs into the lumen of the fallopian tube an average of eggstube under these circumstances fertilization occurs in vivo and if excess eggs are retrieved the remainder undergo ivf with subsequent options for embryo transfer in that cycle or freezing for transfer in a subsequent cycle this art procedure is applied to cases in hicnet medical newsletter page volume number april which there is at least one patent fallopian tube but the couple has such pathologies as ovulatory dysfunction endometriosis male factor infertility andor idiopathic infertility the data reported in the united states ivf registry for through indicate that the overall success rate with gift is higher than that obtained with the ivfet technique range of clinical pregnancies for gift is to percent and for ivfet to percent in view of this fact one might expect more patients to be treated with gift than ivfet however in our program we have taken into account three basic concerns which while substantially reducing the number of gift cycles performed benefit the patient these concerns are the increased costs associated with performing a procedure in the operating room the risks albeit minimal of undergoing general anesthesia and the considerable benefits to be accrued from obtaining direct information on the quality and fertilizability of the eggs and the developmental competency of resultant embryos the increased success with gift undoubtedly reflects the artificial environment provided by the laboratory in the ivfet procedure between january and december we have performed a total of gift cycles with an overall success rate of percent embryo cryopreservation or freezing is applied in our program when embryos result from residual gift eggs or from nontransferred ivf embryos this procedure not only provides patients with a subsequent opportunity for success at much reduced costs but also circumvents the legal and ethical issues relating to disposal of supernumerary embryos therefore as stipulated by the american fertility society ethical guidelines for art programs from both a practical and an ethical standpoint all assisted reproduction programs should have the capability of cryopreserving human embrys gamete micromanipulation this art procedure which is still very new is applied to couples who are unaccepting of insemination with donor semen but who have severe male factor infertility less than million spermml in combination with fewer than perccent motile sperm andor less than percent sperm with normal morphology we are currently developing the procedure of subzonal insertion szi which entails injecting sperm under the coating around the egg the barrier normally penetrated by the sperm through enzymatic digestion available data from szi programs worldwide indicate that only to percent of szi cycles result in a pregnancy this statistic undoubtedly relates to limitations imposed by abnormalities inherent in the sperm therefore we are currently focusing on the development of improved techniques for the recognition and selection of sperm chosen for manipulation such efforts are unquestionably worthwhile in view of the fact that this technology offers the only realistic opportunity for severe male factor patients to establish conception catherine racowsky phdhicnet medical newsletter page volume number april associate professor and director of researchdepartment of obstetrics and gynecologycollege of medicine end of part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom davidstatcom david dodellsubject hicn medical news part cut here limits of azts efficacy and now suggest using the drug either sequentially with other drugs or in a kind of aids treatment cocktail combining a number of drugs to fight the virus all at once treating people with azt alone doesnt happen in the real world anymore said dr mark jacobson of the university of californiasan francisco also with recent findings indicating that hiv replicates rapidly in the lymph nodes after infection physicians may begin pushing even harder for early treatment of hivinfected patients new infectious disease push american medical news vol no p the center for disease control will launch a worldwide network to track the spread of infectious diseases and detect drugresistant or new strains in time to help prevent their spread the network is expected to cost between million and million but is an essential part of the clinton administrations health reform plan according to the cdc and outside experts the plan will require the cdc to enhance surveillance of disease in the united states and establish about facilities across the world to track disease april nih plans to begin aids drug trials at earlier stage nature vol no p macilwain colin hicnet medical newsletter page volume number april the national institutes of health has announced it will start treating hivpositive patients as soon as possible after seroconversion resulting from recent findings that show hiv is active in the body in large numbers much earlier than was previously believed anthony fauci director of the us national institute of allergy and infectious diseases niaid said we must address the question of how to treat people as early as we possibly can with drugs that are safe enough to give people for years and that will get around microbial resistance he said any delay would signify questions over safety and resistance rather than a lack of funds fauci who coauthored one of the two papers published last week in nature rejects the argument by one of his coauthors cecil fox that the new discovery indicates that billion spent on vaccine trials has been a waste of time and money because the trials were started too long after the patients were infected and were ended too quickly john tew of the medical college of virginia in richmond claims that the new evidence strongly backs the argument for early treatment of hivinfected patients aids activists welcomed the new information but said the scientific community has been slow to understand the significance of infection of the lymph tissue weve known about this for five years but were glad it is now in the public domain said jesse dobson of the californiabased project inform but peter duesberg who believes that aids is independent of hiv and is a result of drug abuse in the west said we are several paradoxes away from an explanation of aidseven if these papers are right april risk of aids virus from doctors found to be minimal washington post p a the risk of hiv being transmitted from infected healthcare professionals to patients is minimal according to new research published in todays journal of the american medical association jama this finding supports previous conclusions by health experts that the chance of contracting hiv from a health care worker is remote three studies in the jama demonstrate that thousands of patients were treated by two hivpositive surgeons and dentists without becoming infected with the virus the studies were conducted by separate research teams in new hampshire maryland and florida each study started with an hivpositive doctor or dentist and tested all patients willing to participate the new hampshire study found that none of the patients who had undergone invasive procedures by an hivpositive orthopedic surgeon contracted hiv in maryland of patients operated on by a breast surgery specialist at johns hopkins hospital were found to be hivnegative similarly in florida of dental hicnet medical newsletter page volume number april patients who all had been treated by an hivpositive general dentist were tested and found to be negative for hiv the florida researchers led by gordon m dickinson of the university of miami school of medicine said this study indicates that the risk for transmission of hiv from a general dentist to his patients is minimal in a setting in which universal precautions are strictly observed related story philadelphia inquirer p a alternative medicine advocates divided over new nih research program aids treatment news no p gilden dave the new office of alternative medicine at the national institutes of health has raised questions about the nihs commitment to an effort that uses unorthodox or holistic therapeutic methods the oam is a small division of the nih with its budget only at million dollars compared to more than billion for the nih as a whole in addition the money for available research grants is even smaller about to total will be available this year for or grants kaiya montaocean of the center for natural and traditional medicine in washington dc says the oam is afraid to become involved in aids they have to look successful and there is no easy answer in aids she said there is also a common perception that the oam will focus on fields the nih establishment will find nonthreatening such as relaxation techniques and acupuncture when the oam called for an advisory committee conference of about people last year the aids community was largely missing from the meeting in addition activists general lack of contact with the office has added suspicion that the epidemic will be ignored jon greenberg of actupnew york said the oam advisory panel is composed of practitioners without real research experience it will take them several years to accept the nature of research nevertheless dr leanna standish research director and aids investigator at the bastyr college of naturopathic medicine in seattle said here is a wonderful opportunity to fund aids research its only fair to give the office time to gel but its up to the public to insist that its much much more than public relations herpesvirus decimates immunecell soldiers science news vol no p fackelmann kathy a scientists conducting test tube experiments have found that herpesvirus can attack the human immune systems natural killer cells this attack causes the killer cells to malfunction diminishing an important component in the immune systems fight against diseases also the herpesvirus may be a factor in immune diseases such as aids in paolo lussos research found that herpesvirus attacks another white cell the cd tlymphocyte which is the primary target of hiv lusso also found that herpesvirus can hicnet medical newsletter page volume number april kill natural killer cells scientists previously knew that the natural killer cells of patients infected with hiv do not work correctly lussos research represents the first time scientists have indicated that natural killer cells are vulnerable to any kind of viral attack according to anthony l komaroff a researcher with harvard medical school despite the testtube findings scientists are uncertain whether the same result occurs in the body lussos team also found that herpesvirus produces the cd receptor molecule that provides access for hiv cd tlymphocytes express this surface receptor making them vulnerable to hivs attack researchers concluded that herpesvirus cells can exacerbate the affects of hiv april aids and priorities in the global village to the editor journal of the american medical association vol no p gellert george and nordenberg dale f all healthcare workers are obligated and responsible for not only ensuring that politicians understand the dimensions of certain health problems but also to be committed to related policies write george gellert and dale f nordenberg of the orange county health care agency santa ana calif and the emory university school of public health in atlanta ga respectively dr berkleys editorial on why american doctors should care about the aids epidemic beyond the united states details several reasons for the concerted interest that all countries share in combating aids it should be noted that while aids leads in hastening global health interdependence it is not the only illness doing so diseases such as malaria and many respiratory and intestinal pathogens have similarly inhibited the economic development of most of humanity and acted to marginalize large populations berkley mentions the enormous social and economic impact that aids will have on many developing countries and the increased need for international assistance that will result berkley also cites the lack of political aggressiveness toward the aids epidemic in its first decade but now there is a new administration with a promise of substantial differences in approach to international health and development in general and hivaids in particular vice president al gore proposes in his book earth in the balance a major environmental initiative that includes sustainable international development with programs to promote literacy improve child survival and disseminate contraceptive technology and access throughout the developing world if enacted this change in policy could drastically change the future of worldwide health aids and priorities in the global village in reply journal of the american hicnet medical newsletter page volume number april medical association vol no p berkley seth every nation should tackle hiv as early and aggressively as possible before the disease reaches an endemic state even at a cost of diverting less attention to some other illnesses writes seth berkley of the rockefeller foundation in new york ny in reply to a letter by drs gellert and nordenberg although it is true that diseases other than aids such as malaria and respiratory and intestinal illnesses have similarly inhibited economic development in developing countries and deserve much more attention than they are getting berkley disagrees with the contention that aids is receiving too much attention hiv differs from other diseases in most developing countries because it is continuing to spread for most endemic diseases the outcome of neglecting interventions for one year is another year of about the same level of needless disease and death but with aids and its increasing spread the cost of neglect not only in disease burden but financially is much greater interventions in the early part of a rampantly spreading epidemic like hiv are highly costeffective because each individual infection prevented significantly interrupts transmission berkley says he agrees with gellert and nordenberg about the gigantic social and economic effects of aids and about the need for political leadership but he concludes that not only is assertive political leadership needed in the united states for the aids epidemic but even more so in developing countries with high rates of hiv infection and where complacency about the epidemic has been the rulehicnet medical newsletter page volume number april aidshiv articles first hiv vaccine trial begins in hivinfected children h h s n e w s us department of health and human services march first hiv vaccine therapy trial begins in hivinfected childrenthe national institutes of health has opened the first trial of experimental hiv vaccines in children who are infected with the human immunodeficiency virus hiv the virus that causes aids the trial will compare the safety of three hiv experimental vaccines in children recruited from at least sites nationwide volunteers must be hivinfected but have no symptoms of hiv disease hhs secretary donna e shalala said this initial study can be seen as a hopeful milestone in our efforts to ameliorate the tragedy of hivinfected children who now face the certainty they will develop aids anthony s fauci md director of the national institute of allergy and infectious diseases and of the nih office of aids research said the trial is the first step in finding out whether vaccines can help prevent or delay disease progression in children with hiv who are not yet sick if these vaccines prove to be safe more sophisticated questions about their therapeutic potential will be assessed in phase ii trials the centers for disease control and prevention estimates children in the united states have hiv by the end of the decade the world health organization projects million children will be infected worldwide the study will enroll children ages month to years old niaid which funds the aids clinical trials group network anticipates conducting the trial at nine actg sites around the country and three sites participating in the actg but funded by the national institute of child health and human development preliminary evidence from similar studies under way in infected adults shows that certain vaccines can boost existing hivspecific immune responses and hicnet medical newsletter page volume number april stimulate new ones it will be several years however before researchers know how these responses affect the clinical course of the disease the results from the pediatric trial known as actg will be examined closely for other reasons as well this trial will provide the first insight into how the immature immune system responds to candidate hiv vaccines said daniel hoth md director of niaids division of aids we need this information to design trials to test whether experimental vaccines can prevent hiv infection in children in the united states most hivinfected children live in poor innercity areas and more than percent are minorities mainly black or hispanic nearly all hivinfected children acquire the virus from their mothers during pregnancy or at birth an infected mother in the united states has more than a one in four chance of transmitting the virus to her baby as growing numbers of women of childbearing age become exposed to hiv through injection drug use or infected sexual partners researchers expect a corresponding increase in the numbers of infected children hiv disease progresses more rapidly in infants and children than in adults the most recent information suggests that percent of infants born with hiv develop a serious aidsrelated infection by to years of age these infections include severe or frequent bouts of common bacterial illnesses of childhood that can result in seizures pneumonia diarrhea and other symptoms leading to nutritional problems and long hospital stays at least half of the children in the trial will be years of age or younger to enable comparison of the immune responses of the younger and older participants all volunteers must have welldocumented hiv infection but no symptoms of hiv disease other than swollen lymph glands or a mildly swollen liver or spleen they cannot have received any antiretroviral or immuneregulating drugs within one month prior to their entry into the study study chair john s lambert md of the university of rochester medical school and co chair samuel katz md of duke university school of medicine will coordinate the trial assisted by james mcnamara md medical officer in the pediatric medicine branch of niaids division of aids we will compare the safety of the vaccines by closely monitoring the children for any side effects to see if one vaccine produces more swollen arms or fevers for example than another said dr mcnamara well also look at whether low or high doses of the vaccines stimulate immune responses or other significant laboratory or clinical effects he emphasized that the small study size precludes comparing these responses or effects among the three hicnet medical newsletter page volume number april products the trial will test two doses each of three experimental vaccines made from recombinant hiv proteins these socalled subunit vaccines each genetically engineered to contain only a piece of the virus have so far proved welltolerated in ongoing trials in hivinfected adults one vaccine made by microgenesys inc of meriden conn contains gpa protein that gives rise to hivs surface proteinsplus alum adjuvant adjuvants boost specific immune responses to a vaccine presently alum is the only adjuvant used in human vaccines licensed by the food and drug administration both of the other vaccinesone made by genentech inc of south san francisco and the other by biocine a joint venture of chiron and cibageigy in emeryville califcontain the major hiv surface protein gp plus adjuvant the genentech vaccine contains alum while the biocine vaccine contains mf an experimental adjuvant that has proved safe and effective in other phase i vaccine trials in adults a low dose of each product will be tested first against a placebo in children twelve children will be assigned at random to be immunized with the experimental vaccine and three children will be given adjuvant alone considered the placebo neither the health care workers nor the children will be told what they receive if the low dose is welltolerated controlled testing of a higher dose of the experimental vaccine and adjuvant placebo in another group of children will begin each child will receive six immunizationsone every four weeks for six monthsand be followedup for weeks after the last immunization for more information about the trial sites or eligibility for enrollment call the aids clinical trials information service trialsa from am to pm est weekdays the service has spanishspeaking information specialists available information on niaids pediatric hivaids research is available from the office of communications at nih cdc and fda are agencies of the us public health service in hhs for press inquiries only please call laurie k doepel at hicnet medical newsletter page volume number april new evidence that the hiv can cause disease independently news from the national institute of dental researchthere is new evidence that the human immunodeficiency virus can cause disease independently of its ability to suppress the immune system say scientists at the national institues of health they report that hiv itself not an opportunistic infection caused scaling skin conditions to develop in mice carrying the genes for hiv although the hiv genes were active in the mice they did not compromise the animals immunity the researchers found this led them to conclude that the hiv itself caused the skin disease our findings support a growing body of evidence that hiv can cause disease without affecting the immune system said lead author dr jeffrey kopp of the national institute of dental research nidr dr kopp and his colleagues described their study in the march issue of aids research and human retroviruses developing animal models of hiv infection has been difficult since most animals including mice cannot be infected by the virus to bypass this problem scientists have developed hivtransgenic mice which carry genes for hiv as well as their own genetic material nidr scientists created the transgenic mice by injecting hiv genes into mouse eggs and then implanting the eggs into female mice the resulting litters contained both normal and transgenic animals institute scientists had created mice that carried a complete copy of hiv genetic material in l those mice however became sick and died too soon after birth to study in depth in the present study the scientists used an incomplete copy of hiv which allowed the animals to live longer some of the transgenic animals developed scaling wartlike tumors on their necks and backs other transgenic mice developed thickened crusting skin lesions that covered most of their bodies resembling psoriasis in humans no skin lesions developed in their normal nontransgenic littermates studies of tissue taken from the wartlike skin tumors showed that they were a type of noncancerous tumor called papilloma although the papillomavirus can cause these skin lesions laboratory tests showed no sign of that virus in the animals tissue samples taken from the sick mice throughout the study revealed the presence of a proteinproducing molecule made by the hiv genetic material hicnet medical newsletter page volume number april evidence of hiv protein production proved that the viral genes were turned on or active said dr kopp the scientists found no evidence however of compromised immunity in the mice no increase in their white blood cell count and no signs of common infections the fact that hiv genes were active but the animals immune systems were not suppressed confirms that the virus itself was causing the skin lesions dr kopp said further proof of hiv gene involvement came from a test in which the scientists exposed the transgenic animals to ultraviolet light the light increased hiv genetic activity causing papillomas to develop on formerly healthy skin papilloma formation in response to increased hiv genetic activity proved the genes were responsible for the skin condition the scientists said no lesions appeared on normal mice exposed to the uv light the transgenic mice used in this study were developed at nidr by dr peter dickie who is now with the national institute of allergy and infectious diseases collaborating on the study with dr kopp were mr charles wohlenberg drs nickolas dorfman joseph bryant abner notkins and paul klotman all of nidr dr stephen katz of the national cancer institute and dr james rooney formerly with nidr and now with burroughs wellcomehicnet medical newsletter page volume number april clinical consultation telephone service for aids h h s n e w s us department of health and human services march hhs secretary donna e shalala today announced the first nationwide clinical consultation telephone service for doctors and other health care professionals who have questions about providing care to people with hiv infection or aids the tollfree national hiv telephone consulting service is staffed by a physician a nurse practitioner and a pharmacist it provides information on drugs clinical trials and the latest treatment methods the service is funded by the health resources and services administration and operates out of san francisco general hospital secretary shalala said one goal of this project is to share expertise so patients get the best care a second goal is to get more primary health care providers involved in care for people with hiv or aids which reduces treatment cost by allowing patients to remain with their medical providers and community social support networks currently many providers refer patients with hiv or aids to specialists or other providers who have more experience secretary shalala said this clinical expertise should be especially helpful for physicians and providers who treat people with hiv or aids in communities and clinical sites where hiv expertise is not readily available the telephone number for health care professionals is and it is accessible from am to pm est am to pm pst monday through friday during these times consultants will try to answer questions immediately or within an hour at other times physicians and health care providers can leave an electronic message and questions will be answered as quickly as possible health care professionals may call the service to ask any question related to providing hiv care including the latest hivaids drug treatment information clinical trials information subspecialty case referral literature searches and other information the service is designed for health care professionals rather than patients families or others who have alternate sources of information or materials when a health care professional calls the new service the call is taken by either a clinical pharmacist primary care physician or family nurse practitioner all staff members have extensive experience in outpatient and inpatient primary care for people with hivrelated diseases the consultant asks for patientspecific information including cd cell count current medications sex age and the patients hiv history this national service has grown out of a month local effort that hicnet medical newsletter page volume number april responded to nearly calls from health care providers in northern california the initial project was funded by hrsas bureau of health professions through its community provider aids training cpat project and by the american academy of family physicians when providers expand their knowledge they also improve the quality of care they are able to provide to their patients said hrsa administrator robert g harmon md mph this project will be a great resource for health care professionals and the hivaids patients they serve this service has opened a new means of communication between health care professionals and experts on hiv care management said hrsas associate administrator for aids and director of the bureau of health resources development g stephen bowen md mph providers who treat people with hiv or aids have access to the latest information on new drugs treatment methods and therapies for people with hiv or aids hrsa is one of eight us public health service agencies within hhs aids hotline numbers for consumers cdc national aids hotline aids for information in spanish sida aids clinical trials english spanish trialsahicnet medical newsletter page cut here this is the last part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom sbishopdesirewrightedusubject re hismanal et alside effectsin article aprspdcccom dyerspdcccom steve dyer writes in article aprlrcedu kjivlrcedu writescan someone tell me whether or not any of the following medications has been linked to rapidexcessive weight gain andor a distorted sense of taste or smell hismanal azmacort a topical steroid to prevent asthma vancenase hismanal astemizole is most definitely linked to weight gain it really is peculiar that some antihistamines have this effect and even more so an antihistamine like astemizole which purportedly doesnt cross the bloodbrain barrier and so tends not to cause drowsinessit also gave me lots of problems with joint and muscle pain seemed totrigger arthritislike problemssue steve dyer dyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom davidstatcom david dodellsubject hicn medical newsletter part cut here volume number april health infocom network medical newsletter editor david dodell dmd north nd street suite scottsdale arizona usa telephone fax compilation copyright by david dodell dmd all rights reserved license is hereby granted to republish on electronic media for which no fees are charged so long as the text of this copyright notice and license are attached intact to any and all republished portion or portions the health infocom network newsletter is distributed biweekly articles on a medical nature are welcomed if you have an article please contact the editor for information on how to submit it if you are interested in joining the automated distribution system please contact the editor email address editor internet davidstatcom fidonet bitnet atwhasuacad listserv mednewsasuacadbitnet or internet mednewsasuvminreasuedu anonymous ftp vmnodakedu notification list hicnnotifyrequeststatcom fax delivery contact editor for information t a b l e o f c o n t e n t s comments news from the editor ocr scanner news centers for disease control and prevention mmwr april emerging infectious diseases outbreak of e coli infections from hamburgers use of smokeless tobacoo among adults gonorrhea impact of adult safetybelt use on children less than years age publication of cdc surveillance summaries clinical research news high tech assisted reproductive technologies articles low levels airborne particles linked to serious asthma attacks nih consensus development conference on melanoma national cancer insitute designated cancer centers general announcments uci medical education software repository aids news summaries aids daily summary april to april aidshiv articles first hiv vaccine trial begins in hivinfected children new evidence that the hiv can cause disease independently clinical consultation telephone service for aids hicnet medical newsletter page ivolume number april comments news from the editori would like to continue to thank everyone who has sent in a donation for the mednews ocrscanner fund we have reached our goal a hewlett packardscanjet iip was purchased this weekthank you to the following individuals whose contributions i just receivedjohn sorensoncarol sigelmancarla moorebarbara moosejudith schrieragain thank you to all who gavei have been using wordscan plus for the past couple of weeks and would like to review the product wordscan plus is a product of calera recognition systems it runs under windows and supports that accufont technology of the hewlett packard scanners when initially bringing up the software it lets you select several options text graphics input source ie scanner fax file disk file automatic versus manual decomposition of the scanned image i like manual decomposition since the software then lets me select which parts of the document i would like scanned and in what orderonce an image is scanned you can bring up the popup image verification the software gives you two errors at this point blue which are words that were converted reliability but do not match anything in the builtin dictionary yellow shade which are words that wordscan plus doesnt think it converted correctly at all i have found that the software should give itself more credit it is usually correct instead of wrong if a word is shaded blue you can add it to your personal dictionary the only problem is the personal dictionary will only handle about words i find this to be very limited considering how many medical terms are not in a normal dictionary after a document is converted you can save it in a multitude of word processor formats also any images that were captured can be stored in a seperate tiff or pcx file formati was extremely impressed on the percent accuracy for fax files i use hicnet medical newsletter page volume number april an intel satisfaxtion card which stores incoming faxs in a pcxdcx format while most of my faxes were received in standard mode x dpi the accuracy of wordscan plus was excellent overall a very impressive product the only fault i could find is the limitations of the size of the user dictionary specialized words is just too small if anyone has any specific questions please do not hesitate to send me emailhicnet medical newsletter page volume number april centers for disease control and prevention mmwr emerging infectious diseases source mmwr date apr introduction despite predictions earlier this century that infectious diseases would soon be eliminated as a public health problem infectious diseases remain the major cause of death worldwide and a leading cause of illness and death in the united states since the early s the us public health system has been challenged by a myriad of newly identified pathogens and syndromes eg escherichia coli oh hepatitis c virus human immunodeficiency virus legionnaires disease lyme disease and toxic shock syndrome the incidences of many diseases widely presumed to be under control such as cholera malaria and tuberculosis tb have increased in many areas furthermore control and prevention of infectious diseases are undermined by drug resistance in conditions such as gonorrhea malaria pneumococcal disease salmonellosis shigellosis tb and staphylococcal infections emerging infections place a disproportionate burden on immunocompromised persons those in institutional settings eg hospitals and child day care centers and minority and underserved populations the substantial economic burden of emerging infections on the us healthcare system could be reduced by more effective surveillance systems and targeted control and prevention programs this issue of mmwr introduces a new series emerging infectious diseases future articles will address these diseases as well as surveillance control and prevention efforts by healthcare providers and public health officials this first article updates the ongoing investigation of an outbreak of e coli oh in the western united states references burnet m natural history of infectious disease cambridge england cambridge university press kunin cm resistance to antimicrobial drugs a worldwide calamity ann intern med lederberg j shope re oaks sc jr eds emerging infections microbial threats to health in the united states washington dc national academy press hicnet medical newsletter page volume number april cdc preliminary report foodborne outbreak of escherichia coli oh infections from hamburgers western united states mmwr hicnet medical newsletter page volume number april update multistate outbreak of escherichia coli oh infections from hamburgers western united states source mmwr date apr from november through february more than laboratoryconfirmed infections with e coli oh and four associated deaths occurred in four states washington idaho california and nevada this report summarizes the findings from an ongoing investigation that identified a multistate outbreak resulting from consumption of hamburgers from one restaurant chain washington on january a physician reported to the washington department of health a cluster of children with hemolytic uremic syndrome hus and an increase in emergency room visits for bloody diarrhea during january a casecontrol study comparing of the first cases of bloody diarrhea or postdiarrheal hus identified with age and neighborhoodmatched controls implicated eating at chain a restaurants during the week before symptom onset matched odds ratio orundefined lower confidence limit on january a multistate recall of unused hamburger patties from chain a restaurants was initiated as a result of publicity and casefinding efforts during januaryfebruary patients with bloody diarrhea or hus were reported to the state health department a total of persons had illnesses meeting the case definition of cultureconfirmed e coli oh infection or postdiarrheal hus figure of the persons had close contact with a person with confirmed e coli oh infection during the week preceding onset of symptoms of the remaining persons reported eating in a chain a restaurant during the days preceding onset of symptoms of the patients who recalled what they ate in a chain a restaurant reported eating a regularsized hamburger patty onsets of illness peaked from january through january of the casepatients were hospitalized developed hus and three died the median age of patients was years range years idaho following the outbreak report from washington the division of health idaho department of health and welfare identified persons with cultureconfirmed e coli oh infection with illness onset dates from december through february figure a four persons were hospitalized one developed hus during the week preceding illness onset had eaten at a chain a restaurant california in late december the san diego county department of health services was notified of a child with e coli oh infection who subsequently died active surveillance and record review then identified eight other persons with e coli oh infections or hus from midnovember through midjanuary four of the nine reportedly had recently eaten at a chain a restaurant and hicnet medical newsletter page volume number april four at a chain b restaurant in san diego after the washington outbreak was reported reviews of medical records at five hospitals revealed an overall increase in visits or admissions for diarrhea during december and january compared with the same period year earlier a case was defined as postdiarrheal hus bloody diarrhea that was culture negative or not cultured or any diarrheal illness in which stool culture yielded e coli oh with onset from november through january illnesses of patients met the case definition figure b the outbreak strain was identified in stool specimens of six patients fourteen persons were hospitalized seven developed hus and one child died the median age of casepatients was years range years a casecontrol study of the first casepatients identified and age and sexmatched community controls implicated eating at a chain a restaurant in san diego matched or confidence interval ci a study comparing casepatients who ate at chain a restaurants with well meal companions implicated regularsized hamburger patties matched orundefined lower confidence limit chain b was not statistically associated with illness nevada on january after receiving a report of a child with hus who had eaten at a local chain a restaurant the clark county las vegas health district issued a press release requesting that persons with recent bloody diarrhea contact the health department a case was defined as postdiarrheal hus bloody diarrhea that was culture negative or not cultured or any diarrheal illness with a stool culture yielding the washington strain of e coli oh with onset from december through february because local laboratories were not using sorbitol macconkey smac medium to screen stools for e coli oh this organism was not identified in any patient after smac medium was distributed the outbreak strain was detected in the stool of one patient days after illness onset of persons whose illnesses met the case definition figure c nine were hospitalized three developed hus the median age was years range years analysis of the first patients identified and age and sexmatched community controls implicated eating at a chain a restaurant during the week preceding illness onset matched orundefined lower confidence limit a casecontrol study using well meal companions of casepatients also implicated eating hamburgers at chain a matched or ci other investigation findings during the outbreak chain a restaurants in washington linked with cases primarily were serving regularsized hamburger patties produced on november some of the same meat was used in jumbo patties produced on november the outbreak strain of e coli oh was isolated from lots of patties produced on those two dates these lots had been distributed to restaurants in all states where illness occurred approximately of the implicated patties were recovered by the recall a meat traceback by a cdc team identified five slaughter plants in the united states and one in canada as the likely sources of carcasses used in the hicnet medical newsletter page volume number april contaminated lots of meat and identified potential control points for reducing the likelihood of contamination the animals slaughtered in domestic slaughter plants were traced to farms and auctions in six western states no one slaughter plant or farm was identified as the source further investigation of cases related to secondary transmission in families and child day care settings is ongoing reported by m davis dvm c osaki msph seattleking county dept of public health d gordon ms mw hinds md snohomish health district everett k mottram c winegar mph tacomapierce county health dept ed avner md pi tarr md dept of pediatrics d jardine md depts of anesthesiology and pediatrics univ of washington school of medicine and childrens hospital and medical center seattle m goldoft md b bartleson mph j lewis jm kobayashi md state epidemiologist washington dept of health g billman md j bradley md childrens hospital san diego s hunt p tanner res m ginsberg md san diego county dept of health svcs l barrett dvm sb werner md gw rutherford iii md state epidemiologist california dept of health svcs rw jue central district health dept boise h root southwest district health dept caldwell d brothers ma rl chehey ms rh hudson phd div of health idaho state public health laboratory fr dixon md state epidemiologist div of health idaho dept of health and welfare dj maxson environmental epidemiology program l empey pa o ravenholt md vh ueckart dvm clark county health district las vegas a disalvo md nevada state public health laboratory ds kwalick md r salcido mph d brus dvm state epidemiologist div of health nevada state dept of human resources center for food safety and applied nutrition food and drug administration food safety inspection svc animal and plant health inspection svc us dept of agriculture div of field epidemiology epidemiology program office enteric diseases br div of bacterial and mycotic diseases national center for infectious diseases cdc editorial note e coli oh is a pathogenic gramnegative bacterium first identified as a cause of illness in during an outbreak of severe bloody diarrhea traced to contaminated hamburgers this pathogen has since emerged as an important cause of both bloody diarrhea and hus the most common cause of acute renal failure in children outbreak investigations have linked most cases with the consumption of undercooked ground beef although other food vehicles including roast beef raw milk and apple cider also have been implicated preliminary data from a cdc year nationwide multicenter study revealed that when stools were routinely cultured for e coli oh that organism was isolated more frequently than shigella in four of participating hospitals and was isolated from of all bloody stools a higher rate than for any other pathogen infection with e coli oh often is not recognized because most clinical laboratories do not routinely culture stools for this organism on hicnet medical newsletter page volume number april smac medium and many clinicians are unaware of the spectrum of illnesses associated with infection the usual clinical manifestations are diarrhea often bloody and abdominal cramps fever is infrequent younger age groups and the elderly are at highest risk for clinical manifestations and complications illness usually resolves after days but of patients develop hus which is characterized by hemolytic anemia thrombocytopenia renal failure and a death rate of this report illustrates the difficulties in recognizing community outbreaks of e coli oh in the absence of routine surveillance despite the magnitude of this outbreak the problem may not have been recognized in three states if the epidemiologic link had not been established in washington clinical laboratories should routinely culture stool specimens from persons with bloody diarrhea or hus for e coli oh using smac agar when infections with e coli oh are identified they should be reported to local health departments for further evaluation and if necessary public health action to prevent further cases e coli oh lives in the intestines of healthy cattle and can contaminate meat during slaughter cdc is collaborating with the us department of agricultures food safety inspection service to identify critical control points in processing as a component of a program to reduce the likelihood of pathogens such as e coli oh entering the meat supply because slaughtering practices can result in contamination of raw meat with pathogens and because the process of grinding beef may transfer pathogens from the surface of the meat to the interior ground beef is likely to be internally contaminated the optimal food protection practice is to cook ground beef thoroughly until the interior is no longer pink and the juices are clear in this outbreak undercooking of hamburger patties likely played an important role the food and drug administration fda has issued interim recommendations to increase the internal temperature for cooked hamburgers to f c fda personal communication regulatory actions stimulated by the outbreak described in this report and the recovery of thousands of contaminated patties before they could be consumed emphasize the value of rapid public health investigations of outbreaks the public health impact and increasing frequency of isolation of this pathogen underscore the need for improved surveillance for infections caused by e coli oh and for hus to better define the epidemiology of e coli oh references cdc preliminary report foodborne outbreak of escherichia coli oh infections from hamburgers western united states mmwr riley lw remis rs helgerson sd et al hemorrhagic colitis associated with a rare escherichia coli serotype n engl j med hicnet medical newsletter page volume number april griffin pm tauxe rv the epidemiology of infections caused by escherichia coli oh other enterohemorrhagic e coli and the associated hemolytic uremic syndrome epidemiol rev griffin pm ostroff sm tauxe rv et al illnesses associated with escherichia coli oh infections a broad clinical spectrum ann intern med march sb ratnam s latex agglutination testhicnet medical newsletter page volume number april use of smokeless tobacco among adults united states source mmwr date apr consumption of moist snuff and other smokeless tobacco products in the united states almost tripled from through longterm use of smokeless tobacco is associated with nicotine addiction and increased risk of oral cancer the incidence of which could increase if young persons who currently use smokeless tobacco continue to use these products frequently to monitor trends in the prevalence of use of smokeless tobacco products cdcs national health interview surveyhealth promotion and disease prevention supplement nhishpdp collected information on snuff and chewing tobacco use and smoking from a representative sample of the us civilian noninstitutionalized population aged greater than or equal to years this report summarizes findings from this survey the nhishpdp supplement asked have you used snuff at least times in your entire life and do you use snuff now similar questions were asked about chewing tobacco use and cigarette smoking current users of smokeless tobacco were defined as those who reported snuff or chewing tobacco use at least times and who reported using snuff or chewing tobacco at the time of the interview former users were defined as those who reported having used snuff or chewing tobacco at least times and not using either at the time of the interview ever users of smokeless tobacco included current and former users current smokers were defined as those who reported smoking at least cigarettes and who were currently smoking and former smokers as those who reported having smoked at least cigarettes and who were not smoking now ever smokers included current and former smokers data on smokeless tobacco use were available for persons aged greater than or equal to years and were adjusted for nonresponse and weighted to provide national estimates confidence intervals cis were calculated by using standard errors generated by the software for survey data analysis sudaan in an estimated million us adults were current users of smokeless tobacco including million men and women for all categories of comparison the prevalence of smokeless tobacco use was substantially higher among men for men the prevalence of use was highest among those aged years table for women the prevalence was highest among those aged greater than or equal to years the prevalence of smokeless tobacco use among men was highest among american indiansalaskan natives and whites the prevalence among women was highest among american indiansalaskan natives and blacks among both men and women prevalence of smokeless tobacco use declined with increasing education prevalence was substantially higher among residents of the southern united states and in rural areas although the prevalence of smokeless tobacco use was higher among hicnet medical newsletter page volume number april men and women below the poverty level this difference was significant only for women p less than table among men the prevalence of current use of snuff was highest among those aged years but varied considerably by age the prevalence of use of chewing tobacco was more evenly distributed by age group table although women rarely used smokeless tobacco the prevalence of snuff use was highest among those aged greater than or equal to years an estimated million ci adults reported being former smokeless tobacco users among ever users the proportion who were former smokeless tobacco users was ci among persons aged years the proportion of former users was lower among snuff users ci than among chewing tobacco users ci among persons aged years the proportion of former users was similar for snuff ci and chewing tobacco ci among current users of smokeless tobacco ci currently smoked ci formerly smoked and ci never smoked in comparison among current smokers ci were current users of smokeless tobacco daily use of smokeless tobacco was more common among snuff users ci than among chewing tobacco users ci reported by office on smoking and health national center for chronic disease prevention and health promotion div of health interview statistics national center for health statistics cdc editorial note the findings in this report indicate that the use of smokeless tobacco was highest among young males adolescent and young adult males in particular are the target of marketing strategies by tobacco companies that link smokeless tobacco with athletic performance and virility use of oral snuff has risen markedly among professional baseball players encouraging this behavior among adolescent and young adult males and increasing their risk for nicotine addiction oral cancer and other mouth disorders differences in the prevalence of smokeless tobacco use among racialethnic groups may be influenced by differences in educational levels and socioeconomic status as well as social and cultural phenomena that require further explanation for example targeted marketing practices may play a role in maintaining or increasing prevalence among some groups and affecting the differential initiation of smokeless tobacco use by young persons in this report one concern is that nearly one fourth of current smokeless tobacco users also smoke cigarettes in the nhishpdp the prevalence of cigarette smoking was higher among former smokeless tobacco users than among current and never smokeless tobacco users in a previous study among college students of current smokeless tobacco users smoked hicnet medical newsletter page volume number april occasionally in addition approximately of adults who formerly smoked reported substituting other tobacco products for cigarettes in an effort to stop smoking healthcare providers should recognize the potential health implications of concurrent smokeless tobacco and cigarette use the national health objectives for the year have established special population target groups for the reduction of the prevalence of smokeless tobacco use including males aged years to no more than by the year objective and american indianalaskan native youth to no more than by the year objective a strategies to lower the prevalence of smokeless tobacco use include continued monitoring of smokeless tobacco use integrating smoking and smokeless tobaccocontrol efforts enforcing laws that restrict minors access to tobacco making excise taxes commensurate with those on cigarettes encouraging healthcare providers to routinely provide cessation advice and followup providing schoolbased prevention and cessation interventions and adopting policies that prohibit tobacco use on school property and at schoolsponsored events references office of evaluations and inspections spit tobacco and youth washington dc us department of health and human services office of the inspector general dhhs publication no oei national institutes of health the health consequences of using smokeless tobacco a report of the advisory committee to the surgeon general bethesda maryland us department of health and human services public health service dhhs publication no nih shah bv software for survey data analysis sudaan version software documentation research triangle park north carolina research triangle institute connolly gn orleans ct blum a snuffing tobacco out of sport am j public health national cancer institute smokeless tobacco or health an international perspective bethesda maryland us department of health and human services public health service national institutes of health dhhs publication no nih foreyt jp jackson as squires wg hartung gh murray td gotto am psychological profile of college students who use smokeless tobacco addict behav glover ed laflin m edwards sw age of initiation and switching patterns hicnet medical newsletter page volume number april between smokeless tobacco and cigarettes among college students in the united states am j public health cdc tobacco use in methods and tabulations from adult use of tobacco survey rockville maryland us department of health and human services public health service cdc dhhs publication no om public health service healthy people national health promotion and disease prevention objectives washington dc us department of health and human services public health service dhhs publication no phs end of part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom davidstatcom david dodellsubject hicn medical news part cut here university of arizonatucson arizona suggested readingtan sl royston p campbell s jacobs hs betts j mason b edwards rg cumulative conception and livebirth rates after invitro fertilization lancet for further information call physicians resource line in tucson hicnet medical newsletter page volume number april articles low levels of airborne particles linked to serious asthma attacks american lung association a new study published by the american lung association has shown that surprisingly low concentrations of airborne particles can send people with asthma rushing to emergency rooms for treatment the seattlebased study showed that roughly one in eight emergency visits for asthma in that city was linked to exposure to particulate air pollution the actual exposure levels recorded in the study were far below those deemed unsafe under federal air quality laws people with asthma have inflamed airways and airborne particles tend to exacerbate that inflammation said joel schwartz phd of the environmental protection agency who was the lead author of the study when people are on the threshold of having a serious asthma attack particles can push them over the edge the seattle study correlated months of asthma emergency room visits with daily levels of pm or particulate matter with an aerodynamic diameter of microns or less these finer particles are considered hazardous because they are small enough penetrate into the lung cities are considered out of compliance with clean air laws if the hour average concentration of pm exceeds micrograms per cubic millimeter of air in seattle however a link between fine particles and asthma was found at levels as low as micrograms the authors concluded that for every microgram increase in the fourday average of pm the odds of someone with asthma needing emergency treatment increased by percent the findings were published in the april american review of respiratory disease an official journal of the american thoracic society the lung associations medical section the study is the latest in a series of recent reports to suggest that particulate matter is a greatly under appreciated health threat a study by dr schwartz and douglas dockery phd of harvard found that particles may be causing roughly premature deaths each year in the united states other studies have linked particulate matter to increased respiratory symptoms and bronchitis in children government officials and the media are still very focused on ozone says dr schwartz but more and more research is showing that particles are bad actors as well one problem in setting standards for particulate air pollution is that pmio is difficult to study unlike other regulated pollutants such as ozone and carbon monoxide particulate matter is a complex and varying mixture of substances including carbon hydrocarbons dust and hicnet medical newsletter page volume number april acid aerosols researchers cant put people in exposure chambers to study the effects of particulate air pollution says dr schwartz we have no way of duplicating the typical urban mix of particles consequently most of what is known about particulates has been learned through populationbased research like the seattle study given that the epas current priority is to review the ozone and sulfur dioxide standards the agency is unlikely to reexamine the pm standard any time soon until changes are made there appears to be little people with asthma can do to protect themselves from airborne particles in some areas you can get reports on air quality but the reports only cover the pollutant that is closest to violating its standard and thats rarely particulate matter says dr schwartz however pm doesnt have to be near its violation range to be unhealthyhicnet medical newsletter page volume number april nih consensus development conference on melanomathe national institutes of health consensus development conference on diagnosis and treatment of early melanoma brought together experts in dermatology pathology epidemiology public education surveillance techniques and potential new technologies as well as other health care professionals and the public to address the clinical and histological characteristics of early melanoma the appropriate diagnosis management and followup of patients with early melanoma the role of dysplastic nevi and their significance and the role of education and screening in preventing melanoma morbidity and mortality following days of presentations by experts and discussion by the audience a consensus panel weighed the scientific evidence and prepared their consensus statement among their findings the panel recommended that melanoma in situ is a distinct entity effectively treated surgically with centimeter margins thin invasive melanoma less than millimeter thick has the potential for longterm survival in more than percent of patients after surgical excision with a centimeter margin elective lymph node dissections and extensive staging evaluations are not recommended in early melanoma patients with early melanoma are at low risk for relapse but may be at high risk for development of subsequent melanomas and should be followed closely some family members of patients with melanoma are at increased risk for melanoma and should be enrolled in surveillance programs and education and screening programs have the potential to decrease morbidity and mortality from melanoma a copy of the full text of the consensus panels statement is available by calling the nih office of medical applications of research at or by writing to office of medical applications of research national institutes of health federal building room bethesda md hicnet medical newsletter page volume number april ncidesignated cancer centersthe cancer centers program is comprised of ncidesignated cancer centers actively engaged in multidisciplinary research efforts to reduce cancer incidence morbidity and mortality within the program there are four types of cancer centers basic science cancer centers which engage primarily in basic cancer research clinical cancer centers which focus on clinical research comprehensive cancer centers which emphasize a multidisciplinary approach to cancer research patient care and community outreach and consortium cancer centers which specialize in cancer prevention and control research although some cancer centers existed in the late s and the s it was the national cancer act of that authorized the establishment of new cancer centers as well as continuing support for existing ones the passage of the act also dramatically transformed the centers structure and broadened the scope of their mission to include all aspects of basic clinical and cancer control research over the next two decades the centers program grew progressively in there were comprehensive cancer centers in the nation today there are of these institutions all of which meet specific nci criteria for comprehensive status to attain recognition from the nci as a comprehensive cancer center an institution must pass rigorous peer review under guidelines newly established in the eight criteria for comprehensiveness include the requirement that a center have a strong core of basic laboratory research in several scientific fields such as biology and molecular genetics a strong program of clinical research and an ability to transfer research findings into clinical practice moreover five of the criteria for comprehensive status go significantly beyond that required for attaining a cancer center support grant also referred to as a p or core grant the mechanism of choice for supporting the infrastructure of a cancer centers operations these criteria encompass strong participation in ncidesignated highpriority clinical trials significant levels of cancer prevention and control research and important outreach and educational activitiesall of which are funded by a variety of sources the other types of cancer centers also have special characteristics and capabilities for organizing new programs of research that can exploit important new findings or address timely research questions hicnet medical newsletter page volume number april of the ncidesignated cancer centers are of the basic science type these centers engage almost entirely in basic research although some centers engage in collaborative research with outside clinical research investigators and in cooperative projects with industry to generate medical applications from new discoveries in the laboratory clinical cancer centers in contrast focus on both basic research and clinical research within the same institutional framework and frequently incorporate nearby affiliated clinical research institutions into their overall research programs there are such centers today finally consortium cancer centers of which there is one are uniquely structured and concentrate on clinical research and cancer prevention and control research these centers interface with state and local public health departments for the purpose of achieving the transfer of effective prevention and control techniques from their research findings to those institutions responsible for implementing populationwide public health programs consortium centers also are heavily engaged in collaborations with institutions that conduct clinical trial research and coordinate community hospitals within a network of cooperating institutions in clinical trials together the ncidesignated cancer centers continue to work toward creating new and innovative approaches to cancer research and through interdisciplinary efforts to effectively move this research from the laboratory into clinical trials and into clinical practice comprehensive cancer centers internet addresses are given where available university of alabama at birmingham comprehensive cancer centerbasic health sciences building room university boulevardbirmingham alabama university of arizona cancer center north campbell avenuetucson arizona internet sydazccarizonaedu jonsson comprehensive cancer centeruniversity of california at los angeles medical plazalos angeles california hicnet medical newsletter page volume number april internet rickjcccmedschuclaedu kenneth t norris jr comprehensive cancer centeruniversity of southern california eastlake avenuelos angeles california yale university comprehensive cancer center cedar streetnew haven connecticut lombardi cancer research centergeorgetown university medical center reservoir road nwwashington dc sylvester comprehensive cancer centeruniversity of miami medical school northwest th avenuemiami florida internet hlammednetmedmiamiedu johns hopkins oncology center north wolfe streetbaltimore maryland danafarber cancer institute binney streetboston massachusetts internet kristiestevensonmacmailgwdfciharvardedu meyer l prentis comprehensive cancer center of metropolitandetroit east warren avenuedetroit michigan internet cummingsoncvxdnetrocdecrocwayneedu university of michigan cancer centerhicnet medical newsletter page volume number april simpson driveann arbor michigan bitnet kalliebilamichelsumccumichedu mayo comprehensive cancer center first street southwestrochester minnesota norris cotton cancer centerdartmouthhitchcock medical centerone medical center drivelebanon new hampshire bitnet edwardbresnickdartmouthedu roswell park cancer instituteelm and carlton streetsbuffalo new york columbia university comprehensive cancer centercollege of physicians and surgeons west th streetnew york new york internet janiecuccfaccccolumbiaedu memorial sloankettering cancer center york avenuenew york new york kaplan cancer centernew york university medical center first avenuenew york new york unc lineberger comprehensive cancer centeruniversity of north carolina school of medicinechapel hill north carolina hicnet medical newsletter page volume number april duke comprehensive cancer centerpo box durham north carolina cancer center of wake forest university at the bowman gray schoolof medicine south hawthorne roadwinstonsalem north carolina internet ccwfumailphsbgsmwfuedu ohio state university comprehensive cancer center west th avenuecolumbus ohio internet dyoungmagnusacsohiostateedu fox chase cancer center burholme avenuephiladelphia pennsylvania internet sdavisfcccedu university of pennsylvania cancer center spruce streetphiladelphia pennsylvania pittsburgh cancer institute meyran avenuepittsburgh pennsylvania the university of texas md anderson cancer center holcombe boulevardhouston texas vermont cancer centeruniversity of vermont south prospect streetburlington vermont hicnet medical newsletter page volume number april fred hutchinson cancer research center columbia streetseattle washington internet sedmondscclinkfhcrcorg university of wisconsin comprehensive cancer center highland avenuemadison wisconsin bitnet carboneuwcccbiostatwiscedu clinical cancer centers university of california at san diego cancer center dickinson streetsan diego california internet dedavisucsdedu city of hope national medical centerbeckman research institute east duarte roadduarte california ext university of colorado cancer center east th avenue box bdenver colorado university of chicago cancer research center south maryland avenue box chicago illinois internet judithdelphibsduchicagoedu albert einstein college of medicine morris park avenuebronx new york hicnet medical newsletter page volume number april university of rochester cancer center elmwood avenue box rochester new york internet rickbwotanmedicinerochesteredu ireland cancer center case western reserve universityuniversity hospitals of cleveland abington roadcleveland ohio roger williams cancer centerbrown university chalkstone avenueprovidence rhode island st jude childrens research hospital north lauderdale streetmemphis tennessee internet meyermbcfstjudeorg institute for cancer research and care medical drivesan antonio texas utah regional cancer centeruniversity of utah health sciences center north medical drive room csalt lake city utah bitnet hoganccutahedu massey cancer centermedical college of virginiavirginia commonwealth university east broad streetrichmond virginia consortiahicnet medical newsletter page volume number april drewmeharrymorehouse consortium cancer center db todd boulevardnashville tennessee hicnet medical newsletter page volume number april general announcments the uci medical education software repository this is to announce the establishment of an ftp site at the university of california for the collection of shareware publicdomain software and other information relating to medical education specifically we are interested in establishing this site as a clearinghouse for personally developed software that has been developed for local medical education programs we welcome all contributions that may be shared with other users to connect to the uci medical education software repository ftp to ftpucieduthe repository currently offers both msdos and macintosh software and we hope to support other operating systems unix mumps amiga uploads are welcome we actively solicit information and software which you have personaly developed or have found useful in your local medical education efforts either as an instructor or student once you have connected to the site via ftp cd change directory to either the mededmacincoming or the mededmsdosincoming directories change the mode to binary and send or put your files note that you wont be able to see the files with the ls or dir commands please compress your files as appropriate to the operating system zip for msdos compactor or something similar for macintosh to save disk space after uploading please send email to steve clancy slclancyuciedu for msdos or albert saisho saishouciedu for mac describing the files you have uploaded and any other information we might need to describe itnote that we can only accept software or information that has been designated as shareware publicdomain or that may otherwise be distributed freely please do not upload commercial software doing so may jeopardize the existence of this ftp site if you wish to upload software for other operating systems please contact either steve clancy mls or albert saisho md at the addresses abovehicnet medical newsletter page volume number april aids news summaries aids daily summarythe centers for disease control and prevention cdc national aids clearinghouse makes available the following information as a public service only providing this information does not constitute endorsement by the cdc the cdc clearinghouse or any other organization reproduction of this text is encouraged however copies may not be sold copyright information inc bethesda md april nih set to test multiple aids vaccines reuters frank jacqueline washingtonthe clinton administration will permit the national institutes of health to test multiple aids vaccines instead of only allowing the army to test a single vaccine administration sources said thursday the decision ends the controversy between army aids researchers who had hoped to test a vaccine made by microgenesys inc and the national institutes of health which contended that multiple vaccines should be tested health and human services secretary donna shalala said a final announcement on the therapeutic vaccine trials was expected to be made last friday companies including genentech inc chiron corp and immuno ag have already told nih that they are prepared to participate in the vaccine tests the testing is intended to demonstrate whether aids vaccines are effective in thwarting the replication of hiv in patients already infected shalala refuted last weeks reports that the clinton administration had decided the armys test of the microgenesys vaxsyn should proceed without tests of others at the same time the report was inaccurate and i expect there to be some announcement in the next hours about that particular aids research project said shalala administration sources subsequently confirmed that nih director dr bernadine healy and food and drug administration commissioner david kessler had convinced the white house that multiple vaccines should be tested simultaneously but microgenesys president frank volvovitz said a test of multiple vaccines could triple the cost of the trial and delay it by two years hicnet medical newsletter page volume number april the limits of azts impact on hiv us news world report vol no p azt has become the most widely used drug to fight aids since it was approved by the food and drug administration in burroughs wellcome the manufacturer of azt made million last year alone from sales of the drug however a team of european researchers recently reported that although hivpositive patients taking azt demonstrated a slightly lower risk of developing aids within the first year of treatment that benefit disappeared two years later the lancet published preliminary findings of the threeyear study which could give more reason for critics to argue the drugs cost side effects and general efficacy even though us researchers concede the study was more comprehensive than american trials many argue the european researchers suggestion that hivpositive patients experience little improvement in their illness before the development of aids symptoms in addition researchers have long been familiar with the end of part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom cafomenuucp chuck forsberg wakgxsubject re my new diet it works great in article rksinnicalynxunmedu bhjellecarinaunmedu writesin article apromenuucp cafomenuucp chuck forsberg wakgx writesin article pittuucp gebcspittedu gordon banks writescan you provide a reference to substantiate that gaining backthe lost weight does not constitute weight rebound until itexceeds the starting weight or is this oral tradition thatis shared only among you obesity researchersnot one but twoobesity in europe proceedings of the st european congress on obesityannals of ny acad sci hmmm these dont look like references to me is passiveaggressivebehavior associated with weight rebound briani purposefully left off the page numbers to encourage the reader tostudy the volumes mentioned and benefit therefrom chuck forsberg wakgx tektronixreedomencaf author of ymodem zmodem professionalyam zcomm and dsz omen technology inc the high reliability softwarev nw sauvie is rd portland or from jimzisfeinfactorycom jim zisfein subject re could this be a migrainegb from gebcspittedu gordon banksgb i am excepting migraine which is arguably neurologicgb i hope you meant inarguablygiven the choice i would rather argue gno arguments about migranous aura in fact current best evidence isthat aura is intrinsicially neuronal a la spreading depression ofleao rather than vascular something causing vasoconstriction andsecondary neuronal ischemiamigraine without aura however is a fuzzier issue there do notseem to be objectively measurable changes in brain function thecopenhagen mafia lauritzen olesen et al have done local cbfstudies on migraine without aura and unlike migraine with aurabut like tensiontype they found no changes in lcbffrom one absurd perspective all pain is neurologic because inthe absence of a nervous system there would not be pain fromanother tautologic perspective any disease is in the domain ofthe specialty that treats it neurologists treat headachetherefore at least in the usa headache is neurologicwhether neurologic or not nobody would disagree that disablingheadaches are common perhaps my feeforservice neurologiccolleagues scrounging for cases want all the headache patientsthey can get working on a salary however i would rather not fillmy office with patients holding their heads in pain slmr email jimzisfeinfactorycom jim zisfein from thommorganucsmunca thomas clancysubject re thrush was good grief was re candida albicans what is itdyerspdcccom steve dyer writesin article aprucsvaxsdsuedu mccurdyucsvaxsdsuedu mccurdy m writesdyer is beyond rude ill drink to thatyeah yeah yeah i didnt threaten to rip your lips off did isnortthere have been and always will be people who are blinded by their own knowledge and unopen to anything that isnt already established given what the medical community doesnt know im surprised that he has this outlookduhnice to see steve still has his high and almighty intellectual prowess in tactfor the record i have had several outbreaks of thrush during the several past few years with no indication of immunosuppression or nutritional deficiencies i had not taken any antobiotics listen thrush is a recognized clinical syndrome with definitecharacteristics if you have thrush you have thrush because you cansee the lesions and do a culture and when you treat it it generallyresponds well if youre not otherwise immunocompromised noringsanalretentive idee fixe on having a fungal infection in his sinusesis not even in the same category here nor are these walking neurasthenicswho are convinced they have candida from reading a quack bookyawnmy dentist who sees a fair amount of thrush recommended acidophilousafter i began taking acidophilous on a daily basis the outbreaks ceasedwhen i quit taking the acidophilous the outbreaks periodically resumed i resumed taking the acidophilous with no further outbreaks since thensoexactly my question to you steve whats your point this person hadone you didnt steve dyernice to see that some things never change steve if you arent beingignorant in one group alternative youre into another one positivething came out of it you are no longer bothering the folks in alternative its just a shame that these people have to suffer sothat others may breath freely sorry for wasting bandwidth folks dont forget to bow down onceevery second day and to offer your first born to the almight omniscient omnipotent mr stevefrom dscgeminigsfcnasagov doug s caprettesubject cs chemical agentcan anyone provide information on cs chemical agentthe tear gas used recentlyin waco just what is it chemically and what are its effects on the bodydscgeminigsfcnasagov regards hughes stx code gsfc doug caprette lanham maryland greenbelt md a path is laid one stone at a time the giantfrom annickcortexphysiolsuozau annick ansselinsubject re is msg sensitivity superstitionin cnfdgensdflonestarorg marcosdflonestarorg steve giammarco writesand to add further fuel to the flame war i read about years ago thatthe natural msg extracted from the sources you mention above does notcause the reported aftereffects its only that nasty artificial msg extracted from coal tar or whatever that causes chinese restaurantsyndrome i find this pretty hard to believe has anyone else heard itmsg is mono sodium glutamate a fairly straight forward compound if it ispure the source should not be a problem your comment suggests that impurities may be the causemy experience of msg effects as part of a double blind study was that thepure stuff caused me some rather severe effectsi was under the possibly incorrect assumption that most of the msg onour foods was made from processing sugar beets is this not true are there other sources of msgsoya bean fermented cheeses mushrooms all contain msg i am one of those folx who react sometimes strongly to msg howeveri also react strongly to sodium chloride table salt in excess eachcauses different symptoms except for the common one of rapid heartbeatand an uncomfortable feeling of pressure in my chest upper left quadrantthe symptoms i had were numbness of jaw muscles in the first instancefollowed by the arms then the legs headache lethargy and unable to keepawake i think it may well affect people differentlyfrom lmegnatitanucsumassedu lisa megnasubject neurofibromatosishelloi am writing a grant proposal for a developmental genetics class and ihave chose to look at the neurofibromatosis gene and its variableexpressivity i am curious what has already been done on this subjectespecially the relationship between specific mutations and the resultingphenotype my literature search has produce many references but i want tomake sure i am proposing new research if anyone knows aything that has beenrecently or key peopl doing research to search for using medline i wouldapprciate being informedthank youlisa megnalmegnatitanuccumassedufrom xleegwwmichedusubject re is msg sensitivity superstitionin article annickcortexphysiolsuozau annickcortexphysiolsuozau annick ansselin writes in cnfdgensdflonestarorg marcosdflonestarorg steve giammarco writes and to add further fuel to the flame war i read about years ago thatthe natural msg extracted from the sources you mention above does notcause the reported aftereffects its only that nasty artificial msg extracted from coal tar or whatever that causes chinese restaurantsyndrome i find this pretty hard to believe has anyone else heard it msg is mono sodium glutamate a fairly straight forward compound if it is pure the source should not be a problem your comment suggests that impurities may be the cause my experience of msg effects as part of a double blind study was that the pure stuff caused me some rather severe effects i was under the possibly incorrect assumption that most of the msg onour foods was made from processing sugar beets is this not true are there other sources of msg soya bean fermented cheeses mushrooms all contain msg i am one of those folx who react sometimes strongly to msg howeveri also react strongly to sodium chloride table salt in excess eachcauses different symptoms except for the common one of rapid heartbeatand an uncomfortable feeling of pressure in my chest upper left quadrant the symptoms i had were numbness of jaw muscles in the first instance followed by the arms then the legs headache lethargy and unable to keep awake i think it may well affect people differentlywell i think msg is made from a kind of plant call tapioca and not thosestaff you mentiond abovesubject re broken ribfrom jconebalmanacbccahello i think you are probaly right in spite of the movementit is getting better each day cheers jconebalmanacbcca john cross the old frogs almanac home of the almanac unix users group v public access usenet x vancouver island british columbia waffle xenix from uaverbavaxcstevenstechedusubject arythmiai dont know if anyone knows about this topic electrical heart failure one of my friends has had to go to the doctor becausehe had chest pains the doc said it was arythmia so he had togo to a new york hospital for a lot of money to get treated hisdoctors said that he could die from it and the medication causedcancer that he was taking well i suggested that he run excersizeand eat more he is very skinny but he says that has nothingto do with it does anyone know what causes arythmia and how it can be treatedthanks from nyedacnsvaxuwecedu david nyesubject re acutane fibromyalgia syndrome and cfsreply to danielprincefnzcalcomsocalcom daniel prince there is a person on the fido cfs echo who claims that he was cured ofcfs by taking accutane he also claims that you are using it in thetreatment of fibromyalgia syndrome are you using accutane in thetreatment of fibromyalgia syndrome yes have you used it for cfs it seems to work equally well for cfs another hint that these may bedifferent facets of the same underlying process have you gotten good results with it yes the benefit is usually evident within a few days of starting itmost of the patients for whom it has worked well continued lowdoseamitriptyline daily aerobic excersise and a regular sleep schedulecurrent standard therapy because of the cost usually modepending on dose and potential for significant side effects likecorneal injury and birth defects i currently reserve it for those whofail conventional treatment it is important that the personprescribing it have some experience with it and follow the patientclosely are you aware of any double blind studies on the use of accutane inthese conditions thank you in advance for all replies as far as i know i am the only person looking at it currently ishould get off my duff and finish writing up some case reports im notan academic physician so i dont feel the pressure to publish or perishand i dont have the time during the work day for such things david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom nyedacnsvaxuwecedu david nyesubject re good grief was re candida albicans what is itreply to aldridgenetcomcom jacquelin aldridge medicine is not a totally scientific endevour the acquisition of scientific knowledge is completely scientific theapplication of that knowledge in individual cases may be more art thanscience there are diseases that havent been described yet and the root causeof many diseases now described arent known read a book ongastroenterology sometime if you want to see a lot of them afterscientific methods have run out then its the patients freedom ofchoice to try any experimental method they choose and its wellrecognized by many doctors that medicine doesnt have all the answers certainly we dont have all the answers the question is what is themost reliable means of acquiring further medical knowledge thescientific method has proven itself to be reliable the only reasonalternative therapies are shunned by physicians is that theirpractitioners refuse to submit their theories to rigorous scientificscrutiny insisting that tradition or anecdotal evidence aresufficient these have been shown many times in the past to be veryunreliable ways of acquiring reliable knowledge crooks ideas havenever been backed up by scientific evidence his unwillingness to dogood science makes the rest of us doubt the veracity of his contentions david nye nyedacnsvaxuwecedu midelfort clinic eau claire withis is patently absurd but whoever wishes to become a philosophermust learn not to be frightened by absurdities bertrand russellfrom deshelixnihgov david e scheimsubject re burzynskis antineoplastonsin article jschwimmerwccnetwccwesleyanedu jschwimmerwccnetwccwesleyanedu josh schwimmer writesive recently listened to a tape by dr stanislaw burzynski in which he claims to have discovered a series naturally occuring peptides with anticancer properties that he names antineoplastons burzynski says that his work has met with hostility in the united states despite the favorable responses of his subjects during clinical trialswhat is the generally accepted opinion of dr burzynskis research he paints himself as a lone researcher with a new breakthrough battling an intolerant medical establishment but i have no basis from which to judge his claims two weeks ago however i read that the nihs department of alternative medicine has decided to focus their attention on burzynskis work their budget is so small that i imagine they wouldnt investigate a treatment that didnt seem promisingany opinions on burzynskis antineoplastons or information about the current status of his research would be appreciatedjoshua schwimmerjschwimmereaglewesleyanedutheres been extensive discussion on the compuserve cancer forum about dr burzynskis treatment as a result of the decision of a forum members father to undertake his treatment for brain glioblastoma this disease is universally and usually rapidly fatal after diagnosis in june the tumor was growing rapidly despite radiation and chemotherapy the forum member checked extensively on dr burzynkis track record for this disease he spoke to a few patients in complete remission for a few years from glioblastoma following this treatment and to an nci oncologist who had audited other such case histories and found them valid and impressive after the forum members father began dr burzynskis treatment in september all subsequent scans performed under the auspices of his oncologist in chicago have shown no tumor growth with possible signs of shrinkage or necrosisthe patients oncologist although telling him he would probably not live past december was vehemently opposed to his trying dr burzynskis treatment since the tumor stopped its rapid growth under dr burzynskis treatment shes since changed her attitude toward continuing these treatments saying if it aint broke dont fix itdr burzynski is an md phd with a research background who found a protein that is at very low serum levels in cancer patients synthesized it and administers it to patients with certain cancer types there is little understanding of the actual mechanism of activity david e scheim bitnet none internet deslhelixnihgov phone compuserve fax disclaimer these comments are offered to share knowledge based upon my personal views they do not represent the positions of my employer from ceruleanaccessdigexcom bill christensbarrysubject cytoskeleton dynamicsim looking for good background and review paper references that can help meunderstand the dynamics of cytoskeleton in normal and transformed cells inparticular im not interested in translational behavior and cell motilitybut rather in the internal motions of the cytoskeleton and its componentsunder normal and transformed circumstancesalso id appreciate any data on force constants mechanical and elasticproperties of microtubules and viscous properties of cytoplasm any otherinfo relevant to the vibrational or acoustical properties of these wouldbe useful to methanksbill christensbarryceruleanaccessdigexcomfrom ronrothrosecom ron rothsubject selective placebol levinbbncom joel b levin writesl john badanes wrotel jb ronwhat do you consider to be proper channelsl l im glad it caught your eye thats the purpose of this forum tol educate those eager to learn about the facts of life that phrasel is used to bridle the frenzy of all the wouldbe respondents whol otherwise would feel being left out as the proper authorities to bel consulted on that topic in short it means absolutely nothingl l an apt description of the content of just about all ron roths l posts to date at least theres entertainment value though it l is diminishing well thats easy for you to say all you have to do is sit back soak it all in try it out on your patients and then brag to all your colleagues about that incredibly success rate youre having all of a sudden ron rosereader p for real sponge cake borrow all ingredients rosemail usenet rose media hamilton from sherylseasgwuedu sheryl coppengersubject re hismanal et alside effectsin article aprspdcccom dyerspdcccom steve dyer writesin article aprlrcedu kjivlrcedu writescan someone tell me whether or not any of the following medications has been linked to rapidexcessive weight gain andor a distorted sense of taste or smell hismanal azmacort a topical steroid to prevent asthma vancenasehismanal astemizole is most definitely linked to weight gainit really is peculiar that some antihistamines have this effectand even more so an antihistamine like astemizole which purportedlydoesnt cross the bloodbrain barrier and so tends not to causedrowsinessso antihistamines can cause weight gain now they tell me is there any way to find out which do which dont my doctorobviously is asleep at the wheelthe original poster mentioned fatigue i had that too but it wasmostly due to the really bizarre dreams i was having i wasnt gettingany rest my doctor said that was a common reaction if astemizoledoesnt cross the bloodbrain barrier how does it cause that sideeffect any ideas sheryl coppenger seas computing facility staffsherylseasgwuedu the george washington university from brucedataiocom bruce reynoldssubject re is msg sensitivity superstitionsmjefflerclercnasagov jeff miller writeseven properly controlled studies eg double blind studies are almostuseless if you are trying to prove that something does not affect anyone and in article qnnslagateberkeleyedu sppzabriskieberkeleyedu steve pope writesthe mass of anectdotal evidence combined with the lack ofa properly constructed scientific experiment disprovingthe hypothesis makes the msg reaction hypothesis themost likely explanation for eventsgood grief has no one ever heard of biostatistics the university ofwashington plus or others harvard unc has a department andadvanced degree program in biostatistics my wife has an ms biostat andthere are plenty of mds phds and postdocs doing biostatistical workpeople do this for a living really bright people study for decades to dothis sort of study wellanecedotal evidence is worthless even doctors who have been using a drugor treatment for years and who swear it is effective are often suprisedat the results of clinical trials whether or not msg causes describablereportable documentable symptoms should be pretty simple to discover the last study on which my wife worked employed nurses doctorsand a dozen phds at one university and at hospitals in five nations iwould think the msg question could be settled by one lowly biostat msstudent in a thesisbrucefrom stgpraostunocalcom richard ottolinisubject re krillean photographyliving things maintain small electric fields to enhance certainchemical reactions promote communication of states with in a cell communicate between cells of which the nervous system is a specializedexample and perhaps other uses these electric fields change with locationand time in a large organism special photographic techniques such as applyingexternal fields in kirillian photography interact with these fields or the resistancescaused by these fields to make interesting pictures perhaps such pictures willbe diagonistic of disease problems in organisms when better understood perhaps notstudying the overall electric activity of biological systems is several hundredyears old but not a popular activity perhaps except in the case of a fewtissues like nerves and the electric senses of fishes it is hard to reduce theinvestigation into small pieces that can be clearly analyzed there are somehints that manipulating electric fields is a useful therapy such as speedingthe healing of broken bones but not understood whybioelectricity has a long association with mysticism ideas such as frankensteinreanimation go back to the most early electrical experiments on tissue such aswhen volta invented the battery i personally dont care to revert to supernaturalcause to explain things we dont yet understandfrom tammyvandenboomlaunchpaduncedu tammy vandenboomsubject sore spot on testiclesmy husband woke up three days ago with a small sore spota spot about the size of a nickel on one of his testicles bottom sideno knots or lumps just a little sore spot he says it reminds him of how a bruise feels he has no recollection of hitting it or anything likethat that would cause a bruise he asssures me hed remember somethinglike that any clues as to what it might be hes somewhat of a hypochondriac spso hes sure hes gonna die thanks the opinions expressed are not necessarily those of the university of north carolina at chapel hill the campus office for information technology or the experimental bulletin board service internet launchpaduncedu or from rindenterprisebihharvardedu david rindsubject re thrush was good grief was re candida albicans what is itin article aprucsvaxsdsuedu mccurdyucsvaxsdsuedu mccurdy m writesmy dentist who sees a fair amount of thrush recommended acidophilousafter i began taking acidophilous on a daily basis the outbreaks ceasedwhen i quit taking the acidophilous the outbreaks periodically resumed i resumed taking the acidophilous with no further outbreaks since thenthis is the second post which seems to be blurring the distinctionbetween real disease caused by candida albicans and the diseasethat was being asked about systemic yeast syndromethere is no question that candida albicans causes thrush it alsoseems to be the case that active yogurt cultures with acidophilousmay reduce recurrences of thrush at least for vaginal thrush ive never heard of anyone taking it for oral thrush before though presumably it would work by the same mechanismcandida is clearly a common minor pathogen and a less common majorpathogen that does not mean that there is evidence that it causesthe systemic yeast syndrome david rindrindenterprisebihharvardedufrom jacquiergsbuxuchicagoedu eric jacquier subject opinions on allergy hay fever shotshelloi am interested in trying this desensitization methodagainst hay feverwhat is the state of affairs about this i went to a doctor andpaid for a minute interview scratches leading to thediagnostic that i am allergic to june and timothy grassi believe this from now on it looks like shots per week for months followed by shot per month or so each shot costs talking about soaring costs and the health care system i wouldcall that a racket we are not talking about rare amazonian grasseshere but the garbage which grows behind the doctors officeapart from this issue i was somewhat disappointed to find outthat you have to keep getting the shots forever is that rightthanks for informationej from williamtathenaengsuncom william turnbowsubject re discussions on altpsychoactivesin article rbhsinnhafhpcolcolhpcom billccolhpcom bill claussen writesthis group was originally a takeoff from scimed the reason forthe formation of this group was to discuss prescription psychoactivedrugssuch as oh well obviously no one really caresthen let me ask you for a workable solution we have a namehere that implies certain things to many people rather than tryingto educate each and every person that comes to the group is theresome name that would imply what this group was originallyintended for my dad was a lawyer as such i grew up with being a sticklerfor meaning in my reality psychoactives technically could range from caffeine to datura to the drugs you mention to morestandard recreational drugs in practice i had hoped to see itlimited to those that were above some psychoactive level likesome of the drugs you mention but also possibly including somerecreational drugs but with conversation limited to their psychoactive effects the recent query about bong water i thought was a bitoff topic so i just hit kbut back to the original question what is a workable solution what is a workable name that would imply the topic you with todiscuss it sounds like there should be a altsmartdrugs or somethingsimilar i dont feel psychoactives would generally be used todescribe alot of those drugs there is a big difference between adrug that if taken in certain doses over a period of days may havea psychoactive effect in some people vs many of the drugs inpihkah which are psychoactivewm if prochoice means choice after conception does this apply to men too from matthewsoswegoedu harry matthewssubject re getting aids from acupuncture needlesin article rfbeuuagateberkeleyedu romdasuclinkberkeleyedu ella i baff writes someone wrote in expressing concern about getting aids from acupuncture needlesunless your friend is sharing fluids with their acupuncturist who themselves has aidsit is unlikely not impossible they will get aids from acupuncture needles generally even if accidently inoculated the normalimmune response should be enough to effectively handle the minimal contaminant involved with acupuncture needle insertion isnt this what hiv is about the normal immune response to an exposuremost acupuncturists use disposable needlesuse once and throw awayi had electrical pulse nerve testing done a while back the needles were takenfrom a dirty drawer in an instrument cart and were most certainly notsterile or even clean for that matter more than likely they were freshfrom the previous patient i was concerned but i kept my mouth shut iprobably should have raised hellany comments no excusesfrom paulsontablarcnasagov sharon paulsonsubject re foodrelated seizuresin article buedu dozonoffbuedu david ozonoff writes path newslarcnasagovdarwinsuranetzaphodmpsohiostateeduuwmedulinacattbuedudozonoff from dozonoffbuedu david ozonoff newsgroups scimed date apr gmt references paulsonaprcmblarcnasagov sender newsbuedu lines xnewsreader tin pl sharon paulson paulsontablarcnasagov wrote much deleted the fact that this happened while eating two sugar coated cereals made by kellogs makes me think she might be having an allergic reaction to something in the coating or the cereals of the four of us in our immediate family kathryn shows the least signs of the hay fever running nose itchy eyes etc but we have a lot of allergies in our family history including some weird food allergies nuts mushrooms many of these cereals are cornbased after your post i looked in the literature and located two articles that implicated corn contains tryptophan and seizures the idea is that corn in the diet might potentiate an already existing or latent seizure disorder not cause it check to see if the two kellog cereals are corn based id be interested david ozonoff md mph boston university school of public health dozonoffmeditvaxbuedu east concord st tc boston ma a couple of folks have suggested the corn connection in the five monthperiod between the two seizures my daughter had eaten a fair amount ofkix and berry berry kix in the mornings and never had a problem i checkedthe labels and the first ingredient is corn she has also never had a problemeating corn or corn on the cob but of course that is usually later in the daywith a full stomach so the absorption would not be so high i do believe thatfrost flakes have corn in them but i will have to check the fruit loops butthe fact that she has eaten this other corny cereal in the morning makes mewonderthanks for checking into this all information at this point is valuable to mesharonsharon paulson sspaulsonlarcnasagovnasa langley research centerbldg d mailstop work hampton virginia home from andrew t robinson andymainemaineedusubject reasons for hospitals to join internetwhat resources and services are available on internetbitnet whichwould be of interest to hospitals and other medical care providersim interested in anything relelvant including institutions andbusinesses of interest to the medical profession on internetspecial services such as online access to libraries or diagnosticinformation etc etcplease reply directly to andymaineedufrom roosoperonihelsinkifi christophe roossubject wanted rat cell line adrenal glandcortical ci am looking for a rat cell line of adrenal gland cortical cell type i have been looking at atcc without success and would very much appreciate any helpthank you for reading thischristophe roosinstitute of biotechnology fax pobox valimotie email christopherooshelsinkifiuniversity of helsinki x gchristophesroossf finland ohelsinkiafumailcfifrom mcgnscclehighedu marc gabrielsubject re how to diagnose lyme reallygordon banks gebcspittedu wrote in article aprnscclehighedu mcgnscclehighedu marc gabriel writes now im not saying that culturing is the best way to diagnose its very hard to culture bb in most cases the point is that dr n has developed a feel for what is and what isnt ld this comes from years of experience no serology can match that unfortunately some would call dr n a quack and accuse him of trying to make a quick buck why do you think he would be called a quack the quacks dont do cultures they poopoo doing more lab tests this is lyme believe me ive seen it many times the lab tests arent accurate well treat it now also is dr ns practice almost exclusively devoted to treating lyme patients i dont know any orthopedic surgeons who fit this pattern they are usually gpsno he does not exclusively treat ld patients however in some parts of thecountry you dont need to be known as an ld specialist to see a largenumber of ld patients walk through your office given the huge problem ofunderdiagnosis orthopedists encounter late manifestations of the disease justabout every day in their regular practices dr n told me that last yearhe sent between and patients a week to the ld specialists and he is notthe only orthopedists in the townlets say that only people per week actually have ld that means at thevery minimum people in our town and immediate area develop late stagemanifestations of ld every year add in the folks who were diagnosed byneurologists rheumatologists gps etc and you can see what kind of problemwe have no wonder just about everybody in town personally knows an ldpatienthe refers most patients to ld specialists but in extreme cases he puts thepatient on medication immediately to minimize the damage in most cases tothe kneesgordon is correct when he states that most ld specialists are gpsmarc marc c gabriel uc box lehigh universityfrom debbiecsdcsduwmedu debbie forestsubject re hismanal et alside effectsin article aprseasgwuedu sherylseasgwuedu sheryl coppenger writesin article aprspdcccom dyerspdcccom steve dyer writeshismanal astemizole is most definitely linked to weight gainit really is peculiar that some antihistamines have this effectand even more so an antihistamine like astemizole which purportedlydoesnt cross the bloodbrain barrier and so tends not to causedrowsinessthe original poster mentioned fatigue i had that too but it wasmostly due to the really bizarre dreams i was having i wasnt gettingany rest my doctor said that was a common reaction if astemizoledoesnt cross the bloodbrain barrier how does it cause that sideeffect any ideasit made me really bitchy for the first few weeks now that i think aboutit i was having some bizarre dreams too my doctor said it made him feellike he had to be doing something all the time but if you keep taking itafter a few weeks these symptoms seem to go away he said hang in there i did and they did from shavlikcswiscedu jude shavliksubject program reg forms st int conf on intell sys for molecular biologyfor those attending the aaai conf this summer note thatthis conference is immediately preceding it preliminary program and registration materials first international conference on intelligent systems for molecular biology washington dc july sponsored by the national institutes of health national library of medicine the department of energy office of health and environmental research the biomatrix society the american association for artificial intelligence aaaiposter session and tutorials bethesda ramada hoteltechnical sessions lister hill center auditorium national library of medicinefor more information contact ismbnlmnihgov or fax purposethis the first international conference on intelligent systems for molecular biology is the inaugural meeting in a series intended to bring together scientists who are applying the technologies of artificial intelligence robotics machine learning massively parallel computing advanced data modelling and related methods to problems in molecular biology the scope extends to any computational or robotic system supporting a biological task that is cognitively challenging involves a synthesis of information from multiple sources at multiple levels or in some other way exhibits the abstraction and emergent properties of an intelligent system facilitiesthe conference will be held at lister hill center national library of medicine rockville pike nih building a bethesda md seating in the conference center is strictly limited so registrations will be accepted on a firstcome firstserve basis accomodations as well as a reception and poster session will be at the bethesda ramada hotel wisconsin avenue bethesda md a special room rate has been negotiated with the hotel of day expires attendees must make their own reservations by writing the hotel or calling and mentioning the ismb conference to participate in a roommatematching service email opitzcswiscedu transportationthe two facilities are within easy walking distance convenient to the subway metro red line medical center stop and from there to the amtrak station nearby airports include dulles national and baltimorewashington international proceedingsfulllength papers from both talks and posters will be published inarchival proceedings the citation is proceedings of the first international conference on intelligent systems for molecular biology eds l hunter d searls and j shavlik aaaimit press menlo park ca copies will be distributed at the conference to registered attendees and will be available for purchase from the publisher afterwards talkswednesday july am continental breakfastam opening remarksam invited talk statistics protein cores and predicted structures prof temple smith boston universityambreakamconstructive induction and protein structure prediction tr ioerger l rendell s surbramaniamamprotein secondarystructure modeling with probabilistic networks al delcher s kasif hr goldberg w hsupmlunchpmprotein secondary structure using twolevel casebased reasoning b leng bg buchanan hb nicholaspm automatic derivation of substructures yields novel structural building blocks in globular proteins x zhang js fetrow wa rennie dl waltz g bergpm using dirichlet mixture priors to derive hidden markov models for protein families m brown r hughey a krogh is mian k sjolander d hausslerpmbreakpmprotein classification using neural networks ea ferran b pflugfelder p ferrarapmneural networks for molecular sequence classification c wu m berry ys fung j mclartypmcomputationally efficient cluster representation in molecular sequence megaclassification dj states n harris l hunterpm poster setuppm reception poster session thursday july am continental breakfastam invited talk largescale dna sequencing a tale of mice and men prof leroy hood university of washingtonambreakampattern recognition for automated dna sequencing i online signal conditioning and feature extraction for basecalling jb bolden iii d torgersen c tibbettsamgenetic algorithms for sequence assembly r parsons s forrest c burksama partial digest approach to restriction site mapping ss skiena g sundarampmlunchpmintegrating order and distance relationships from heterogeneous maps m graves pmdiscovering sequence similarity by the algorithmic significance method a milosavljevicpmidentification of human gene functional regions based on oligonucleotide composition vv solovyev cb lawrencepmknowledge discovery in genbank js aaronson j haas gc overtonpmbreakpman expert system to generate machine learning experiments learning with dna crystallography data d cohen c kulikowski h berman pm detection of correlations in trna sequences with structural implications tm klingler d brutlagpmprobabilistic structure calculations a three dimensional trna structure from sequence correlation data rb altmanfriday july am continental breakfastam invited talk artificial intelligence and a grand unified theory of biochemistry prof harold morowitz george mason universityambreakamtesting hiv molecular biology in in silico physiologies hb sieburg c barayamidentification of localized and distributed bottlenecks in metabolic pathways ml mavrovouniotisamfinegrain databases for pattern discovery in gene regulation sm veretnik br schatzpmlunchpmrepresentation for discovery of protein motifs d conklin s fortier j glasgowpmfinding relevant biomolecular features l hunter t kleinpmdatabase techniques for biological materials and methods k baclawski r futrelle n fridman mj pescitellipma multilevel description scheme of protein conformation k onizuka k asai m ishikawa stc wongpmbreakpmprotein topology prediction through parallel constraint logic programming da clark cj rawlings j shirazi a veron m reevepma constraint reasoning system for automating sequence specific resonance assignments in multidimensional protein nmr spectra d zimmerman c kulikowski gt montelionepmclosing remarks poster sessionthe following posters will be on display at the bethesda ramada hotel from pm wednesday july the induction of rules for predicting chemical carcinogenesis in rodents d bahler d bristol senex a closclim application for molecular pathology ss ball vh mah flash a fast lookup algorithm for string homology a califano i rigoutsos toward multistrategy parallel learning in sequence analysis pk chan sj stolfo protein structure prediction selecting salient features from large candidate pools kj cherkauer jw shavlik comparison of two approaches to the prediction of protein folding patterns i dubchak sr holbrook sh kim a modular learning environment for protein modeling j gracy l chiche j sallantin inference of order in genetic systems jn guidi th roderick palm a pattern language for molecular biology c helgesen pr sibbald grammatical formalization of metabolic processes r hofestedt representations of metabolic knowledge pd karp m riley protein sequencing experiment planning using analogy b kettler l darden design of an objectoriented database for reverse genetics kj kochut j arnold ja miller wd potter a small automaton for word recognition in dna sequences c lefevre je ikeda multimap an expert system for automated genetic linkage mapping tc matise m perlin a chakravarti constructing a distributed objectoriented system with logical constraints for fluorescenceactivated cell sorting t matsushima prediction of primate splice junction gene sequences with a cooperative knowledge acquisition system em nguifo j sallantin objectoriented knowledge bases for the analysis of prokaryotic and eukaryotic genomes g perriere f dorkeld f rechenmann c gautier petri net representations in metabolic pathways vn reddy ml mavrovouniotis ml liebman minimizing complexity in cellular automata models of selfreplication ja reggia hh chou sl armentrout y peng building large knowledge bases in molecular biology o schmeltzer c medigue p uvietta f rechenmann f dorkeld g perriere c gautier a serviceoriented information sources database for the biological sciences gk springer tb patrick hidden markov models and iterative aligners study of their equivalence and possibilities h tanaka k asai m ishikawa a konagaya protein structure prediction system based on artificial neural networks j vanhala k kaski transmembrane segment prediction from protein sequence data sm weiss dm cohen n indurkhya tutorial programtutorials will be conducted at the bethesda ramada hotel on tuesday july pm introduction to molecular biology for computer scientists prof mick noordewier rutgers universitythis overview of the essential facts of molecular biology is intended as an introduction to the field for computer scientists who wish to apply their tools to this rich and complex domain material covered will include structural and informational molecules the basic organization of the cell and of genetic material the central dogma of gene expression and selected other topics in the area of structure function and regulation as relates to current computational approaches dr noordewier has appointments in both computer science and biology at rutgers and has extensive experience in basic biological research in addition to his current work in computational biologypm introduction to artificial intelligence for biologists dr richard lathrop mit arris corpan overview of the field of artificial intelligence will be presented as it relates to actual and potential biological applications fundamental techniques symbolic programming languages and notions of search will be discussed as well as selected topics in somewhat greater detail such as knowledge representation inference and machine learning the intended audience includes biologists with some computational background but no extensive exposure to artificial intelligence dr lathrop codeveloper of ariadne and related technologies has worked in the area of artificial intelligence applied to biological problems in both academia and industrypm neural networks statistics and information theory in biological sequence analysis dr alan lapedes los alamos national laboratory this tutorial will cover the most rapidlyexpanding facet of intelligent systems for molecular biology that of machine learning techniques applied to sequence analysis closely interrelated topics to be addressed include the use of artifical neural networks to elicit both specific signals and general characteristics of sequences and the relationship of such approaches to statistical techniques and informationtheoretic views of sequence data dr lapedes of the theoretical division at los alamos has long been a leader in the use of such techniques in this domainpm genetic algorithms and genetic programming prof john koza stanford universitythe genetic algorithm an increasingly popular approach to highly nonlinear multidimensional optimization problems was originally inspired by a biological metaphor this tutorial will cover both the biological motivations and the actual implementation and characteristics of the algorithm genetic programming an extension wellsuited to problems where the discovery of the size and shape of the solution is a major part of the problem will also be addressed particular attention will be paid to biological applications and to identifying resources and software that will permit attendees to begin using the methods dr koza a consulting professor of computer science at stanford has taught this subject since and is the author of a standard text in the fieldpm linguistic methods in sequence analysis prof david searls university of pennsylvania shmuel pietrokovski weizmann instituteapproaches to sequence analysis based on linguistic methodologies are increasingly in evidence these involve the adaptation of tools and techniques from computational linguistics for syntactic pattern recognition and gene prediction the classification of genetic structures and phenomena using formal language theory the identification of significant vocabularies and overlapping codes in sequence data and sequence comparison reflecting taxonomic and functional relatedness dr searls who holds research faculty appointments in both genetics and computer science at penn represents the branch of this field that considers higherorder syntactic approaches to sequence data while shmuel pietrokovski has studied and published with prof edward trifinov in the area of wordbased analyses registration formmail with check made out to ismb to ismb conference co j shavlik computer sciences department university of wisconsin west dayton street madison wi usa name affiliation address phone fax electronic mail registration status regular student presenting talk poster tutorial registration molecular biology for computer scientists or artificial intelligence for biologists neural networks statistics and or information theory in sequence analysis genetic algorithms and genetic programming or linguistic methods in sequence analysis payment early registration before june registration early late regular student tutorials one two regular student total registration fees include conference proceedings refreshments and general program expenses organizing committee lawrence hunter nlm david searls u of pennsylvania jude shavlik u of wisconsin program committee douglas brutlag stanford u bruce buchanan u of pittsburgh christian burks los alamos national lab fred cohen ucsan francisco chris fields inst for genome research michael gribskov ucsan diego peter karp sri international toni kazic washington u alan lapedes los alamos national lab richard lathrop mit arris corp charles lawrence baylor michael mavrovouniotis u of maryland george michaels nih harold morowitz george mason u katsumi nitta icot mick noordewier rutgers u ross overbeek argonne national lab chris rawlings icrf derek sleeman u of aberdeen david states washington u gary stormo u of colorado ed uberbacher oak ridge national lab david waltz thinking machines corpfrom greenislandcom robert greensteinsubject re accupuncture and aidsin article ctdxnewscsouiucedu euclidmrcnextcsouiucedu euclid k writesalicebteatwoengsuncom alice taylor writesa friend of mine is seeing an acupuncturist andwants to know if there is any danger of gettingaids from the needlesask the practitioner whether he uses the presterilized disposableneedles or if he reuses needles sterilizing them between use in theformer case theres no conceivable way to get aids from the needles inthe latter case its highly unlikely though many practitioners use thedisposable variety anywayit is illegal to perform acupuncture with unsterilized needles no licensedpractitioner would dare do this also there is not a single documented caseof transmission of aids via acupuncture needles i wouldnt worry about it robert greenstein what the fool cannot learn he laughs at thinkinggreensrilankaislandcom that by his laughter he shows superiority instead of latent idiocy m corellifrom jgecsuncedu john eylessubject diet for crohns ibda friend has what is apparently a fairly minor case of crohnsdiseasebut she cant seem to eat certain foods such as fresh vegetableswithout discomfort and of course she wants to avoid a recurrenceher question is are there any nutritionists who specialize in theproblems of people with crohns disease i saw the suggestion of lipoxygnase inhibitors like tea and turmericthanks in advancejohn eylesjgecsuncedufrom gebcspittedu gordon bankssubject neurastheniain article aprspdcccom dyerspdcccom steve dyer writesresponds well if youre not otherwise immunocompromised noringsanalretentive idee fixe on having a fungal infection in his sinusesis not even in the same category here nor are these walking neurasthenicswho are convinced they have candida from reading a quack bookspeaking of which has anyone else been impressed with how much the descriptions of neurasthenia published a century ago sound like cfs gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re my new diet it works great in article apromenuucp cafomenuucp chuck forsberg wakgx writescan you provide a reference to substantiate that gaining backthe lost weight does not constitute weight rebound until itexceeds the starting weight or is this oral tradition thatis shared only among you obesity researchersannals of ny acad sci hmmm these dont look like references to me is passiveaggressivebehavior associated with weight rebound i purposefully left off the page numbers to encourage the reader tostudy the volumes mentioned and benefit therefromgood story chuck but it wont wash i have read the ny acad scione and have it this am i couldnt find any reference toweight rebound im not saying it isnt there but since youcited it it is your responsibility to show me where it is in therethere is no index i suspect you overstepped your knowledge baseas usual gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon subject good bookfrom rginzbergeaglewesleyanedu ruth ginzberghaving been gone for days im way behind on my news reading so manypardons if i am repeating something that has been said alreadyi read a good book while i was away the antibiotic paradox how miracle drugsare destroying the miracle stuart b levy md plenum pressisbnit is about drug resistant microorganisms the history of antibiotics itis interesting written at a level which i think many scimed readers wouldappreciate which is it assumes an intelligent reader who is capable ofunderstanding scientific concepts but who may not yet have been exposed tothis particular information ie it assumes you are smart enough tounderstand it but it does not assume that you already have a degree inmicrobiology or medicine table of contentschapter from tragedy the antibiotic age is bornchapter the disease and the cure the microscopic world of bacteria andantibioticschapter reliance on medicine and selfmedication the seeds of antibioticmisusechapter antibiotic resistance microbial adaptation and evolutionchapter the antibiotic mythchapter antibiotics animals and the resistance gene poolchapter further ecological considerations antibiotic use in agricultureaquaculture pets and minor animal specieschapter future prospects new advances against potential disasterchapter the individual and antibiotic resistancechapter antibiotic resistance a societal issue at local national andinternational levelsincludes bibliography and indexi personally found that it made very good airplanereadingrgruth ginzberg rginzbergeaglewesleyaneduphilosophy departmentwesleyan universityusafrom youngserumkodakcom rich youngsubject re is msg sensitivity superstitionin article qnnslagateberkeleyedu sppzabriskieberkeleyedu steve pope writesthe mass of anectdotal evidence combined with the lack ofa properly constructed scientific experiment disprovingthe hypothesis makes the msg reaction hypothesis themost likely explanation for events the following is from a critique of a minutes presentation on msg which was aired on november rd the critique comes from the tufts diet and nutrition letter february edited for brevitychances are good that if you watched minutes last novemberrd you came away feeling msg is bad for you inthe segment entitled no msg for instance show host ed bradleymakes alarming statements without adequately substantiating themmillions are suffering a host of symptoms and some get violentlysick peppers his report with sensational but clinically unprovenpersonal testimony and speaks of studies on msg that make thesubstance seem harmful without explaining just how inconclusive those studies areconsider his making reference at the beginning of the program toa study conducted at the eastern virginia medical school in orderto back up his comment that there is a lot of evidence that msga flavor enhancer in chinese and other asian cuisines as well asin many supermarket items causes headaches what he does notmake reference to is the fact that the study was performed not onhumans but on rabbitsone of the researchers who conducted the study pharmacologistpatricia williams phd says it certainly is conceivable thata small minority of people are sensitive enough to msg to get headaches from it but she explains the show probably overemphasized the extent of the problema second lapse comes with mention of dr john olney a professorat the washington university school of medicine who mr bradleyremarks says that his years of research with laboratoryanimals shows msg is a hazard for developing youngsters becauseit poses a threat of irreversible brain damage dr olneysresearch with lab animals does not show anything about humanyoungstersin fact only under extreme circumsrtances did dr olneys experiments ever bring about any brain damage when he injectedextremely high doses of msg into rodents completely bypassing their digestive tracts and entering their bloodstreams more directlyand when he used tubes to forcefeed huge amounts of the substanceto very young animals on an empty stomach of course neitherof those procedures occurs with humans they simply take in msg with food and most of what they take in is broken down byenzymes in the wall of the small intestine so that very littlereaches the bloodstream much to little in fact for humanblood levels of msg to come anywhere near the high concentrationsfound in dr olneys lab animalsthe world health organization appears to be very much aware ofthat fact and so does the european communities scientificcommittee for foodboth after examining numerous studieshave concluded that msg is safetheir determination makes sense considering that msg has neverbeen proven to cause all the symptoms that have been attributedto it headaches swelling a tightness in the chest and aburning sensation among others in fact the most failsafeof clinical studies the doubleblind study has consistentlyexonerated the muchmaligned substancethats quite fortunate since the alleged hazardous component ofmonosodium glutamate glutamate enters our systems wheneverwe eat any food that contains protein the reason is that oneof the amino acids that make up protein glutamic acid is brokendown into glutamate during digestionits a breakdown that occurs frequently glutamic acid is themost abundant of the or so amino acids in the diet it makesup about percent of the protein in flesh foods percent inmilk percent in corn and percent in whole wheatthat doesnt mean its entirely unimaginable that a small numberof people have trouble metabolizing msg properly and are thereforesensitive to itthe consensus reached by large internationalprofessional organizations is that msg is safe the same consensusreached by the fda and the biomedical community at largerich young these are not kodaks opinionsfrom nealcmptrclonestarorg neal howardsubject re seek sedative informationin article cubrnfufigcitibcom ghicafigcitibcom renato ghica writeshas any one heard of a sedative called rhoepnol made by larouchei believe any info as to side effects or equivalent tranquillizersyou probably mean rohypnol a member of the benzodiazepine familychemical name is flunitrazepam it is such a strong tranquilizer that it isprobably best refered to as a hypnotic rather than a tranquilizer just onepill will knock you on your ass side effects may be similar to valium xanaxserax librium and other benzodiazepines neal howard xlh dod computrac inc richardson tx doh o nealcmptrclonestarorg std disclaimer my opinions are mine not computracs let us learn to dream gentlemen and then perhaps we shall learn the truth august kekule from brandoncaldonianlmnihgov brandon brylawskisubject re should i be angry at this doctormryanstsciedu writes am i justified in being pissed off at this doctor last saturday evening my year old son cut his finger badly with a knife i took him to a local urgent and general care clinic at pm the clinic was open till pm the receptionist went to the back and told the doctor that we were there and came back and told us the doctor would not see us because she had someplace to go at and did not want to be delayed here during the next few minutes in response to my questions with several trips to the back room the receptionist told me the doctor was doing paperwork in the back the doctor would not even look at his finger to advise us on going to the emergency room the doctor would not even speak to me she would not tell me the doctors name or her own name when asked who is in charge of the clinic she said i dont know i realize that a private clinic is not the same as an emergency room but i was quite angry at being turned away because the doctor did not want to be bothered my son did get three stitches at the emergency room speaking as a physician who works in an urgent care center the abovebehavior is completely inappropriate if a patient who requires extensivecare shows up at the last minute we always see them and give them appropriatecare it is reasonable for a clinic to refuse to see patients outside of itsposted hours but what you describe is misbehavior ask to speak to theclinic director and complain whatever their attitude they have nothing togain from angering patientsbrandon brylawskifrom uabdpodpouabedugila stephen hollandsubject re diet for crohns ibdin article rgfinneceticsuncedu jgecsuncedu john eyleswrote a friend has what is apparently a fairly minor case of crohns disease but she cant seem to eat certain foods such as fresh vegetables without discomfort and of course she wants to avoid a recurrence her question is are there any nutritionists who specialize in the problems of people with crohns disease i saw the suggestion of lipoxygnase inhibitors like tea and turmeric thanks in advance john eyles jgecsunceduif she is having problems with fresh vegetables the guess is that thereis some obstruction of the intestine without knowing more it is notpossible to say whether the obstruction is permanent due to scarringor temporary due to swelling of inflammed intestine in general there areno dietary limitations in patients with crohns except as they relateto obstruction there is no evidence that any foods will bring on recurrence of crohns it is important to distinguish recurrence fromrecurrent symptoms a physician would think of new inflammation as recurrence while pains from raw veggies just imply a narrowing of theintestine your friend should look into membership in the crohns and colitis foundation of america good luck to your friendsteve hollandfrom holfeltzlstcvmstortekcomsubject re krillean photographyin article aprunlvedutodamhypcharlesunlvedu brian m huey writes in article aprunlvedu todamhypcharlesunlvedu brian m huey writes i think thats the correct spellingthe proper spelling is kirlian it was an effect discoverd bys kirlian a soviet film developer in as i recall the coronas visible are ascribed to static dischargesand chemical reactions between the organic material and the silverhalides in the films tarl neustaedter stratus computer tarlswstratuscom marlboro massdisclaimer my employer is not responsible for my opinionsi think thats the correct spelling i am looking for any informationsupplies that will allowdoityourselfers to take krillean pictures im thinkingthat education suppliers for schools might have a appartus forsale but i dont know any of the companies any info is greatlyappreciated in case you dont know krillean photography to the best of myknowledge involves taking pictures of an most of the time organicobject between charged plates the picture will show energy patternsor spikes around the object photographed and depending on what typeof object it is the spikes or energy patterns will vary one mightextrapolate here and say that this proves that every object withinthe universe as we know it has its own energy signatureto construct a kirlian device find a copy of handbook of psychicdiscoveries by sheila ostrander and lynn schroeder library ofcongress it describes the necessary equipment and suppliers for the tesla coil or alternatives the copper plate andsetup i used a pack of sx film and removed a single pack in adark room then made the exposure put it back in the film pack andran it out through the rollers of the camera forinstant developingand very high quality it is a good way to experience what kirlianphotography is really and what it is not as you know all readyit is the pattern in the bioplasmic energy fieldthat is significantvariations caused by exposure time distance from the plate orpressure on the plate or variations in the photo materials are notimportant hard copy mail mark c high p o box parowan ut from banschbachvmsocomokstateedusubject candidayeast bloom fact or fictioni can not believe the way this thread on candidayeast has progressedsteve dyer and i have been exchanging words over the same topic in sci med nutrition when he displayed his typical reserve and attacked a women poster for being treated by a liscenced physician for a disease that did not exist calling this physician a quack was reprehensible steve and i see that you and some of the others are doing it here as well let me tell you who the quacks really are these are the physicans who have no idea how the human body interacts with its environment and how that balance can be altered by diet and antibiotics these are the physicians who dismiss their patients with difficult symptomatology and make them go from doctor to doctor to find relieflike elaine in sci med nutrition and then when they find one that solves their problem the rest start yelling quack could it just be professional jealousy i couldnt help elaine or jonbut somebody else did could they know more than me no way they must be a quack ive been teaching a human nutrition course for medical students for over ten years now and guess who the most receptive students are those that were raised on farms and saw firsthand the effect of diet on the health of their farm animals and those students who had made a dramatic diet change prior to entering medical schoolswitched to the vegan diet typically this is about of my class of students those not interested in nutrition either tune me out or just stop coming to class thats okay because i know that some of what im teaching is going to stick and there will be at least a few enlightened physicians practicing in the us its really too bad that most us medical schools dont cover nutrition because if they did candida would not be viewed as a nondisease by so many in the medical professionin animal husbandry an animal is reinnoculated with good bacteria after antibiotics are stopped medicine has decided that since humans do not have a ruminant stomach no such reinnoculation with good bacteria is needed after coming off a braod spectrum antibiotic humans have all kinds of different organisms living in the gi systemmouth stomach small and large intestine sinuses vagina and on the skin these are nonpathogenic because they do not cause disease in people unless the immune system is compromised they are also called nonpathogens because unlike the pathogenic organisms that cause human disease they do not produce toxins as they live out their merry existence in and on our body but any of these organisms will be considered pathogenic if it manages to take up residence within the body a poor mucus membrane barrier can let this happen and vitamin a is mainly responsible for setting up this barriersteve got real upset with elaines doctor because he was using antifungals and vitamin a for her gi problems if steve really understoood what vitamin a does in the body he would notor at least should not be calling elaines doctor a quackhere is a brief primer on yeast yeast infections as they are commonly called are not truely caused by yeasts the most common organism responsiblefor this type of infection is candida albicans or monilia which is actually a yeastlike fungus an infection caused by this organism is called candidiasiscandidiasis is a very rare occurance because like an e coli infection it requires that the host immune system be severly depressed candida is frequently found on the skin and all of the mucous membranes of normal healthy people and it rarely becomes a problem unless some predisposingfactor is present such as a high blood glucose leveldiabetes or an oral course of antibiotics has been used in diabetics their secretions contain much higher amounts of glucose candida unlike bacteria is very limited in its foodfuel selection without glucose it can not grow it just barely survives if it gets access to a lot of glucose it blooms and over rides the other organisms living with it in the sinuses gi tract or vagina in diabetics skin lesions can also foster a good bloom site for these little buggers the bloom is usually just a minor irritant in most people but some people do really develop a bad inflammatory process at the mucus membrane or skin bloom site whether this is an allergic like reaction to the candida or not isnt certain when the bloom is in the vagina or on the skin it can be easliy seen and some doctors do then try to treat itif its internal only symptoms can be used and these symptoms are pretty nondiscript candida is kept in check in most people by the normal bacterial flora in the sinuses the gi tractmouth stomach and intestines and in the vaginal tract which compete with it for food the human immune system ususally does not bother itself with thesenonpathogenic organisms unless they broach the mucus membrane barrier if they do an inflammatory response will be set up most americans are not getting enough vitamin a from their diets about of all americans die with less vitamin a than they were born withus autopsy studies while this low level of vitamin a does not cause pathologyblindness it does impair the mucus membrane barrier system this would then be a predisposing factor for a strong inflammatory response after a candida bloom while diabetics can suffer from a candida bloom the most common cause of this type of bloom is the use of broad spectrum antibiotics which knock down many different kinds of bacteria in the body and remove the main competition for candida as far as food is concerned while drugs are available to handle candida many patients find that their doctor will not use them unless there is evidence of a systemic infection the toxicity of the antifungal drugs does warrant some caution but if the gi or sinus inflammation is suspected to be candidaand recent use of a broad spectrum antibiotic is the smoking gun then antifungal use should be approrpriate just as the antifungal creams are an appropriate treatment for recurring vaginal yeast infections in spite of what mr steve dyer saysbut even in patients being given the antifungals the irritation caused by the excessive candida bloom in the sinus gi tract or the vagina tends to return after drug treatment is discontinued unless the underlying cause of the problem is addressedlack of a good bacterial flora in the body andor poor mucus membrane barrier lactobacillus acidophilus is the most effective therapy for candida overgrowth from its name it is an acid loving organism and it sets up an acidic condition were it grows candida can not grow very well in an acidic environment in the vagina l acidophilius is the predominate bacteriaunless you are hit with broad spectrum antibiotics in the gi system the anorectal region seems to be a particularly good reservoir for candida and the use of pantyhose by many women creates a very favorable environment around the rectum for transferthrough moisture and humidity of candida to the vaginal tract one of the most effctive ways to minimmize this transfer is to wear undyed cotton underwear if the bloom occurs in the anal area the burning swelling pain and even blood discharge make many patients think that they have hemorroids if the bloom manages to move further up the gi tract very diffuse symptomatology occursabdominal discomfort and blood in the stool this positive stool for occult blood is what sent elaine to her family doctor in the first place after extensive testing he told her that there was nothing wrong but her gut still hurt on to another doctor and so on richard kaplan has told me throiugh email that he considers occult blood tests in stool specimens to be a waste of time and money because of the very large number of false positivescandida blooms guys if my gut hurt me on a constant basis i would want it fixed yes its nice to know that i dont have colon cancer but what then is causing my distress when i finally find a doctor who treats me and gets me better steve dyer calls him a quackcandida prefers a slightly alkaline environment while bacteria tend to prefer a slightly acidic environment the vagina becomes alkaline during a womans period and this is often when candida blooms in the vagina vinegar and water douches are the best way of dealing with vaginal problems many women have also gotten relief from the introduction of lactobacillus directly into the vaginal tracti would want to be sure of the purity of the product before trying this my wife had this vagina problem after going on birth control pills and searched for over a year until she found a gynocologist who solved the problem rather than just writting scripts for antifungal creams this was a woman gynocologist who had had the same problemrecurring vaginal yeast infections this md did some digging and came up with an acetic acid and l acidophilis douche which she used in your office to keep it sterile after three treatments sex returned to our marraige i have often wondered what an md with chronic gi distress or sinus problems would do about the problem that he tells his patients is a nonexistent syndromethe nonpathogenic bacteria l acidophilus is an acid producing bacteria which is the most common bacteria found in the vaginal tract of healthy women if taken orally it can also become a major bacteria in the gut through aresol sprays it has also been used to innoculate the sinus membranesbut before this innoculation occurs the mucus membrane barrier system needs to be strengthened this is accomplished by vitamin a vitamin c and some of the bcomplex vitamins diet surveys repeatedly show that americans are not getting enough b and folate these are probably the segement of the population that will have the greatest problem with this nonexistent disordercandida blooms after antibiotic therapy some of the above material was obtained from natural healing by mark bricklin published by rodale press as well as notes from my human nutrition course i will be posting a discussion of vitamin a sometime in the future along with reference citings to point out the extremely important role that vitamin a plays in the mucus membrane defense system in the body and why vitamin a should be effective in dealing with candida blooms another effective dietary treatment is to restrict carbohydrate intake during the treatment phase this is especially important if the gi system is involved if candida can not get glucose its not going to out grow the bacteria and you then give bacteria which can use amino acids and fatty acids for energy a chance to take over and keep the candida in check once carbohydrate is returned to the gutif steve and some of the other naysayers want to jump all over this post fine i jumped all over steve in sci med nutrition because he verbably accosted a poster who was seeking advice about her doctors use of vitamin a and antifungals for a candida bloom in her gut people seeking advice from newsnet should not be treated this way those of us giving of our time and knowledge can slug it out to our hearts content if you saved your venom for me steve and left the helpless posters who are timidly seeking help alone i wouldnt have a problem with your behavior martin banschbach phdprofessor of biochemistry and chairmandepartment of biochemistry and microbiologyosu college of osteopathic medicine west th sttulsa ok without discourse there is no remembering without remembering there is no learning without learning there is only ignorancefrom egbucsusledu boutte erika gsubject m contagiosemi was wondering if anyone had any information about molluscous contagiosemi acquired it and fortunately got rid of it but the question still lingersin my mind where did it come from the little bit of info that i have received about it in the past states that it can be transmitted sexually butalso occurs in small children on the hands feet and genitaliaany information will be greatly appreciatedi grow old i grow oldi shall wear my trousers rolled t s eliotfrom sdrllnlgov dakotasubject re help for kidney stones in article aprwvnvmswvnetedu pkwvnvmswvnetedu writes my girlfriend is in pain from kidney stones she says that because she has no medical insurance she cannot get them removed my question is there any way she can treat them herself or at least mitigate their effects any help is deeply appreciated advice referral to literature etc thank you dave carvell pkwvnvmswvnetedufirst let me offer you my condolences ive had kidney stones times and i know the pain she is going through first it is best that she see a doctor however every time i had kidney stones i saw my doctor and theonly thing they did was to prescribe some pain killers and medication for aurinary tract infection the pain killers did nothing for mekidney stonesare extremely painful my stones were judged passable so we just waited itout however the last one took days to passnot fun anyway if sheabsolutely wont see a doctor i suggest drinking lots of fluids and perhapsan over the counter sleeping pill but i do highly suggest seeing a doctorkidney stones are not something to fool around with she should be xrayed to make sure there is not a serious problemstevefrom spenserfuddjscnasagov s spenser adensubject re diet for crohns ibdin article uabdpodpouabeduspamdomuabedu uabdpodpouabedugila stephen holland writesin article rgfinneceticsuncedu jgecsuncedu john eyleswrote a friend has what is apparently a fairly minor case of crohns disease but she cant seem to eat certain foods such as fresh vegetables without discomfort and of course she wants to avoid a recurrence her question is are there any nutritionists who specialize in the problems of people with crohns disease if she is having problems with fresh vegetables the guess is that thereis some obstruction of the intestine without knowing more it is notpossible to say whether the obstruction is permanent due to scarringor temporary due to swelling of inflammed intestine in general there areno dietary limitations in patients with crohns except as they relateto obstruction there is no evidence that any foods will bring on recurrence of crohns interesting statements simply because i have been told otherwise imcertainly not questioning steves claims as for one i am not a doctor and iagree that foods dont bring on the recurrence of crohns but inflammationcan be either mildly or drastically enhanced due to foodhaving had one major obstruction resulting in resection is that a good enoughcaveat i was told that a low residue diet is called for basicallythe idea is that if there is inflammation of the gut which may not berealized by the patient any residue in the system can be caught in the foldsof inflammation and constantly irritate thus exacerbating the problemtherefore anything that doesnt digest completely by the point of commoninflammation should be avoided with what ive been told is typical crohnsof the terminal ileum my diet should be low residue consisting ofcompletely out never again itemso corn kernel husk doesnt digest most of us know this o popcorn sameo dried dehydrated fruit and fruit skinso nuts very tough when it comes to giving up some fudge discouraged greatlyo raw vegetables too fibrouso wheat and raw grain breadso exotic lettuce iceberg is ok since its apparently mostly watero greens turnip mustard kale etco little seeds like sesame try getting an arbys without ito long grain and wild rice huskyo beans youll generate enough gas alone without themo basically anything that requires heavy digestive processingi was told that the more processed the food the better rather ironic in thisday and age the whole point is preventative you want to give yoursystem as little chance to inflame as possible i was told that among thenumerous things that were heavily discouraged i only listed a few to trythe ones i wanted and see how i felt if its bad dont do it againremember though that this was while i was in remission for veggies cook thedaylights out of them i prefer steaming i think its cooks morethoroughly youre mileage may varyas with anything else check with your doctor dont just take my word butthis is the info ive been given and it may be a starting point fordiscussion good luckspenser s spenser aden lockheed engineering and sciences co nasa flight data and evaluation office johnson space center houstonspenserfuddjscnasagov internet opinions herein are mine aloneadenvfjscnasagov if above bounces eschew obfuscation unknownfrom sastlsmvssascom tamara shaffersubject re seizures infantile spasms in article aprdbasednuodeccomdufaultlftfldenetdeccom md writes the reason im posting this article to this newsgroup is to gather any information about this disorder from anyone who might have recently been effected by it from being associated with it or actually having this disorder and help me find out where i can access any medical literature associated with seizures over the internet i tried to email you but it bounced back please email me andi will give you someones name who might be very helpful you mightalso post your message to misckidstamarasastlsmvssascomfrom euclidmrcnextcsouiucedu euclid ksubject re getting aids from acupuncture needlesmatthewsoswegoedu harry matthews writesi had electrical pulse nerve testing done a while back the needles were takenfrom a dirty drawer in an instrument cart and were most certainly notsterile or even clean for that matter more than likely they were freshfrom the previous patient i was concerned but i kept my mouth shut iprobably should have raised hellcould you describe in more detail the above procedure ive neverheard about itand yes if they pierced you with the needles you probably should haveprotested euclid euclid k standard disclaimers applyit is a bit ironic that we need the wave model of light to understand thepropagation of light only through that part of the system where it leaves notrace hudson nelson universityphysicsfrom taspegasuscom len howardsubject re foreskin troublesin article aprradfordvakededu mmatusevradfordvakededu melissa n matusevich writeswhat can be done short of circumcision for an adult malewhose foreskin will not retractmelissa there is a simpler procedure called a dorsal slit that isreally the first step of the usual circumcision it is simpler andquicker but the pain is about the same as circumcision after theanesthetic wears off and the aesthetic result post healing is not asgood see your friendly urologist for more details len howardfrom taspegasuscom len howardsubject re quality control in medicinein article uuicvmuicedu uuicvmuicedu writesdoes anybody know of any information regarding the implementaion of total quality management quality control quality assurance in the delivery of health care service i would appreciate any information if there is enoughinterest i will post the responses thank you abhin singla ms bioe mba md president ac medcomp incdr singla you might contact kaiser health plan either in the areaclosest to you or at the central office in oakland ca we have beendoing qa qos concurrent ur and tqm for some time now in the hawaiiregion and i suspect it is nationwide in the systemlen howard mdfrom tronfafnirlalocuscom michael trofimoffsubject request gyro souvlaki saucehi allwould anyone out there in netland happen to have anauthentic surefire way of making this great sauce thatis used to adorn gyros and souvlakithanks tron email tronlocuscomvidi vici venifrom akinscbnewsdcbattcom kayaakinssubject seizure information infanthere is the tollfree hotline for the epilepsy foundationof america efa they will be able to answeryour questions and send you information and references onseizure types medication etc they can also give you referencesfor a pediatric neorologist in your area also ask for the number of your local foundation who can put you in touch witha parent support group and social workersgood luckfrom korethspudhyperioncom steven grimmsubject re opinions on allergy hay fever shotsi had allergy shots for about four years starting as a sophomore in highschool before that i used to get bloody noses nighttime asthma attacksand eyes so itchy i couldnt get to sleep after about months on theshots most of those symptoms were gone and they havent come back istopped getting the shots due more to laziness than planning in collegemy allergies got a little worse after that but are still nowhere near asbad as they used to be so yes the shots do worksubject re arythmiafrom perryhuscharvardedu alexis perryin article aprvaxcstevenstechedu uaverbavaxcstevenstechedu writesdoctors said that he could die from it and the medication causedis it that serious my ekg often comes back with a few irregularbeats another question is a low blood potassium level very bad mydoctor seems concerned but she tends to worry too much in generalalexis perrythe less i want the more i getperryhuscharvardedu make me chaste but not just yeteliot house box its a promise or a lie ill repent before i diework have you lost your mind rensting nobody really admits to sharing my opinions last of all harvard collegefrom melewittcssandiagov martin e lewittsubject re altitude adjustmentin article mdavcrmdaca vidamdavcrmdaca vida morkunas writesi live at sealevel and am calledupon to travel to highaltitude citiesquite frequently on business the cities in question are at to feet of altitude one of them especially is very pollutedoften i feel faint the first two or three days i feel lightheaded andmy heart seems to pound a lot more than at sealevel also it is verydry in these cities so i will tend to drink a lot of water and keepaway from dehydrating drinks such as those containing caffeine or alcoholthing is i still have symptoms how can i ensure that my short trips thereno i dont usually have a week to acclimatize are as comfortable as possibleis there something else that i could doi saw a lifetime medical television show a few months back on travelmedicine it briefly mentioned some drugs which when started two orthree days before getting to altitude could assist in acclimitazationunfortunately all that i can recall is that the drug stimulatedbreathing at night i dont know if that makes sense it seemsto me that the new drug which stimulates red blood cell productionwould be a more logical approach erythropoiten spalas i didnt record the program but wish i had since i liveat over ft and my mother gets sick when visitingplease let me know if you get more informative responsesphone martin e lewitt my opinions aredomain lewittncubecom po box my own not mysandia melewittcssandiagov sandia park nm employers from robgcitruqozau rob geraghtysubject re good grief was re candida albicans what is itdyerspdcccom steve dyer writessnort ah there go my sinuses againoh wow a classic textbook hey they laughed at einstein tooyeah ill bet tomorrow the worldlisten uncontrolled studies like this are worthlessim sure you are you sound like the typical hysterichypochondriac whoresponds to miracle curesyeah it makes sense to me so of course it should be taken seriouslysnortyeah it sounds reasonable to meoh really what tests immunecompromised my assmore like credulous malingerer this is a psychiatric syndromeyou know its a shame that a drug like itraconazole is being misusedin this way its ridiculously expensive and potentially toxicthe trouble is that it isnt toxic enough so it gets abused by quacksthe only good thing about nystatin is that its relatively cheapand when taken orally nontoxic but oral nystatin is without anysystemic effect so unless it were given iv it would be withoutany effect on your sinuses i wish these quacks would first useiv nystatin or amphotericin b on people like you that would solvethe yeast problem once and for allperhaps a little haldol would go a long way towards amelioratingyour symptomsare you paying for this treatment out of your own pocket id hateto think my insurance premiums are going towards thissteve take a look at what you are saying i dont see one construvtiveword here if you dont have anything constructive to add why wastethe bandwidth yeah sure flame me for doing it myself is thisscimed or altflame like it or not medical science does not knowcategorically everything about everything im not flaming yourknowledge just asking you to sit back and ask yourself what ifminds are like parachutes they only function when they are openoh and if you do want to flame me or anyone else how about usingemailrobwho doesnt claim any relevant qualifications just interestrob geraghty things are important to me robgcitruqozau the gift of love the joy of lifecitr and the making of music in all its formsfrom petesmtldemoncouk pete phillipssubject nebulisers and particle sizehiwe are just completing a project on nebuliser performance and have awealth of data on particle size and output which we are going to useto adjudicate a contract next weekalthough the output data is easy for us to present there seems to belittle concensus on the optimum diameter of the nebulised droplets forstraightforward inhalation therapy eg for asthmaticssome say that the droplets must be smaller than microns whilstothers say that if they are too small they will not be effectiveanyone up on this topic who could summarise the current status cheerspete pete phillips deputy director surgical materials testing lab bridgend general hospital s wales petesmtldemoncouk the four horse oppressors of the apocalypse were nutritionaldeprivation state of belligerency widespread transmittable conditionand terminal inconvenience official politically correct dictionaryfrom banschbachvmsocomokstateedusubject re diet for crohns ibdin article rgfinneceticsuncedu jgecsuncedu john eyles writes a friend has what is apparently a fairly minor case of crohns disease but she cant seem to eat certain foods such as fresh vegetables without discomfort and of course she wants to avoid a recurrence her question is are there any nutritionists who specialize in the problems of people with crohns disease i saw the suggestion of lipoxygnase inhibitors like tea and turmeric thanks in advance john eylesall your friend really has to do is find a registered dieticianrd while most work in hospitals and clinics many major cities will have rds who are in private practice so to speak many physicans will refer their patients with crohns disease to rds for dietary help if you can get your friends physician to make a referral medical insurance should pay for the rds services just like the services of a physical therapist the better medical insurance plans will cover this but even if your friends plan doesnt it would be well worth the cost to get on a good diet to control the intestinal discomfort and help the intestinal lining healcrohns disease is an inflammatory disease of the intestinal lining and lipoxygenase inhibitors may help by decreasing leukotriene formation but im not aware of tea or turmeric containing lipoxygenase inhibitors for bad inflammation steroids are used but for a mild case the side effects are not worth the small benefit gained by steroid use upjohn is developing a new lipoxygenase inhibitor that should greatly help deal with inflammatory diseases but its not available yetmarty b from krishnasvaxoxfordacuksubject re help me injectthe best way of self injection is to use the right size needleand choose the correct spot for streptomycin usually given intramuscularly use a thin needle guage and select a spot onthe upper outer thigh no major nerves or blood vessels there clean the area with antiseptic before injection and after makesure to inject deeply a different kind of pain is felt when theneedle enters the muscle contrasted to the prick when it pierces the skinps try to go to a doctor selftreatment and selfinjection shouldbe avoided as far as possible from noringnetcomcom jon noringsubject great post was re candida yeast bloom very longgreat post martin very informative wellbalanced and humanitarianwithout neglecting the need for scientific rigorcrossposted to altpsychologypersonality since some personality typingwill be discussed at the beginning note ive set all followups to scimedsince most of my comments are more scimed oriented and im sure most of thereplies if any will be medrelatedin article banschbachvmsocomokstateedu writesi can not believe the way this thread on candidayeast has progressedsteve dyer and i have been exchanging words over the same topic in sci med nutrition when he displayed his typical reserve and attacked a woman poster for being treated by a licenced physician for a disease that did not exist calling this physician a quack was reprehensible steve and i see that you and some of the others are doing it here as well they are just responding in their natural way hypercholeric syndrome hcsoops that is not a recognized illness in the psychological communitybetter not say that since it therefore must not and never will exist actually it is fascinating that a disproportionate number of physicianswill type out as nt for those not familiar with the myersbriggs systemjust email me and ill send a summary file to you in the generalpopulation nts comprise only about of the population but amongphysicians it is much much higher i dont know the exact percentage any help here appersone driving characteristic of an nt especially an ntj is their obviouscholeric behavior driver type a etc the extreme emotional need tocontrol to lead andor to be the best or the most competent if they arealso extroverted they are best described as field marshalls this traitis very valuable and essential in our society we need people who want tolead to strive to overcome the elements to seek and thirst for knowledgeto raise the level of competency etc the great successes in science andtechnology are in large part due to the vision an n trait and scientificallyminded approach t trait of the nt personality of course the other typesand temperaments have their own positive contributions as well howeverwhen the nt person has selfimage challenges the darkside of thispersonality type usually comes out which should be obvious to alla physician who is a strong nt and who has not learned to temper theirtemperament will be extremely businesslike lack of empathy or feelingand is very compelled to have total control over their patient the patientmust be obedient to their diagnosis and prescription without question iveknown many mds of this temperament and suffice to say i dont oblige themwith a followup visit no matter how competent i think they are and theyusually are very competent from a knowledge viewpoint since that is anextreme drive of theirs to know the most to know it allmaybe we need more nf doctors enough on this subject lets move on to candida bloomlet me tell you who the quacks really are these are the physicans who have no idea how the human body interacts with its environment and how that balance can be altered by diet and antibiotics could it just beprofessional jealousy i couldnt help elaine or jon but somebody else didyouve helped me already by your post of course i believe that i havebeen misdiagnosed on the net as suffering from anal retentivitis but beingthe phlegmatic i am maybe i was just a little too harsh on a few peoplemyself in past posts lets all try to raise the level of this discussionabove the level of anal effluenthumans have all kinds of different organisms living in the gi system mouth stomach small and large intestine sinuses vagina and on the skin these are nonpathogenic because they do not cause disease in people unless the immune system is compromised they are also called nonpathogens because unlike the pathogenic organisms that cause human disease they do not produce toxins as they live out their merry existence in and on our body but any of these organisms will be considered pathogenic if it manages to take up residence within the body a poor mucus membrane barrier can let this happen and vitamin a is mainly responsible for setting up this barrierin my welldescribed situation in prior posts i definitely was immunestressed blood tests showed my vitamin a levels were very low my sinuseswere a mess no doubt the mucosal lining and the cilia were heavily damagedi also was on antibiotics times in years in the end even two weeksof ceftin did not work and i had confirmed diagnoses of a chronic bacterialinfection of the sinuses via catscans mucus color wont get into thedetails and other symptoms three very traditional ents made thisdiagnosis i did not have any cultures done however because of thedifficulty of doing this right and because my other symptoms clearly showeda bacterial infection enough of this background provided to help youunderstand where i was when i make comments about my sporanox antifungaltherapy belowthe first question i have is this can fungus penetrate a little way into poormucus membrane tissue maybe via hyphae thus causing symptoms without beingconsidered systemic in the classic sense it is sort of an inbetweeninfectionsteve got real upset with elaines doctor because he was using antifungals and vitamin a for her gi problems if steve really understoood what vitamin a does in the body he would notor at least should not be calling elaines doctor a quacki was concerned too because of the toxicity of vitamin a my doctor aftermy blood tests put me on iu of vitamin a for one week only thendropped it down to iu for the next couple of weeks i also receivedzinc and other supplementation since all of these interrelate in fairlycomplex ways as my doctor explained hes one of those evil orthomolecularspecialists i had a blood test three weeks later and vitamin a was normalhe then stopped me on all vitamin a except for some in a multivitaminsupplement and made sure that i maintain a iuday of beta carotenecall me carrot face hopefully elaines doctor will take a similar careful approach and toall supplements im even reevaluating some supplements im taking forexample niacin in fairly large dosages gramday which steve dyer hadgood information about on scimednutrition if niacin only has secondorderimprovement in symptomatic relief of my sinus allergies then it probably isnot worth taking such a large dose longterm and risking liver damagesurvives if it gets access to a lot of glucose it blooms and over rides the other organisms living with it in the sinuses gi tract or vagina in though i do now believe based on my successful therapy with sporanox thati definitely had some excessive growth of fungus unknown species in mysinuses i still want to ask the question have there been any studies thatdemonstrate candida blooms in the sinuses with associated sinus irritationsinusitisrhinitis my sinus irritation reduced significantly after oneweek of sporanox and no other new treatments were implemented during thistime i did not have any noticeable gi track problems before starting onsporanox but some for a few days after which then went away considerednormalbtw my doctor dug out one of his medical reference books sorry cantremember which one and found an obscure comment dating back into the swhich stated that people can develop contained nonlethal or nonseriousaspergillis infestations aspergiliosis of the sinuses leading to sinusinflammation symptoms ill have to dig out that reference again since itis relevant to this discussionsome people do really develop a bad inflammatory process at the mucus membrane or skin bloom site whether this is an allergic like reaction to the candida or not isnt certainmy doctor tested me i believe a rast or rast similar test for allergicresponse to specificially candida albicans and i showed a strong positiveanother question would everybody show the same strong positive so this testis essentially useless and assuming it is true that candida can growpartway into the mucus membrane tissue and the concentration exceeds a threshold amount could not a person who tests as having an allergy tocandida definitely develop allergic symptoms such as mucus membraneirritation due to the bodys allergic response as i said in an earlier postone does not need to be a rocket scientist or have a md degree or a phd in biochemistry to see the plausibility of this hypothesisbtw and ill repost this again dr ivker in his book sinus survivalhas routinely given before anything else nizoral a presporanox systemicantifungal not as safe and not as good as sporanox to his new chronicsinusitis patients if they have been on antibiotics four or more times inthe last two years he claims that out of or so patients well over notice some relief of sinus inflammation and other symptoms but itdoesnt cure it by any means implying the socalled yeastfungus infectionis not the primary cause but a later complication hes also found thatnystatin whether taken internally or put into a sinus spray does not helpthis implies of course assuming that excessive yeastfungus bloom isaggravating the sinus inflammation that the yeastfungus has grown partwayinto the tissue since nystatin will not kill yeastfungus other than bydirect contact it is not absorbed into the blood stream again i admitlots of ifs and implies which doesnt please the hardcore nt whohas to have the doubleblind study or its a nonissue but one has to startwith some plausible hypothesisexplanation a strawman if you willif its internal only symptoms can be used and these symptoms are pretty nondescript this brings up an interesting observation used by those who will denyand reject any and all aspects of the yeast hypothesis until theappropriate studies are done and that is if you cant observe or culturethe yeast bloom in the gut or sinus then theres no way to diagnose oreven recognize the disease and i know they realize that it is virtuallyimpossible to test for candida overbloom in any part of the body that cannotbe easily observed since candida is everywhere in the bodyits a real catchanother catch those who totally reject the yeast hypothesis say thatno studies have been done actually studies have been done but if its notup to a certain standard then it is from their perspective a nonstudy whichshould not even be considered i agree that the appropriate studies shouldbe done and that will take big to do it right however in order toconvince the funding agencies in these austere times to open their walletsyou literally have to give them evidence and the only acceptable evidence tocompete with other proposals is paradoxically to do almost the exact studyneeded funding that is you have to do of the study before you even getfunding as a scientist at a national lab im very aware of this for thesmaller funded projects im afraid that even if dr ivker and otherdoctors got together pooled their practices case histories and anecdotesinto a compelling picture and approach the funding agencies they would getnowhere even if they were able to publish their statistical resultsit is obvious from the comments by some of the doctors here is that they havedecided excessive yeast colonization in the gut or sinuses leading tonoticeable nonlethal symptoms does not exist and is not even a tenablehypothesis so any amount of case histories or compiled anecdotal evidenceto the contrary will never change their mind and not only that they wouldalso oppose the needed studies because in their minds its a done issue excessive yeast growth leading to diffuse allergic symptoms does not willnot and cannot exist period kind of tough to dialog with those who holdsuch a viewpoint kind of reminds me of listercandida is kept in check in most people by the normal bacterial flora in the sinuses the gi tractmouth stomach and intestines and in the vaginal tract which compete with it for food the human immune system ususally does not bother itself with thesenonpathogenic organisms unless they broach the mucus membrane barrier if they do an inflammatory response will be set up most americans are not getting enough vitamin a from their diets about of all americans die with less vitamin a than they were born withus autopsy studies while this low level of vitamin a does not cause pathologyblindness it does impair the mucus membrane barrier system this would then be a predisposing factor for a strong inflammatory response after a candida bloom arent there also other nutrients necessary to the proper working of thesinus mucus membranes and ciliawhile diabetics can suffer from a candida bloom the most common cause of this type of bloom is the use of broad spectrum antibiotics which knock down many different kinds of bacteria in the body and remove the main competition for candida as far as food is concerned while drugs are available to handle candida many patients find that their doctor will not use them unless there is evidence of a systemic infection the toxicity of the antifungal drugs does warrant some caution but if the gi or sinus inflammation is suspected to be candidaand recent use of a broad spectrum antibiotic is the smoking gun then antifungal use should be approrpriate just as the antifungal creams are an appropriate treatment for recurring vaginal yeast infections in spite of what mr steve dyer saysagain the evidence from mycological studies indicate that many yeastfungusspecies can grow hyphae roots into deep tissue similar to mold growingin bread you can continue to kill the surface such as nystatin does butyou cant kill that which is deeper in the tissue without using a systemicantifungal such as itraconazole sporanox or some of the older ones suchas nizoral which are more toxic and not as effective this is why as hasbeen pointed out by recent studies sent to me by a doctor ive been inemail contact with thanks that nystatin is not effective in the longterm treatment of gi tract candidiasis its like trying to weed a gardenby cutting off whats above the ground but leaving the roots ready to comeout again once you walk awaythe question is whether a contained candida bloom can partiallygrow into tissue through the mucus membranes causing some types of symptomsin susceptible people eg allergy without becoming systemic in theclassical sense of the word something in between strictly an excessivebloom not causing any problems and the fullblown systemic infection thatis potentially lethalin the gi system the anorectal region seems to be a particularly good reservoir for candida and the use of pantyhose by many women creates a very favorable environment around the rectum for transferthrough moisture and humidity of candida to the vaginal tract one of the most effctive ways to minimmize this transfer is to wear undyed cotton underwear also if one is an anal retentive like ive been diagnosed in a priorpost that can also provide more sites for excessive candida growth if the bloom occurs in the anal area the burning swelling pain and even blood discharge make many patients think that they have hemorroids if the bloom manages to move further up the gi tract very diffuse symptomatology occursabdominal discomfort and blood in the stool this positive stool for occult blood is what sent elaine to her family doctor in the first place after extensive testing he told her that there was nothing wrong but her gut still hurt on to another doctor and so on richard kaplan has told me throiugh email that he considers occult blood tests in stool specimens to be a waste of time and money because of the very large number of false positivescandida blooms guys if my gut hurt me on a constant basis i would want it fixed yes its nice to know that i dont have colon cancer but what then is causing my distress when i finally find a doctor who treats me and gets me better steve dyer calls him a quackas ive said in private email there are flaws in our current medical systemthat make it difficult or even impossible for a physician to attemptalternative therapies after the approvedprovenaccepted therapies dont workfor example i went to three ents who all said that i will just have to livewith my acutechronic sinusitis after the abs failed they did mentionsurgery to open up the ostia but my ostia werent plugged and it would notget to the root cause of my condition after three months of aggressive andfairly nonstandard therapy sporanox body nutrient level monitoring andequalization vitamin c lentinen echinacea etc my health has vastlyimproved to where i was two years ago before my health greatly deterioratedof course skeptics would say that maybe if i did nothing i would haveimproved anyway but that view is stretching things quite far because of theexperience of the three ents i saw who said that id just have to live withit im confident i will reach what one could call a total cure theantifungal program i undertook was one necessary step in that directionbecause of my overuse of abs for the last four years note for thosehaving sinus problems may i suggest the book by dr ivker i mention abovebe sure to get the revised editioni have often wondered what an md with chronic gi distress or sinus problems would do about the problem that he tells his patients is a nonexistent syndromedr ivker started off having chronic and severe sinus problems and hisvisits to several ents totally floored him when they said youll just haveto live with it he spent several years trying everything standard andnonstandard until he was essentially cured of chronic sinusitis he nowshares his approach in his book and i can honestly say that i am on the roadto recovery following some parts of it his one recommendation to take asystemic antifungal at the beginning of treatment if you have a history ofantibiotic overuse has been proven to him time and time again in his ownpractice im sure if i commented to him of the hardcore beliefs of the antiyeast hypothesis posters that he would have definite things to say such asits worked wonders for me in almost two thousand cases to put it mildlyi also would not be surprised if he would say that they are the ones violatingtheir moral obligations to help the patientmaybe those doctors who are reading this who have a practice and areconfronted by a patient having symptoms that could be due to the hypotheticalyeast overgrowth eg they fit some of the profiles the proyeast peoplehave identified should consider antifungal therapy if all other avenueshave been exhausted remember theory and practice are two different things you cannot have one without the other they are synergistic if a doctor doessomething nonstandard yet produces noticeable symptomatic relief in over athousand of his patients shouldnt you at least sit up and take noticemaybe you ought to trust what he says and begin hypothesizing why it worksinstead of why it shouldnt work im afraid a lot of doctors have becomeso enamored with scientific correctness that they are ignoring the patientsthey have sworn to help you have to do both both have to be balanced whichwe dont see from some of the posters to this group there comes a point whenyou just have to use a little common sense and maybe an empirical approachsuch as trying a good systemic antifungal such as sporanox after havingexhausted all the other avenues i was one of those who the traditionalmedical establishment was not able to help so i did the natural thing iwent to a couple of doctors who are somewhat outside this establishmentand as a result i have found significant reliefwould it not be better if the traditional medical establishment can set upsome kind of mechanism where any doctor without fear of being sued or havinghis license pulled can try experimental and unproven beyond a doubttherapies for hisher patients that finally reach the point where all theaccepted therapies are ineffective id like to hear a doctor tell mewell ive tried all the therapies that are approved and accepted in thiscountry and since they clearly dont work for you i now have the authorityto use experimental unproven techniques that seem to have helped others icant promise anything and there are some risks you will have to signsomething saying you understand the experimental and possibly risky nature ofthese unproven therapies and ill have to register your case at the stateboard anyway if my ent had suggested this to me i wouldve jumped on thispronto instead of going to one of those doctors who for either altruisticreasons or for greed is practicing these alternative therapies with muchrisk to himher risk meaning losing their license and possibly to thepatient such a mechanism would keep control in the more mainstream medicineand also provide valuable data that would essentially be free it also wouldbe morally and ethically better than the current system by showing thecompassion of the medical community to the patient that its doing everythingit can within reason to help the patient it is the lack of such a mechanismthat is leading large numbers of people to try alternative therapies some ofwhich seem to work like my case and others of which will never work at alltrue quackeryi better get off my soapbox before this post reaches k in sizeif taken orally it can also become a major bacteria in the gut through aresol sprays it has also been used to innoculate the sinus membranesbut before this innoculation occurs the mucus membrane barrier system needs to be strengthened this is accomplished by vitamin a vitamin c and some of the bcomplex vitamins diet surveys repeatedly show that americans are not getting enough b and folate these are probably the segement of the population that will have the greatest problem with this nonexistent disordercandida blooms after antibiotic therapywhat dosage of b appears to be necessary to promote the healing and properworking of the mucos memebranessome of the above material was obtained from natural healing by mark bricklin published by rodale press as well as notes from my human nutrition course i will be posting a discussion of vitamin a sometime in the future along with reference citings to point out the extremely important role that vitamin a plays in the mucus membrane defense system in the body and why vitamin a should be effective in dealing with candida blooms another effective dietary treatment is to restrict carbohydrate intake during the treatment phase this is especially important if the gi system is involved if candida can not get glucose its not going to out grow the bacteria and you then give bacteria which can use amino acids and fatty acids for energy a chance to take over and keep the candida in check once carbohydrate is returned to the gutid like to see the role of complex carbohydrates such as starchif steve and some of the other naysayers want to jump all over this post fine i jumped all over steve in sci med nutrition because he verbably accosted a poster who was seeking advice about her doctors use of vitamin a and antifungals for a candida bloom in her gut people seeking advice from newsnet should not be treated this way those of us giving of our time and knowledge can slug it out to our hearts content if you saved your venom for me steve and left the helpless posters who are timidly seeking help alone i wouldnt have a problem with your behavior brave soul you are the venom on usenet can be quite toxic unless onedevelops an immunity to it one year ago my phlegmatic self would havebacked down right away from an attack of cholericitis but my immunesystem and my computer system have been hardened from gradualdesensitization i now kind of like being called anal retentive it hasa nice ring to it i also was very impressed by how it just flowed into thepost truly classic worthy of a blue or maybe brown ribbon i mighteven crosspost it to altbestofinternet hmmmmartin banschbach phdprofessor of biochemistry and chairmandepartment of biochemistry and microbiologyosu college of osteopathic medicinethanks again for a great and informative post i hope others who haveresearched this area and are lurking in the background will post theirthoughts as well no matter their views on this subjectjon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom dpcuxacsouiucedu daniel paul checkmansubject re is msg sensitivity superstitionbrucedataiocom bruce reynolds writesanecedotal evidence is worthless even doctors who have been using a drugor treatment for years and who swear it is effective are often suprisedat the results of clinical trials whether or not msg causes describablereportable documentable symptoms should be pretty simple to discover i tend to disagree i think anecdotal evidence provided there is a lot of itand it is fairly consistent will is very important first it points to thenecessity of doing a study and second it at least says that the effects areall psychological or possibly allergy in this case as ive pointed out before pyschological effects are no less real than other effects one persons makebelieve can easily be another persons reality using psychadelic drugs in a bizarre and twisted example the hallucinations oneperson experiences on an acid trip cannot be guaranteed to another person onan acid trip there is no clinical evidence that those effects are always goingto happen anyhow that was a pretty lame example but hopefully i made mypoint its all a matter of perception and as long as someone ingesting msgperceives it as causing bad effects then she can definitely experience thoseaffects on the other hand it could just be an allergy to the food its in or something still anecdotal evidence is not worthless its the stuff thatleads to the study being donedanfrom eulenbrgcarsonuwashingtonedu julia eulenbergsubject re arythmiaalexis perry asked if low blood potassium could be dangerous yeszzfrom hahncsdcsduwmedu david james hahnsubject re re help me injectfrom article aprvaxoxfordacuk by krishnasvaxoxfordacuk the best way of self injection is to use the right size needle and choose the correct spot for streptomycin usually given intra muscularly use a thin needle guage and select a spot on the upper outer thigh no major nerves or blood vessels there clean the area with antiseptic before injection and after make sure to inject deeply a different kind of pain is felt when the needle enters the muscle contrasted to the prick when it pierces the skin ps try to go to a doctor selftreatment and selfinjection should be avoided as far as possible the areas that are least likely to hurt are where you have a little fat i inject on my legs and gut and prefer the gut i can stickit in at a degree angle and barely feel it im not fat justhave a little gut my legs however are muscular and i have to pinchto get anything and then i inject at about a degree angleand itstill hurts the rate of absorbtion differs for subcutaneous and muscular injections howeverso if its a daily thing it would bebest not to switch places every day to keep consistencey althoughsome suggest switch legs or sides of the stomach for each shot to prevent irritation when you clean the spot off with an alcohol prep wait for it to dry somewhat or you may get the alcohol in thepuncture and of course that doesnt feel good a way to preventirratation is to mark the spot that you injected a good way todo this is use a little round bandage and put it over the spot this helps prevent you from injecting in the same spotand spacing the sites out accuartely about apartthis is from experience so i hope itll help you i havediabetes and have to take an injection every morninglaterdavid david hahnuniversity of wisconsin milwaukee hahncsdcsduwmedufrom mcovingtaisunaiugaedu michael covingtonsubject re foodrelated seizuresin article cuqblrjtoadspghpaus gebcspittedu gordon banks writesin article buedu dozonoffbuedu david ozonoff writesmany of these cereals are cornbased after your post i looked in theliterature and located two articles that implicated corn containstryptophan and seizures the idea is that corn in the diet mightpotentiate an already existing or latent seizure disorder not cause itcheck to see if the two kellog cereals are corn based id be interestedyears ago when i was an intern an obese young woman was brought intothe er comatose after having been reported to have grand mal seizureswhy attending a corn festival we pumped her stomach and obtainedwhat seemed like a couple of liters of corn much of it intact kernals after a few hours she woke up and was fine i was tempted to sign her out asacute corn intoxicationgordon banks njxp skepticism is the chastity of the intellect andhow about contaminants on the corn eg aflatoxin michael a covington associate research scientist artificial intelligence programs mcovingtaiugaedu the university of georgia phone athens georgia usa amateur radio ntmi from cafomenuucp chuck forsberg wakgxsubject re my new diet it works great in article cwcgegtoadspghpaus gebcspittedu gordon banks writesin article apromenuucp cafomenuucp chuck forsberg wakgx writescan you provide a reference to substantiate that gaining backthe lost weight does not constitute weight rebound until itexceeds the starting weight or is this oral tradition thatis shared only among you obesity researchersannals of ny acad sci hmmm these dont look like references to me is passiveaggressivebehavior associated with weight rebound i purposefully left off the page numbers to encourage the reader tostudy the volumes mentioned and benefit therefromgood story chuck but it wont wash i have read the ny acad scione and have it this am i couldnt find any reference toweight rebound im not saying it isnt there but since youcited it it is your responsibility to show me where it is in therethere is no index i suspect you overstepped your knowledge baseas usualgordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon its on page about inches up from the bottom and an inch infrom the rightat least we know what some people havent read and remembered chuck forsberg wakgx tektronixreedomencaf author of ymodem zmodem professionalyam zcomm and dsz omen technology inc the high reliability softwarev nw sauvie is rd portland or from heartaccessdigexcom gsubject cholistasisspfatfree dietpregnancyhiive just returned from a visit with my obgyn and i have a few concerns that maybe yall can help me with ive been seeing her every weeks for the past few months im at week and during the last visits ive gained to pounds every weeks she said this was unacceptable over any week period as it stands ive thus far gained pounds also she says that though im at weeks the babys size is weeks i think she mentioned inches for the top of the fundus when i was weeks the babys size was weeks i must also add that i had an operation a few years ago for endometriosis and ive had no problems with endometriosis but apparently it is causing me pain in my pelvic region during the pregnancy and i have a very difficult time moving and the doc has recommended i not walk or move unless i have to i have a little handicapped sticker for when i do need to go out anyway thats of the situation the other is that almost from the beginning of pregnancy i was getting sick throwing up about times a day and mostly it was bile that was being eliminated i told her about this i know this because i wasnt eating very much due to the nausea and could see the results well now i only get sick about once every weeks and it is still bile related but in addition i had begun to feel movement near my upper right abdomen just below the right breast usually when i was lying on my right side it began to get worse though because it started to hurt when i lay on my right side and then it hurt no matter what position i was in next i noticed that when i ate greasy or fatty foods i felt like my entire abdomen had turned to stone and the pain in the area got worse however if i ate sauerkraut or vinegar or something to cut the fat it wasnt as much of a problemso the doctor says i have cholistatis and that i should avoid fatty foods this makes sense and because i was already aware of what seemed to me this cause and effect relationship i have been avoiding these foods on my own but im still able to eat foods with ricotta cheese for instance and other low fat foods but doc wants me to be on a nonfat diet this means no meat except fish and chicken wo skin i do this anyway no nuts fried food cheese etc i am allowed skim milk she said i should avoid anything sweet eg bananas also i must only have one serving of something high in carbohydrates a day potatoes pasta rice she said i cant even cook vegetables in a little bit of oil and that i should eat vegetables raw or steamed im concerned because i understand you need to have some fat in your diet to help in the digestive process and if im not taking in fat is she expecting the baby will take it from my stores and why this restriction on carbohydrates if shes concerned about fat im not clear how much of her recommendation is based on my weight gain and how much on cholistatis which i cant seem to find any information on she originally said that i should only gain pounds during the entire pregnancy since i was about lbs overweight when i started but my sister gained lbs during her pregnancy and shes taken it all off and hasnt had any problems she also asked if any members of my family were obese which none of them are anyway i think she is overly concerned about weight gain and feel like im being punished by a severe diet she did want to see me again in one week so i think she the diet may be temporary for that one week what i want to know is how reasonable is this nonfat diet i would understand if she had said lowfat diet since im trying that anyway even if she said really lowfat diet i think she assumes i must be eating a highfat diet but really it is that because of the endometriosis and the operation im not able to use the energy from the food i do eat any opinions info and experiences will be appreciated im truly going stark raving mad trying to meet this new strict diet because fruits and vegetables go through my system in a few minutes and ill end up having to eat constantly thus far i dont find any foods satisfyingthanks gfrom bbenowittelesciencescom barry d benowitzsubject prk photo refractive keratostomyfor those of you interested in the above procedure i am able to add thefollowing facts this procedure is not done in philadelphia it is performed in maryland at johns hopkins for corrections between and and from to diopters i think are the units it is performed in new york city at manhattan eye and ear for corrections between and the magic words to use when requesting information on this is not prk theythink you mean rk but the excimer laser study or protocol this will get you to the proper people barry d benowitzemailbbenowittelesciencescom pyrnjtelescibbenowitphone xsnailtelesciences co systems new albany rd moorestown nj from etxmowgarboericssonse mats winbergsubject re help for kidney stones isnt there a relatively new treatment for kidney stones involving a noninvasive use of ultrasound where the patient is lowered into some sort of liquid when heshe undergoes treatment im sure ive read about it somewhere if i remember it correctly it is a painless and effective treatment a couple of weeks ago i visited a hospital here in stockholm and saw big signs showing the way to the kidney stone chrusher mats winberg stockholm sweden from skepkmabse kristoffer erikssonsubject re science and methodology was homeopathy traditionin article quqlginnqimucsutexasedu turpincsutexasedu russell turpin writes my definition is this science is the investigation of the empiricalthat avoids mistakes in reasoning and methodology discovered from previousworkreading this definition i wonder when should you recognize somethingas being a mistake it seems to me that proponents of pseudosciencesmight have their own ideas of what constitutes a mistake and whichdiscoveries of such previous mistakes they accept kristoffer eriksson peridot konsult ab stallgatan s oerebro swedenphone email skepkmabsefax or mailswipnetkullmarpkmabskefrom billscorchapanaorgau bill dowdingsubject re krillean photographytodamhypcharlesunlvedu brian m huey writesi think thats the correct spellingi am looking for any informationsupplies that will allowdoityourselfers to take krillean pictures im thinkingthat education suppliers for schools might have a appartus forsale but i dont know any of the companies any info is greatlyappreciatedkrillean photography involves taking pictures of minute decapods resident in the seas surrounding the antarctic or pictures taken by them perhapsbill from ozfrom donald mackie donaldmackiemedumichedusubject re request gyro souvlaki saucein article aprlocuscom michael trofimofftronfafnirlalocuscom writeswould anyone out there in netland happen to have anauthentic surefire way of making this great sauce thatis used to adorn gyros and souvlakiim not sure of the exact recipe but im sure acidophilus is one ofthe major ingredients don mackie his opinionsum anesthesiology will disavowfrom sjhacscmuedu somesh jhasubject what is intersection syndrome near the forearmwristhii went to the orthopedist on tuesday he diagnosed me as havingintersection syndrome he prescribed feldene for me i wantto know more about the disease and the drugthankssomeshfrom choueiryliasunepflch berthe y choueirysubject french to english translation of medical termsdear nettersi am not sure whether this is the right place to post my query but ithought there may be some bilingual physicians in this newsgroup thatcould help please excuse me for overloading the bandwidthi am trying to build a resource allocation program for managing asurgical operating unit in a hospital the user interface is inenglish however the terms of medical specialties i was given are infrench i have no medical dictionary handy mine is a technicaluniversity i need to get the translation into english when there is one of thefollowing words they refer to medical categories of operating roomstheaters i admit they may not be universally used sceptique orl brulurebrule neonatal prenatal premature neurochirurgie neurosurgery chirurgie generale chirurgie plastique urologie urologythank you for you helpcheersberthe y choueirychoueiryliadiepflchliadi ecole polytechnique federale de lausanne ecublensch lausanne switzerlandvoice and fax ps please reply by email if possible since i scan too quicklythrough the messages of this newsgroupfrom jgddixiecom john de armondsubject re do we need a radiologist to read an ultrasoundej draper draperodinmdauthtmcedu writesif it were my wife i would insist that a radiologist be involved in theprocess radiologist are intensively trained in the process ofinterpreting diagnostic imaging data and are aware of many things thatother physicians arent aware of maybe maybe not a new graduate would obviously be well trained butperhaps without sufficient experience a radiologist trained or years ago who has not kept his continuing education current is a whole nuther matter a ob who has trained in modern radiology technologyis certainly more qualified than the latter and at least equal to the formerwould you want a radiologist todeliver your baby if you wouldnt then why would you want a obgyn toread your ultrasound studyif the radiologist is also trained in obgyn why notjohn john de armond wdoqc interested in high performance mobility performance engineering magazinetm interested in high tech and computers marietta ga send ur snailmail address to jgddixiecom performdixiecom for a free sample maglee harvey oswald where are ya when we need yafrom mmatusevradfordvakededu melissa n matusevichsubject re help me injectaccording to a previous poster one should seek a doctorsassistance for injections but what about sumatriptin spdoesnt one have to inject oneself immediately upon the onsetof a migrainefrom backonvmshujiacilsubject re diet for crohns ibdin article aprvmsocomokstateedu banschbachvmsocomokstateedu writes in article rgfinneceticsuncedu jgecsuncedu john eyles writes a friend has what is apparently a fairly minor case of crohns disease but she cant seem to eat certain foods such as fresh vegetables without discomfort and of course she wants to avoid a recurrence her question is are there any nutritionists who specialize in the problems of people with crohns disease i saw the suggestion of lipoxygnase inhibitors like tea and turmeric thanks in advance john eyles all your friend really has to do is find a registered dieticianrd while most work in hospitals and clinics many major cities will have rds who are in private practice so to speak many physicans will refer their patients with crohns disease to rds for dietary help if you can get your friends physician to make a referral medical insurance should pay for the rds services just like the services of a physical therapist the better medical insurance plans will cover this but even if your friends plan doesnt it would be well worth the cost to get on a good diet to control the intestinal discomfort and help the intestinal lining heal crohns disease is an inflammatory disease of the intestinal lining and lipoxygenase inhibitors may help by decreasing leukotriene formation but im not aware of tea or turmeric containing lipoxygenase inhibitors forif you do a medline search on turmeric youll see that it is a potentlipoxygenase inhibitor which is being investigated in a number of areasim in cardiology and about years ago the cardiothoracic surgery lab at myhospital compared the effect of a teaspoon of dissolved turmeric vs a bolus of tpa in preventing myocardial reperfusion injury in a perfusedlangendorff sheep heart the turmeric was more effective a colleague of mine in the school of pharmacy dr ron kohen has a paper inpress on the free radical scavenging activity and antioxidant activity of teajoshbackonvmshujiacil bad inflammation steroids are used but for a mild case the side effects are not worth the small benefit gained by steroid use upjohn is developing a new lipoxygenase inhibitor that should greatly help deal with inflammatory diseases but its not available yet marty bfrom mhollowaicsunysbedu michael hollowaysubject re wanted rat cell line adrenal glandcortical cin article roosoperonihelsinkifi roosoperonihelsinkifi christophe roos writesi am looking for a rat cell line of adrenal gland cortical cell type i have been looking at atcc without success and would very much appreciate any helpi shot off a response to this last night that ive tried to cancel it was only a few minutes later while driving home that i remembered that your message does specifically say cortical my first reaction had been to suggestthe pc pheochromocytoma line that may still be a good compromise dependingon what youre doing have you concidered using a mouse cell line from one of the sv t antigen transgenic lines another alternative might be primarycells from bovine adrenal cortex mikefrom jkjecwestminsteracuk shazad barlassubject need help on scaring pleasehii need information on scaring particularly as a result of grazing the skini really wanted to know of would a scar occur as a result of grazing if yes then would it disappear how long does a graze take to heal will hair grow on it once it has healed what is scar tissue should antiseptic cream be applied to it regularly is it better to keep it exposed and let fresh air at itplease help any info no matter how small will be appreciated greatly but please email me directly because i dont read this newsgroup often thisis my first time shazfrom uabdpodpouabedugila stephen hollandsubject re diet for crohns ibdsummary of threada person has crohns raw vegetables cause problems unspecifiedsteve holland replies patient may have mild obstruction avoid thingsthat would plug her up crohns has no dietary restriction in generalin article apraiojscnasagovspenserfuddjscnasagov s spenser aden wrote interesting statements simply because i have been told otherwise im certainly not questioning steves claims as for one i am not a doctor and i agree that foods dont bring on the recurrence of crohns but inflammation can be either mildly or drastically enhanced due to foodthe feeling obout this has changed in the gi community the currentfeelingis that inflammation is not induced by food there is even evidence thatpatients deprived of food have mucosal atrophy due to lack of stimulationofintestinal growth factors there is now interest in providing smallamountsof nasogastric feeding to patients on iv nutrition but i digress symptoms can be drastically enhanced by food but not inflammation having had one major obstruction resulting in resection is that a good enough caveat i was told that a low residue diet is called for basically the idea is that if there is inflammation of the gut which may not be realized by the patient any residue in the system can be caught in the folds of inflammation and constantly irritate thus exacerbating the problem therefore anything that doesnt digest completely by the point of common inflammation should be avoided with what ive been told is typical crohns of the terminal ileum my diet should be low residue consisting of completely out never again items o corn kernel husk doesnt digest most of us know this o popcorn same o dried dehydrated fruit and fruit skins o nuts very tough when it comes to giving up some fudge the low residue diet is appropriate for you if you still have obstructionsagain it is not felt that food causes inflammation these foods areavoided because they may get stuck id go ahead and have thefudge though discouraged greatly o raw vegetables too fibrous o wheat and raw grain breads o exotic lettuce iceberg is ok since its apparently mostly water o greens turnip mustard kale etc o little seeds like sesame try getting an arbys without it o long grain and wild rice husky o beans youll generate enough gas alone without them o basically anything that requires heavy digestive processing i was told that the more processed the food the better rather ironic in this day and age the whole point is preventative you want to give your system as little chance to inflame as possible i was told that among the numerous things that were heavily discouraged i only listed a few to try the ones i wanted and see how i felt if its bad dont do it again remember though that this was while i was in remission for veggies cook the daylights out of them i prefer steaming i think its cooks more thoroughly youre mileage may vary as with anything else check with your doctor dont just take my word but this is the info ive been given and it may be a starting point for discussion good luck spencer makes an especially good point in having an observant andinformed patient would that many patients be able to tell whatcauses them problems the digestive processing idea is changing butif a food causes problems avoid them be sure that the foods are tested a second time to be sure the food is a real cause crohnscommonly causes intermittent symptoms and some patients end up withseverly restricted diets that take months to renormalizethere was a good article in the ccfa newsletter recently that discussedthe issue of dietary restriction of fiber it would be worth readingto anyone with an interest in crohnsand as i always say when dealing with crohns as does spencer good lucksteve hollandfrom uabdpodpouabedugila stephen hollandsubject re diet for crohns ibdin article aprvmsocomokstateedubanschbachvmsocomokstateedu wrote in article rgfinneceticsuncedu jgecsuncedu john eyles writes a friend has what is apparently a fairly minor case of crohns disease but she cant seem to eat certain foods such as fresh vegetables without discomfort and of course she wants to avoid a recurrence her question is are there any nutritionists who specialize in the problems of people with crohns disease i saw the suggestion of lipoxygnase inhibitors like tea and turmeric thanks in advance john eyles all your friend really has to do is find a registered dieticianrd while most work in hospitals and clinics many major cities will have rds who are in private practice so to speak many physicans will refer their patients with crohns disease to rds for dietary help if you can get your friends physician to make a referral medical insurance should pay for the rds services just like the services of a physical therapist the better medical insurance plans will cover this but even if your friends plan doesnt it would be well worth the cost to get on a good diet to control the intestinal discomfort and help the intestinal lining heal crohns disease is an inflammatory disease of the intestinal lining and lipoxygenase inhibitors may help by decreasing leukotriene formation but im not aware of tea or turmeric containing lipoxygenase inhibitors for bad inflammation steroids are used but for a mild case the side effects are not worth the small benefit gained by steroid use upjohn is developing a new lipoxygenase inhibitor that should greatly help deal with inflammatory diseases but its not available yet marty b be sure a dietician is up to date on crohns and ulcerative colitis previously low residue diets were recommended but this advice hasnow changed also there will be differences in advice in patients withand without obstructuon remaining so input by the physician will be important i find the dietician very important in my practice and i send most of my patients to a dietician in the course of seeingthem since dieticians know so much better how to get diet historiesand evaluate the contents of a diet than i dosteve hollandfrom jagampexcom rayaz jaganisubject re homeopathy a respectable medical traditionin article pittuucp gebcspittedu gordon banks writesin article nlsunoraclenl rgaschnloraclecom robert gasch writesin many european countries homepathy is accepted as a method of curingor at least alleiating many conditions to which modern medicine has no answer in most of these countries insurance pays for the treatmentsaccepted by whom not by scientists there are peoplein every country who waste time and money on quackeryin britain and scandanavia where i have worked it was not paid forwhat are most of these countries i dont believe youwhen were you in britain my information is differentfrom miranda castro the complete homeopathy handbookisbn oringinally published in britain in from page and in when the national health service was establishedhomeopathy was included as an officially approved methodof treatmentfrom tonynexusyorkuca anthony wallissubject choleric and the great ntnf semantic warcrossposted from altpsychologypersonality since it talks about physicians personalities apologies to scimed readers not familiar with the myersbriggs ntnf personality terms but in a word or two the nts intuitivethinkers are approximately your philosophysciencetech pragmatic types and the nfs intuitivefeelers are your humanitiessocialsciencetheology idealistic types they hate each others guts but tend to intermarry the letter j is a reference to conscienciousnessdecisivenessjon noring emits typical nftype stuff physicians are just responding in their natural way hypercholeric syndrome hcs it is fascinating that a disproportionate number of physicians will type out as nt one driving characteristic of an nt especially an ntj is their obvious choleric behavior driver type a etc the extreme emotional need to control to lead andor to be the best or the most competent please get it right jonthis ntj has a strong desire to correct semantic mistakes because the nfs of this world are fouling the oncepristine nt intellectual nest with their verbal poopthe dominant correlation is nt phlegmatic and not nt cholericone of the semantic roots of choleric is the idea of hot emotionaland one of the semantic roots of phlegmatic is cold unemotionalhere is a thumbnail sketch taken from hans eysenck refering to wundtrelating the ancient greek quadratic typology with modern terms emotional melancholic choleric thoughtful suspicious quicklyaroused hotheaded unhappy worried egocentric histrionic anxious exhibitonist serious active unchangeable changeable calm playful reasonable carefree steadfast persistent hopeful sociable highlyprincipled controlled controlled easygoing phlegmatic sanguine v nonemotionali suspect that your characterisation of nts as choleric is whatyou psychtypes call a projection of your own nfness onto us maybe we need more nf doctors perhaps in serious pediatics and my little boys got a runnynose doctor general practice but please god not in neurologyopthamology urology etc etc and nfpsychiatry should seperatefrom ntie real psychiatry and be given a new name something like channeling tonynexusyorkuca tony wallis york university toronto canadafrom noringnetcomcom jon noringsubject re is msg sensitivity superstitionin article dpcuxacsouiucedu daniel paul checkman writesbrucedataiocom bruce reynolds writesanecedotal evidence is worthless even doctors who have been using a drugor treatment for years and who swear it is effective are often suprisedat the results of clinical trials whether or not msg causes describablereportable documentable symptoms should be pretty simple to discover but it is quite a leap in logic to observe one situation where anecdotalevidence led nowhere and therefore conclude that anecdotal evidence willnever lead anywhere im sure somebody here can provide an example whereanecdotal evidence and the interpretation of it was upheldverified byfollowon rigorous clinical trialsi tend to disagree i think anecdotal evidence provided there is a lot of itand it is fairly consistent will is very important first it points to thenecessity of doing a study and second it at least says that the effects areall psychological or possibly allergy in this case as ive pointed out persons makebelieve can easily be another persons realitygood point there has been a tendency by some on this newsgroup to circlethe wagons to the viewpoint that anecdotal medical evidence is worthlessmaybe to counter the claims of those who are presenting anecdotal evidenceto support controversial subjects such as the yeast hypothesis butevidence is evidence it requires a jury or a process to sort it out anddetermine the truth from the junk medicine must continue to strive to betterunderstand the workings of the bodymind for the purpose of alleviatingillness anecdotal evidence is just one piece of the puzzle it is notworthless rather it can help focus limited resources in the right directionjon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom banschbachvmsocomokstateedusubject how to prevent kidney stone formationi got asked in sci med nutrition about vitamin c and oxalate productiontoxic kidney stone formation i decided to post my answer here as well because of the recent question about kidney stones not long after i got into sci med i got flamed by a medical fellow for stating that magnesium would prevent kidney stone formation im going to state it again herebut the best way to prevent kidney stones from forming is to take b supplements read on to find out whyi have my asbestos suit on now guysvitamin c will form oxalic acid but large doses are needed above grams per day review article nutritional factors in calcium containing kidney stones with particular emphasis on vitamin c int clin nutr rev but glycine also forms oxalic aciddamino acid oxidases for both glycine and vitamin c one of the best ways to drastically reduce this production is not to cut back on dietary intake of vitamin c or glycine but to increase your intake of vitamin b control of hyperoxaluria with large doses of pyridoxine in patients with kidney stones int urol nephrol to mg of b each day significasntly decreased the urinary excretion of oxalate over the month treatment program the action of pyridoxine in primary hyperoxaluria clin sci patients receiving at least mg b each day showed a significant reduction in urinary oxalate levelsfor gylcine this effect is due to increased transaminase activityb is required for transaminase activity which makes less glycine available for oxidative deaminationdamino acid oxidases for vitamin c the effect is quite different there are different pathways for vitamin c catabolism the pathway that leads to oxalic acid formation will usually have to of the ingested dose going into oxalic acid but this is highly variable and the vitamin c review article pointed out that unless the dose gets upto grams per day not too much vitamin c gets catabolized to form oxalic acid at very high doses of vitamin cabove grams per day more of the extra vitamin c more than conversion can end up as oxalic acid in a very early study on vitamin c and oxalic productionproc soc exp biol med intakes of grams per day up to grams per day increased the average oxalic acid excretion from mg per day up to mg per day until grams per day was reached the average excreted was increased by only to mg per day gram dose gram dose gram dose and gram dose grams jumped it to mg over the average excretion before supplementation and grams jumped it to mg over the average before supplementationb is required by more enzymes than any other vitamin in the body there are probably some enzymes that require vitamin b that we dont know about yet vitamin c catabolism is still not completely understood but the speculation is that this other pathway that does not form oxalic acid must have an enzyme in it that requires b differences in b levels could then explain the very variable production of oxalic acid from a vitamin c challengethis is not the preferred route of catabolism increasing your intake of b would then result in less oxalic acid being formmed if you take vitamin c supplements since the typical american diet is deficient in b some researchers believe that the main cause of calciumoxalate kidney stones is b deficiencyespecially since so little oxalic acid gets absorbed from the gut diets providing to mg of oxalic acid per day showed absolutely no change in urinary excretion of oxalateurol int if mg was present each day there was a significant increase in urinary oxalate excretionhere are the high oxalate foods beans coca instant coffee parsley rhubarb spinach and tea contain at least mggrams beet tops carrots celery chocolate cumber grapefruit kale peanuts pepper sweet potatoe contain to mggramsif the threshold is mg per day you can see that you really have a lot of latitude in food selection a recent nengj med article also points out that one good way to prevent kidney stone formation is to increase your intake of calcium which will prevent most of the dietary oxalate from being absorbed at all if you also increase your intake of b you shouldnt have to worry about kidney stones at all the rda for b is mg per day for males and mg per day for femalesdirectly related to protein intakeb can be toxicnerve damage if it is consumed in doses of mg or more per day for an extended peroidweeks to months the usda food survey done in had an average intake of mg per day for males and mg per day for females living in the us coupled with this low intake was a high protein dietwhich greatly increases the b requirement as well as the presence of some of the different drugs that either block b absorption are metabolic antagonists of b or promote b excretion in the urine common ones are birth control pills alcoholisoniazid penicillamine and corticosteroids i tell my students to supplement all their patients that are going to get any of the drugs that increase the b requirement the dose recommended for patients taking birth control pills is mg per day and this should work for most of the other drugs that increase the b requirementthis would be on top of your dietary intake of b any patient that has a history of kidney stone formation should be given b supplementsone other good way to prevent kidney stone formation is to make sure your camg dietary ratio is magnesiumoxalate is much more soluble than is calciumoxalate the magnesiumcalcium ratio in the concentrated urines of patients with calcium oxalate calculiinvest urol effect of magnesium citrate and magnesium oxide on the crystallization of calcium in urine changes producted by foodmagnesium interactionj urol review article magnesium in the physiopathology and treatment of renal calcium stones j presse med there are actually about three times as many articles published in the medical literature on the role of magnesium in preventing kidney stone formation than there are for b i thought that i was being pretty safe in stating that magnesium would prevent kidney stone formation in an earlier post in this news group but good old john a in mass jumped all over me i guess that he doesnt read the medical literature oh well since kidney stones can be a real pain and a lot of people suffer from them i thought id tell you how you can avoid the pain and stay out of the doctors officemartin banschbach phdprofessor of biochemistry and chairmandepartment of biochemistry and microbiologyosu college of osteopathic medicine w th streettulsa ok without discourse there is no remembering without remembering there is no learning without learning there is only ignorance from a wise man who lived in china many many years ago i think that it still has meaning in todays worldfrom kxgstpittedu kenneth gilbertsubject re request gyro souvlaki saucein article rpcnrmterminatorrsitdumichedu donaldmackiemedumichedu donald mackie writesin article aprlocuscom michael trofimofftronfafnirlalocuscom writeswould anyone out there in netland happen to have anauthentic surefire way of making this great sauce thatis used to adorn gyros and souvlakiim not sure of the exact recipe but im sure acidophilus is one ofthe major ingredients the only recipies ive ever seen for this include plain yogurt finelychopped cucumber and a couple of crushed cloves of garlic yummy kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from gebcspittedu gordon bankssubject re great post was re candida yeast bloom very longin article noringcwzmnnetcomcom noringnetcomcom jon noring writeshate to wreck your elaborate theory but steve dyer is not an mdso professional jealosy over doctors who help their patients withnystatin etc cant very well come into the picture stevedoesnt have any patientsresponse to specificially candida albicans and i showed a strong positiveanother question would everybody show the same strong positive so this testis essentially useless and assuming it is true that candida can growyes everyone who is normal does that we use candida on the other armwhen we put a tuberculin test on if people dont react to candidawe assume the tb test was not conclusive since such people may notreact to anything all normal people have antibodies to candidaif not you would quickly turn into a fungus ballthis brings up an interesting observation used by those who will denyand reject any and all aspects of the yeast hypothesis until theappropriate studies are done and that is if you cant observe or culturethe yeast bloom in the gut or sinus then theres no way to diagnose oreven recognize the disease and i know they realize that it is virtuallyimpossible to test for candida overbloom in any part of the body that cannotbe easily observed since candida is everywhere in the bodyits a real catchyouve just discovered one of the requirements for a good quack theoryfind something that no one can disprove and then write a book sayingit is the cause of whatever since no one can disprove it you canrake in the bucks for quite some time i have often wondered what an md with chronic gi distress or sinus problems would do about the problem that he tells his patients is a nonexistent syndromethat is odd isnt it why do you suppose it is that mds with thesecommon problems dont go for these crazy ideas does the professionaljealosy extend to suffering in silence even though they know theycould be cured if they just followed this quack book gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from gebcspittedu gordon bankssubject re homeopathy a respectable medical traditionin article cqmjjybampexcom jagampexcom rayaz jagani writesfrom miranda castro the complete homeopathy handbookisbn oringinally published in britain in from page and in when the national health service was establishedhomeopathy was included as an officially approved methodof treatmenti was there in i suppose it must have died out since then certainly i never heard of any homeopaths or herbalists inthe employ of the nhs perhaps the law codified it but the authoritiesrefused to hire any homeopaths a similar law in the us allowschiropractors to practice in va hospitals but ive never seen onethere and i dont know of a single va that has hired a chiropractorthere are a lot of britons on the net so someone should be able totell us if the nhs provides homeopaths for you gordon banks njxp skepticism is the chastity of the intellect andgebcadredslpittedu it is shameful to surrender it too soon from jcherneyenvyreededu joel alexander cherneysubject epsteinbarr syndrome questionsokay this is a long shotmy friend robin has recurring bouts of mononucleosistype symptoms very regularly this has been going on for a number of years shes seen a number of doctors six was the last count i think most of them have said either you have mono or youre full of it theres nothing wrong with you one has admitted to having no idea what was wrong with her and one has claimed that it is epsteinbarr syndromenow what she told me about ebs is that very few doctors even believe that it exists obviously this has been her experience so whats the story is it real does the medical profession believe it to be realhas anyone had success is treating ebs or is it just something to live with thanks for your assistancejoel the ogre cherneyjcherneyreededuof the hordefrom paulsontablarcnasagov sharon paulsonsubject re foodrelated seizuresin article cxlrathenacsugaedu mcovingtaisunaiugaedu michael covington writes newsgroups scimed path newslarcnasagovsaimiriprimatewiscedusddhpcomelroyjplnasagovswrindezaphodmpsohiostateeduhowlandrestonansneteuropaenggtefsdcomemoryathenaaisunaiugaedumcovingt from mcovingtaisunaiugaedu michael covington sender usenetathenacsugaedu nntppostinghost aisunaiugaedu organization ai programs university of georgia athens references paulsonaprcmblarcnasagov buedu cuqblrjtoadspghpaus date fri apr gmt lines in article cuqblrjtoadspghpaus gebcspittedu gordon banks writes in article buedu dozonoffbuedu david ozonoff writes many of these cereals are cornbased after your post i looked in the literature and located two articles that implicated corn contains tryptophan and seizures the idea is that corn in the diet might potentiate an already existing or latent seizure disorder not cause it check to see if the two kellog cereals are corn based id be interested years ago when i was an intern an obese young woman was brought into the er comatose after having been reported to have grand mal seizures why attending a corn festival we pumped her stomach and obtained what seemed like a couple of liters of corn much of it intact kernals after a few hours she woke up and was fine i was tempted to sign her out as acute corn intoxication gordon banks njxp skepticism is the chastity of the intellect and how about contaminants on the corn eg aflatoxin michael a covington associate research scientist artificial intelligence programs mcovingtaiugaedu the university of georgia phone athens georgia usa amateur radio ntmi what is aflatoxinsharonsharon paulson sspaulsonlarcnasagovnasa langley research centerbldg d mailstop work hampton virginia home from ffujitaspsychuiucedu frank fujitasubject re choleric and the great ntnf semantic waralso remember that most people map thesanguinecholericmelencholicphlegmatic division onto the extraversionand neuroticism dimensions like eysenck and that the mbti does notdeal with neuroticism costa mccraefrank fujitafrom granteaquariusrosemountcom grant edwardssubject re krillean photographystgpraostunocalcom richard ottolini writes living things maintain small electric fields to enhance certain chemical reactions promote communication of states with in a cell communicate between cells of which the nervous system is a specialized example and perhaps other usestrue these electric fields change with location and time in a large organismalso true special photographic techniques such as applying external fields in kirillian photography interact with these fields or the resistances caused by these fields to make interesting picturesnot really kirlian photography is taking pictures of the corona discharge fromobjects animate or inanimate the fields applied to the objects aremillions of times larger than any biologically created fields if youwant to record the biologically created electric fields youve got touse lownoise highgain sensors typical of eegs and ekgs kirlianphotography is just phunwithphysics type stuff right up there withsoaking chunks of extrafine steel wool in liquid oxygen then hittingthem with a hammer which like a kirlean setup is fun but possiblydangerous perhaps such pictures will be diagonistic of disease problems in organisms when better understood perhaps notprobably notgrant edwards yow vote for me imrosemount inc welltapered halfcocked illconceived andgranteaquariusrosemountcom taxdeferredfrom rindenterprisebihharvardedu david rindsubject re arrhythmiain article aprhuscharvardedu perryhuscharvardedu alexis perry writesin article aprvaxcstevenstechedu uaverbavaxcstevenstechedu writesdoctors said that he could die from it and the medication causedis it that serious my ekg often comes back with a few irregularbeats another question is a low blood potassium level very bad mydoctor seems concerned but she tends to worry too much in generalthe term arrhythmia is usually used to encompass a wide range of abnormalheart rhythms cardiac dysrhythmias some of them are very seriouswhile others are completely benign having a few irregular beatson an ekg could be serious depending on what those beats were andwhen they occurred or could be of no significancelow blood potassium levels probably predispose people with underlyingheart disease to develop arrhythmias very low potassium levels areclearly dangerous but it is not clear how much of a problemlowendofnormal levels are a lot of cardiologists seem to treatanyone with even a mildly lownormal potassium level david rindrindenterprisebihharvardedufrom rindenterprisebihharvardedu david rindsubject re candidayeast bloom fact or fictionin article aprvmsocomokstateedu banschbachvmsocomokstateedu writesposter for being treated by a liscenced physician for a disease that did not exist calling this physician a quack was reprehensible steve and i see that you and some of the others are doing it here as well do you believe that any quacks exist how about quack diagnoses isbeing a licensed physician enough to guarantee that someone is nota quack or is it just that even if a licensed physician is a quackother people shouldnt say so can you give an example of acommonly diagnosed ailment that you think is a quack diagnosisor have we gotten to the point in civilization where we no longerneed to worry about unscrupulous healers taking advantage ofpeople david rindrindenterprisebihharvardedufrom chorleyvmsocomokstateedusubject re homeopathy a respectable medical traditionin article cyzrbtoadspghpaus gebcspittedu gordon banks writes in article cqmjjybampexcom jagampexcom rayaz jagani writes from miranda castro the complete homeopathy handbookisbn oringinally published in britain in from page and in when the national health service was establishedhomeopathy was included as an officially approved methodof treatment i was there in i suppose it must have died out since then certainly i never heard of any homeopaths or herbalists in the employ of the nhs perhaps the law codified it but the authorities refused to hire any homeopaths a similar law in the us allows chiropractors to practice in va hospitals but ive never seen one there and i dont know of a single va that has hired a chiropractor there are a lot of britons on the net so someone should be able to tell us if the nhs provides homeopaths for you i dont think they provide homeopaths heck the heir apparent was trying to promote osteopaths to the ranks of eligibility a couple of years back it pleased my family no end since im at an osteopathic school sort of validated it for themthen i told them that the name was the same but the practice was differentohif youre seeking validation for your philosophy on the strength of the national health service adopting it i suggest that you are not very sure of the validity of your philosophy i believe in the nhs was still having its nurses taught the fine art of cupping which is the vacuum extraction of intradermal fluids by means of heating a cup placing it on the afflicted site and allowing it to cooli wouldnt take my sick daughter to a homeopathdavid n chorleyyikes im agreeing with gordon banksfrom klieriscsvaxuniedusubject re modified sense of taste in cancer ptin article aprpeavaxmlodeccom lungerhelixenetdeccom dave lunger writes what does a lack of taste of foods or a sense of taste that seems off when eating foods in someone who has cancer mean what are the possible causes of this why does it happeni cant answer most of your questions but ive seen it happen in family members who are being treated with radiation andor chemotherapyjory graham published a cookbook many years ago in cooperation with the american cancer society i think called something has to tastegood as i recallthe cookbook was just what we needed several times when favorite foodssuddenly became yechkay klier biology dept unifrom turpincsutexasedu russell turpinsubject re great post was re candida yeast bloom very longin article noringcwzmnnetcomcom noringnetcomcom jon noring writes if you cant observe or culture the yeast bloom in the gut or sinus then theres no way to diagnose or even recognize the disease and i know they realize that it is virtually impossible to test for candida overbloom in any part of the body that cannot be easily observed since candida is everywhere in the bodyin article cynmaxvtoadspghpaus gebcspittedu gordon banks writes youve just discovered one of the requirements for a good quack theory find something that no one can disprove and then write a book saying it is the cause of whatever since no one can disprove it you can rake in the bucks for quite some time i hope gordon banks did not mean to imply that notions such ashardtosee candida infections causing various problems should notbe investigated many researchers have made breakthroughs by figuring out how to investigate things that were previously thoughtvirtually impossible to test forindeed i would be surprised if candida overbloom were such aphenomena i would think that candida would produce signaturebyproducts whose measure would then set a lower bound on the extent of recent infection i realize this might get quite tricky and difficult probably expensive and likely inconvenientor uncomfortable to the subjects but that is not the same as virtually impossiblerussellfrom bmdelanequadsuchicagoedu brian manning delaneysubject re diet for crohns ibdone thing that i havent seen in this thread is a discussion of therelation between ibd inflammation and the profile of ingested fattyacids fasi was diagnosed last may wcrohns of the terminal ileum when i gotout of the hospital i read up on it a bit and came across severalstudies investigating the role of epa an essentially fa in reducinginflammation the evidence was mixed many of these studies arediscussed in inflammatory bowel disease macdermott stenson but if i recall correctly there were some methodological bones to bepicked with the studies both the ones wpos and wneg results inthe studies patients were given epa a few gramsday for most of thestudies but if i recall correctly there was no restriction of theother fas that the patients could consume from the informedlaypersons perspective this seems mistaken if lots of n fas areconsumed along with the epa then the ratio of bad prostanoidproducts to good prostanoid products could still be fairly badisnt this ratio the issuewhats the view of the gastro community on epa these days epasupplements along with a fairly severe restriction of other fasappear to have helped me significantly though it could just be thelow absolute amount of fat i eat caloriesbrian bmdelanemidwayuchicagoedufrom andrewcalvindgbtdocca andrew patricksubject any interest in a mailing list on epilepsy and seizuresi have seen a fair bit of traffic recently concerning epilepsy andseizures i am also interested in this subject i have a son withepilepsy and i am very active with the local association i posted amessage like this a few months ago and received no replies but here itis againis anyone interested in participating in a mailing list on epilepsy andseizures this would allow us to hold discussions and shareinformation via electronic mail i already run a listserver for twoother groups so the mechanics would be easyif you are interested mail me a note if i get enough replies i willmake it happen and provide you with the detailsbtw i have also started a database on epilepsy this is part of myresearch on natural language question answering systems users of thisservice are able to ask questions about epilepsy and the programsearches the database and retrieves its best response the technologyworks by comparing your question against a set of questions that havebeen seen before all new questions that are not answered are recordedand used to improve the systemthis database is still small and sparse but we are adding newinformation to try it out do the followingtelnet debradgbtdoccalogin chatthen select the epilepsy item from the menu of databases andrew patrick phd communications research centre ottawa canada andrewcalvindgbtdocca for a good time run telnet debradgbtdocca and login as chatfrom bmdelanequadsuchicagoedu brian manning delaneysubject re epsteinbarr syndrome questionsin article aprreededu jcherneyreededu writesokay this is a long shotmy friend robin has recurring bouts of mononucleosistype symptoms very regularly this has been going on for a number of years shes seen a number of doctors six was the last count i think most of them have said either you have mono or youre full of it theres nothing wrong with you one has admitted to having no idea what was wrong with her and one has claimed that it is epsteinbarr syndromenow what she told me about ebs is that very few doctors even believe that it exists obviously this has been her experience so whats the story is it real does the medical profession believe it to be realhas anyone had success is treating ebs or is it just something to live with thanks for your assistanceoutbreaks of a chronicmonolike entity were originally called ebs orsome variant thereof because most of the people with this disease hadelevated levels of antibodies to the ebv virus but not all of themdid which prompted an official renaming of the disease to chronicfatigue syndrome this renaming took place in the annals of internalmedicine jan i believe now its also called chronic fatigueand immune dysfunction syndrome cfids since it seems clear thatsome sort of immune disregulation is causing the probsastonishly there are still docs who tell people with massivelyswollen glands recurrent fevers and nightsweats etc that theresnothing wrong with them this is not the same thing as saying that thesyndrome may have a at least partly psychological cause thedisagreement among people whose thoughts are worth considering centerson just what the cause is no one knows but theories includepsychological stress some sort of virus a retrovirus say most maybe one of the newly discovered herpes viruses environmentaltoxins bacteria and yes candida genes andor some combo ofthesetheres no outright cure at the moment but different docs trydifferent things some of which seem to helpmassive amounts of info on the condition are available these dayspost your q to altmedcfs and you will be flooded wfactsnote there are lots of far better understood and better treatablediseases that look like cfids make sure these get ruledout by a gooddocfrom cfaksuxctseiuedu alice sanderssubject frozen shoulder and lawn mowingihave had a frozen shoulder for over a year or about a year it is stillpartially frozen and i am still in physical therapy every week but thepain has subsided almost completely until last week when i mowed thelawn for twenty minutes each two days in a row i have a push type powermower the pain started back up a little bit for the first time in quitea while and i used ice and medicine again can anybody explain why thisparticular activity which does not seem to stress me very much generallyshould cause this shoulder problemthanksalicefrom noringnetcomcom jon noringsubject re great post was re candida yeast bloom very longin article turpincsutexasedu russell turpin writesi hope gordon banks did not mean to imply that notions such ashardtosee candida infections causing various problems should notbe investigated many researchers have made breakthroughs by figuring out how to investigate things that were previously thoughtvirtually impossible to test forindeed i would be surprised if candida overbloom were such aphenomena i would think that candida would produce signaturebyproducts whose measure would then set a lower bound on the extent of recent infection i realize this might get quite tricky and difficult probably expensive and likely inconvenientor uncomfortable to the subjects but that is not the same as virtually impossiblei recall reading in the recently revised edition of the yeast connectionthat there is indeed work by researchers to do this of course they areworking on the theory that candida overbloom with penetration into mucusmembrane tissue with associated mild inflammatory response can and doesoccur in a large number of people if you reject this yeast hypothesisthen id guess youd view this research as one more wasteful and quixoticendeavor stay tunedjon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom banschbachvmsocomokstateedusubject re candidayeast bloom fact or fictionin article rjghsdndevharvardedu rindenterprisebihharvardedu david rind writes in article aprvmsocomokstateedu banschbachvmsocomokstateedu writesposter for being treated by a liscenced physician for a disease that did not exist calling this physician a quack was reprehensible steve and i see that you and some of the others are doing it here as well do you believe that any quacks exist how about quack diagnoses is being a licensed physician enough to guarantee that someone is not a quack or is it just that even if a licensed physician is a quack other people shouldnt say so can you give an example of a commonly diagnosed ailment that you think is a quack diagnosis or have we gotten to the point in civilization where we no longer need to worry about unscrupulous healers taking advantage of people david rindi dont like the term quack being applied to a licensed physician davidquestionable conduct is more appropriately called unethicalin my opinionill give you some examples prescribing controlled substances to patients with no demonstrated needother than a drug addition for the medication prescribing thyroid preps for patients with normal thyroid function for the purpose of quick weight loss using laetril to treat cancer patients when such treatment has been shown to be ineffective and dangerouscyanide release by the ncithese are errors of commission that competently trained physicians should not committ but sometimes do there are also errors of omissionsome of which result in malpractice suits i dont think that using antifungal agents to try to relieve discomfort in a patient who you suspect may be having a problem with candidaor another fungal growth is an error of commission or omission healers have had a long history of trying to relieve human suffering some have stuck to standard approved proceduresothers have been willing to try any reasonable treatment if there is a chance that it will help the patient the key has to be tied to the healers oath i will do no harm but you know david that very few treatments involve no risk to the patient the job of the physician is a very difficult one when risk versus benefit has to be weighed each physician deals with this riskbenefit paradox a little differently some are very conservative while others are more agressive an agressive approach may be more costly to the patient and carry more risk but as long as the motive is improving the patients health and not an attempt to rake in lots of moneythrough some of the schemes that have been uncovered in the medicare fraud cases i dont see the need to label these healers as quacks or even unethicalwhat do i reserve the term quack for pseudomedical professionals these people lurk on the fringes of the health care system waiting for the frustrated patient to fall into their lair some of these individuals are really doing a pretty good job of providing alternative medicine but many lack any formal training and are in the business simply to make a few fast bucks while a patient can be reasonably assured of getting competent care when a liscenced physician is consulted this alternative care area is really a buyers beware arena if you are lucky you may find someone who can help you if you are unlucky you can loose a lot of money and develop severe disease because of the inability of these pseudomedical professional to diagnose diseasewhich is the fortay of the liscened physiciansi hope that this clears things up davidmarty bfrom uabdpodpouabedugila stephen hollandsubject re diet for crohns ibdin article aprmidwayuchicagoedubmdelanequadsuchicagoedu brian manning delaney wrote one thing that i havent seen in this thread is a discussion of the relation between ibd inflammation and the profile of ingested fatty acids fas i was diagnosed last may wcrohns of the terminal ileum when i got out of the hospital i read up on it a bit and came across several studies investigating the role of epa an essentially fa in reducing inflammation the evidence was mixed many of these studies are discussed in inflammatory bowel disease macdermott stenson but if i recall correctly there were some methodological bones to be picked with the studies both the ones wpos and wneg results in the studies patients were given epa a few gramsday for most of the studies but if i recall correctly there was no restriction of the other fas that the patients could consume from the informed laypersons perspective this seems mistaken if lots of n fas are consumed along with the epa then the ratio of bad prostanoid products to good prostanoid products could still be fairly bad isnt this ratio the issue whats the view of the gastro community on epa these days epa supplements along with a fairly severe restriction of other fas appear to have helped me significantly though it could just be the low absolute amount of fat i eat calories brian bmdelanemidwayuchicagoeduas you note the research is mixed so there is no consensus on therole of fatty acids in ulcerative colitis there is a role for shortchain fatty acids in patients with colostomies and rectal pouchesthat are inflammed short is butyrate and shorter there may be a rolefor treatment of uc with short chain fatty acids and i am looking forward to the upcoming aga meeting in boston to see what people aredoing you raise a hypothesis about the studies and restriction of otherfatty acids you should contact the authors directly about that oreven write a letter to the editor it is a good point by the waythe abbreviation epa is not in general use so i do not know what fatty acid you are speaking aboutand to brian an u of c there is a physician named stephen hanauerthere who is a recognized expert in the treatment of ibd you might give him a call he is interested in new combinations of drugs for the treatment of ibd if you call please say hello to him from mei was looking at u of c for a position and perhaps still am andbe sure to look into joining the ccfabest of lucksteve hollandfrom lundbyrtsgmotcom walter f lundbysubject re is msg sensitivity superstitionin article aprllyenejplnasagov julieeddiejplnasagov julie kangas writesas for how foods taste if im not allergic to msg and i likethe taste of it why shouldnt i use it saying i shouldnt useit is like saying i shouldnt eat spicy food because my neighborhas an ulcer nobody is saying that you shouldnt be allowed to use msg justdont force it on others if you have food that you want to enhance with msg just put the msg on the table like salt it isthen the option of the eater to use it if you make a commericalproduct just leave it out you can include a packet like somesalt packets if you desiresalt pepper mustard ketchup pickles are table optionstreat msg the same way i wouldnt shove my condiments down yourthroat dont shove yours down minewfl walter lundbyfrom noringnetcomcom jon noringsubject quackquack was re candidayeast bloom fact or fictionin article rindenterprisebihharvardedu david rind writesdo you believe that any quacks exist how about quack diagnoses isbeing a licensed physician enough to guarantee that someone is nota quack or is it just that even if a licensed physician is a quackother people shouldnt say so can you give an example of acommonly diagnosed ailment that you think is a quack diagnosisor have we gotten to the point in civilization where we no longerneed to worry about unscrupulous healers taking advantage ofpeoplei would say there are also significant numbers of unscrupulous doctors ofthe squeakyclean traditional crewcut talk to the ama before startingany treatment kind who recommend treatments that though accepted maynot be necessary for the patient at the time and all for making a quickbuck i would not be surprised if the cost of medical services in the us issignificantly inflated by these quacks of a different color in fact idsay these doctors are the most dangerous since they call into question thetrue focus of the medical profession the ama and the boards should focuson these quacks instead of devoting unbelievable energy on searchanddestroymissions to pull the licenses of those doctors who are trying nontraditional or not fully accepted treatments for their desperate patientsthat traditionalaccepted medicine cannot helpnow to make a general comment on many recent postslately ive seen the word quack bandied about recklessly when a doctor ordoctorwannabe has decided to quit discussing any controversial medicalsubject in a civilized manner all heshe has to do is say quackquack andsomehow they magically expect the readership of this newsgroup to roll overon their backs and peepee on themselves in obedience what do they teachyou in medical school how to throw your authority aroundlet me put it another way to make my point clear quack is a nebulous wordlacking in any precision its sole use is to obfuscate the issues at handthe indiscriminate use of this word is a sure sign of incompetency and comingfrom any medical doctor or wannabe where competency is expected is realscarybut what do i know ive already been diagnosed by the scimedgods in thisnewsgroup as being anal retentive and psychotic i look forward to morenetdiagnoses hey theyre freejon quacks r us noringps may i suggest seriously that if the doctors and wannabedoctors onthe net who refuse to have an open mind on alternative treatments andtheories such as the yeast theory should create your own moderated groupyou can call it scimedtraditionalmoderated or scimedamaapproved so youcan keep analretentives like me out of it charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom pat lydon patnetmanagecomsubject helpreflux esophagitisi am writing this to find out the followingany information on surgery to prevent reflux esophagitisthe names of a doctors who specialize in such surgeryinformation on reflux esophagitis which leads to cancermy boyfriend age and otherwise in good health was diagnosed with reflux esophagitis and a hiatal hernia about years ago at that time he saw a gastroenterologist and has tried acid controllers mylanta tagamet as well as a restricted diet and raising the head of his bed these treatments were not effective and because the damage was worsening he opted for a surgical repair months ago he was told there were two repair techniques that could fix the problem a nissen wrap and a hill repair he opted for the hill repair he recovered very well from the surgery itself but the pain he had originally is worse and in addition he now has trouble swallowing including salivathe doctor now wants to do an endoscopy and has also informed him that a biopsy might be necessary if he has a precancerous condition which he called barretts syndrome if he cant avoid having reflux will he necessarily get cancerbasically if anyone has any information on what he should do now id appreciate itthankspat lydon netmanage inc patnetmanagecomfrom daveldavelpcsandiegoncrcom dave lordsubject re request gyro souvlaki saucein article rpcnrmterminatorrsitdumichedu donald mackiedonaldmackiemedumichedu writes in article aprlocuscom michael trofimoff tronfafnirlalocuscom writes would anyone out there in netland happen to have an authentic surefire way of making this great sauce that is used to adorn gyros and souvlaki im not sure of the exact recipe but im sure acidophilus is one of the major ingredients its plain yoghurt with grated cucumber and coriander other spices aresometimes used some people use half yoghurt and half mayonaisefrom bmdelanequadsuchicagoedu brian manning delaneysubject re diet for crohns ibdin article uabdpodpouabeduspamdomuabedu uabdpodpouabedugila stephen holland writesin article aprmidwayuchicagoedubmdelanequadsuchicagoedu brian manning delaney wrote one thing that i havent seen in this thread is a discussion of the relation between ibd inflammation and the profile of ingested fatty acids fas even write a letter to the editor it is a good point by the waythe abbreviation epa is not in general use so i do not know what fatty acid you are speaking aboutsorry i mean eicosapentaenoic acidand to brian an u of c there is a physician named stephen hanauerthere who is a recognized expert in the treatment of ibd you might give him a callcoincidentaly just yesterday i was finally referred from the clinicto hanauer im seeing him on may ill report what he says aboutthis questionthe treatment of ibd if you call please say hello to him from mei was looking at u of c for a position and perhaps still amwill dobrian delaneyfrom solmsteadpfcforestryca sherry olmsteadsubject re heat shock proteinsrousseauaimmunexcom writes about heat shock proteins hsps and dnai hate to be derogatory but in this case i think its warrantedhsps are part of the cellular response to stress the only reason theyare called heat shock proteins is because they were first demonstratedusing heat shock dead tissue ie meat is not going to produce anyprotein because its dead also who cares if the dna you are ingesting is mutated it will be completely digested in your stomach which is about ph some of you worry way too much eat a healthy balanced diet and relaxmy advice is if you dont know what you are talking about it is betterto keep your mouth shut than to open it and remove all doubt about yourignorance dont speculate or at least get some concrete informationbefore you dosherry olmsteadbiochemist sherry olmstead title lab technician forestry canada phone victoria bc internet solmsteadapfcforestrycafrom pajukcogecmrc paul johnsonsubject poisoning with heavy water was re too many mrisin article aprinformixcom probertsinformixcom paul roberts writesin article aprkestreledu kingreasoningcom dick king writesi recall reading somewhere during my youth in some science popularizationbook that whyle isotope changes dont normally affect chemistry a consumptionof only heavy water would be fatal and that seeds watered only with heavywater do not sprout does anyone know about thisi also heard this i always thought it might make a good eposide ofcolumbo for someone to be poisoned with heavy water it wouldntshow up in any chemical testno one else seems to know so ill post thisthis topic came up on sciphysicsfusion shortly after the coldfusionflap started as i recall its been done to some experimental micethey showed various ill effects and eventually died the reason isthat deuterium does not have exactly the same reaction rates ashydrogen due to its extra mass which causes lower velocity boltzmanconstant mumble this throws various bits of body biochemistry outof kilter and you get sick and dieive never heard of anyone being poisened this way in or out of reallife the process takes quite a while if anyone wants to write thisbook i would imagine you would have to replace a significant fraction of the water in the body with heavy water wait while normal breakdown and repair processes cause other molecules in the body to be synthesised using the deuteriumduring this process the victim would gradually deteriorate andeventually die but i imagine it would take weeks during which thepoisoner would have to ensure that a significant proportion of thewater the victim ingested was heavyyou would get such a mess of symptoms that the doctors would be bothalarmed and confused why should every organ in the body suddenlybegin to deteriorate if you can figure out how the poisoner gets theheavy water into the victim in a hospital then you could have a realstory herecome to think of it would continue even after the heavy water wasno longer being ingested so hospitalisation might be too latethe most detectable effect would be that the victims body fluidswould literally be heavy water has a molecular weight of andheavy water has a mw of thus the victims weight will increase byabout for every of body water replaced by heavy water maybethe detection occurs because some pathologist in the lab notices thatthe victims urine is strangely dense is there any medical testinvolving the specific gravity of a body fluidpaul paul johnson pajgecmrccouk tel ext these ideas and others like them can be had gecmarconi research is notfor each from any reputable idealist responsible for my opinionsfrom aldridgenetcomcom jacquelin aldridgesubject re cholistasisspfatfree dietpregnancyheartaccessdigexcom g writeshiive just returned from a visit with my obgyn and i have a few concerns that maybe yall can help me with ive been seeing her every weeks for the past few months im at week and during the last visits ive gained to pounds every weeks she said this was unacceptable over any week period as it stands ive thus far gained pounds also she says that though im at weeks the babys size is weeks i think she mentioned inches for the top of the fundus when i was weeks the babys size was weeks i must also add that i had an operation a few years ago for endometriosis and ive had no problems with endometriosis but apparently it is causing me pain in my pelvic region during the pregnancy and i have a very difficult time moving and the doc has recommended i not walk or move unless i have to i have a little handicapped sticker for when i do need to go out anyway thats of the situation the other is that almost from the beginning of pregnancy i was getting sick throwing up about times a day and mostly it was bile that was being eliminated i told her about this i know this because i wasnt eating very much due to the nausea and could see the results well now i only get sick about once every weeks and it is still bile related but in addition i had begun to feel movement near my upper right abdomen just below the right breast usually when i was lying on my right side it began to get worse though because it started to hurt when i lay on my right side and then it hurt no matter what position i was in next i noticed that when i ate greasy or fatty foods i felt like my entire abdomen had turned to stone and the pain in the area got worse however if i ate sauerkraut or vinegar or something to cut the fat it wasnt as much of a problemso the doctor says i have cholistatis and that i should avoid fatty foods this makes sense and because i was already aware of what seemed to me this cause and effect relationship i have been avoiding these foods on my own but im still able to eat foods with ricotta cheese for instance and other low fat foods but doc wants me to be on a nonfat diet this means no meat except fish and chicken wo skin i do this anyway no nuts fried food cheese etc i am allowed skim milk she said i should avoid anything sweet eg bananas also i must only have one serving of something high in carbohydrates a day potatoes pasta rice she said i cant even cook vegetables in a little bit of oil and that i should eat vegetables raw or steamed im concerned because i understand you need to have some fat in your diet to help in the digestive process and if im not taking in fat is she expecting the baby will take it from my stores and why this restriction on carbohydrates if shes concerned about fat im not clear how much of her recommendation is based on my weight gain and how much on cholistatis which i cant seem to find any information on she originally said that i should only gain pounds during the entire pregnancy since i was about lbs overweight when i started but my sister gained lbs during her pregnancy and shes taken it all off and hasnt had any problems she also asked if any members of my family were obese which none of them are anyway i think she is overly concerned about weight gain and feel like im being punished by a severe diet she did want to see me again in one week so i think she the diet may be temporary for that one week what i want to know is how reasonable is this nonfat diet i would understand if she had said lowfat diet since im trying that anyway even if she said really lowfat diet i think she assumes i must be eating a highfat diet but really it is that because of the endometriosis and the operation im not able to use the energy from the food i do eat any opinions info and experiences will be appreciated im truly going stark raving mad trying to meet this new strict diet because fruits and vegetables go through my system in a few minutes and ill end up having to eat constantly thus far i dont find any foods satisfyingthanks gfor one week she probably wants to see how you react to the diet if itchanges anything you can live on the diet but you need to up your calories where before youhad a pat of butter now you need a medium apple probably microwavecooked smaller meals but more of them not terrific amounts of meat itshard to digest anyway for comfort and to make the carbohydrate meal last longer eat pasta orrice which give their calories up slowly rather than bread or corn maybesmaller meals as you may be getting less room in the stomach area is thebaby still coming up is it starting to push or rub under your ribs howtight are your clothes you shouldnt be wearing any clothing that compresses your middle be sure not to suck in your stomach when sitting again itwill put pressure on the digestive tract try laying on your sides backand stay in reclining positions for the many hours you are being inactiveeasier on your legs circulation as well you might try letting the babyturn or at least not be forced under the ribs during the last monthswhen you are shortwaisted its easy for that baby to end up right under thediaphram especially if you have tight abdominal muscles if i had mysecond one to do over again i think id have tried to loosen up since hedidnt turn sideways until late and the relief was enormousmaybe this doctor does have a thing about weight gain in pregnancy or maybeshe just nags all her patients this way especially if shes young but this gallbladderwhatever problem that might be coming up is somethingto be avoided if possible nausea etc can vary from person to person and with each pregnancy myfirst pregnancy was miserable during the second i had very little troublesome articles have said that women with nausea had a statistically betterchance of carrying their baby grain of salt here good luckjackiefrom bbenowittelesciencescom barry d benowitzsubject re eye dominancein article cegworldstdcom rsilverworldstdcom richard silver writes is there a righteye dominance eyedness as there is an overall righthandedness in the population i mean do most people require less lens corrections for the one eye than the other if so what kinds of percentages can be attached to this thanks yes there is such a thing as eye dominance although i am not sure ifthis dominance refers to perscription strengthas i recall if you selectively close your dominant eye you will percievethat the image shifts this will not happen if you close your other eyei believe that which eye is dominant is related to handedness but icant recall the relation at the momentbarry d benowitzemailbbenowittelesciencescom pyrnjtelescibbenowitphone xsnailtelesciences co systems new albany rd moorestown nj from aldridgenetcomcom jacquelin aldridgesubject re candidayeast bloom fact or fictionrindenterprisebihharvardedu david rind writesin article aprvmsocomokstateedu banschbachvmsocomokstateedu writesposter for being treated by a liscenced physician for a disease that did not exist calling this physician a quack was reprehensible steve and i see that you and some of the others are doing it here as well do you believe that any quacks exist how about quack diagnoses isbeing a licensed physician enough to guarantee that someone is nota quack or is it just that even if a licensed physician is a quackother people shouldnt say so can you give an example of acommonly diagnosed ailment that you think is a quack diagnosisor have we gotten to the point in civilization where we no longerneed to worry about unscrupulous healers taking advantage ofpeople david rindsure there are quacks there are quacks who dont treat and quacks whotreat ones that refuse to diagnose and ones that diagnose improperly there are lucky quacks and unlucky quacks smart quacks and dumb ones there are people ahead of their time with unprobable or unproven theoriesand rationals there are illreasoned absurd theorists sometimes its hard to tell whos who reading a book of ancient jokes it seems that doctors called other doctorsquacks in babylon arguments abound when there arent any firm answers plenty of illnessesarent or cant be diagnosed or treated but i think its better to argueagainst the theory as was originally done with postings on candida a monthor so ago stating the facts usually works better than simply asserting anopinion about someones competency and you cant convince everybody sometimes a correct diagnosistakes years for people they dont run into a doctor who recognizes thedisease they havent developed something recognizable yet or they havesomething that no one is going to recognize because it hasnt beendescribed yet sometimes they get a cure sometimes the illness wears outsometimes they stumble on an improper diagnosis with the right treatmentsometimes they find its incurable there is no profit in a patient accepting a hopeless attitude about an illness unless its a rock solid diagnosis of terminal disease its ismore like ly that a person will find a cure if they keep looking jackiefrom rindenterprisebihharvardedu david rindsubject re quackquack was re candidayeast bloom fact or fictionin article noringcyliqonetcomcom noringnetcomcom jon noring writesin article rindenterprisebihharvardedu david rind writesdo you believe that any quacks exist how about quack diagnoses isbeing a licensed physician enough to guarantee that someone is nota quack or is it just that even if a licensed physician is a quackother people shouldnt say soi would say there are also significant numbers of unscrupulous doctors ofthe squeakyclean traditional crewcut talk to the ama before startingany treatment kindumm werent you the one objecting to someone who is a licensedphysician being called a quack or is it just that being a licensedphysician is a good defense against charges of quackery when thephysician agrees with your system of beliefslately ive seen the word quack bandied about recklesslyactually i almost never use the term quack when i discusssystemic yeast syndrome however i always point out thatmainstream medicine views this as a quack diagnosis and i agreewith that characterizationlet me put it another way to make my point clear quack is a nebulous wordlacking in any precisionreally i bet virtually everyone reading these posts understands whatsteve dyer gordon banks and i am implying when we have talked aboutsystemic yeast syndrome as a quack diagnosis would you prefer theword charlatan i dont happen to think that all quacks arecharlatans since i suspect that some believe in the diseases theyare diagnosingps may i suggest seriously that if the doctors and wannabedoctors onthe net who refuse to have an open mind on alternative treatments andtheories such as the yeast theory should create your own moderated groupwhy is there some reason why you feel that it shouldnt be pointed outin scimed that there is no convincing empirical evidence to support the existence of systemic yeast syndrome david rindrindenterprisebihharvardedufrom vortexzikzakapanaorgau paul andersonsubject re do we need a radiologist to read an ultrasounddougbcommmotcom doug bank writesmy wifes obgyn has an ultrasound machine in her office whenon her next visit my wife asked another doctor in the office ifthey read the ultrasounds themselves or if they had a radiologistread the pictures the doctor very vehemently insisted that theywere qualified to read the ultrasound and radiologists were notmy wife is concerned about this she saw a tv show a couple monthsback something like or dateline nbc etc where an experton fetal ultrasounds a radiologist was showing all the differentdeffects that could be detected using the ultrasoundshould my wife be concerned should we take the pictures to a radiologist for a second opinion and if so where would we findsuch an expert in chicago we dont really have any special medicalreason to be concerned but if a radiologist will be able to seethings the obgyn cant then i dont see why we shouldnt use oneany thoughts as far as i can see if your obstetrition has an ultrasound in his roomsand is expirienced its use and interpretation he should be just ascapable of reading it as any radiologist all doctors are qualified toread xrays us ct scans etc it is just that a radiologist does nothingelse and thus is only better at reading them because of all this timespent doing this skill in reading xrays etc just comes from plenty ofpractice if your obstetrition reads heaps of obstetric ultrasounds heshould be able to pick up any abnormalities that can be demonstrated bythis technique paul zikzak public access unix melbourne australia o o from nigeldatamandemoncouk nigel ballardsubject re adult chicken pox i am and am recovering from a case of chicken pox which i contractedfrom my year old daughter i have quite a few of these little puppiesall over my bod at what point am i no longer infectious my physiciansoffice says when they are all scabbed over is this truei have been in the same boat as you last year ive tried four times tosend you an email response but your end doesnt seem to accept my mailplease let me know if you receive thischeers nigel nigel ballard int nigeldatamandemoncouk vacant lot bournemouth uk cis radioghoi for rent diaries of the famous colonel custersurrounded by indians just when i fancied a chinesefrom kenisiscnscaltechedu ken millersubject re quackquack was re candidayeast bloom fact or fictionin article ragcbhsdndevharvardedu rindenterprisebihharvardedu david rind writesin article noringcyliqonetcomcom noringnetcomcom jon noring writesps may i suggest seriously that if the doctors and wannabedoctors onthe net who refuse to have an open mind on alternative treatments andtheories such as the yeast theory should create your own moderated groupwhy is there some reason why you feel that it shouldnt be pointed outin scimed that there is no convincing empirical evidence to support the existence of systemic yeast syndromei dont know the first thing about yeast infections but i am a scientistno scientist would take your statement no convincing empirical evidenceto support the existence of systemic yeast syndrome to tell youanything except an absence of data on the question noring has pointed outthe catch that if the crazy theory were true you probably couldntfind any direct evidence of it that you couldnt observe those yeastiebeasties with present methods even if they were there noring and thefellow from oklahoma sorry forgot your name have also suggested one setof anecdotal evidence in favor based on their personal experiences namely that when people with certain conditions are given antifungalsmany of them appear to get better so if you have any evidence against the hypothesis for examplecontrolled doubleblind studies showing that the antifungals dont do anybetter than sugar water then lets hear it if you dont then what wehave is anecdotal and uncontrolled evidence on one side and abjectdisbelief on the other in which case please there is no point in yellingback and forth at each other any longer since neither side has anyconvincing evidence either positive or negative and i understand that your abject disbelief is based on the existence ofpeople who may get famous or make money applying the diagnosis to everythingin sight making wild claims with no evidence and always refusing to docontrolled studies but that has absolutely no bearing on the apparentlysincere experiences of the people on the net observing antifungals workingon themselves and other people in certain specific cases there are alsoquacks who sell oral superoxide dismutase in spite of the fact that itscompletely broken down in the guts but this doesnt change the genuinescientific knowledge about the role of superoxide dismutase in fightingoxidative damage same thing just cause there are candida quacks thatdoesnt establish evidence against the candida hypothesis if theres someother reason besides the quacks if only anecdotal to think it could betrue then that is what has to be considered that is what the net peoplehave been talking aboutbut again there is no point in arguing about it there is anecdotalevidence and there is no convincing evidence and there are also somecandida quacks out there i hope everyone can agree on all of that thusit appears to me the main question now is whether the proponents canmarshall enough anecdotal evidence in a convincing and documented enoughmanner to make a good case for carrying out a good controlled doubleblindstudy of antifungals or else forget convincing anybody else to carry outthe test just carry it out themselves and also whether they canadequately define the patient population or symptoms on which such a studyshould be carried out to provide a fair test of the hypothesisken from aldridgenetcomcom jacquelin aldridgesubject re eye dominancebbenowittelesciencescom barry d benowitz writesin article cegworldstdcom rsilverworldstdcom richard silver writes is there a righteye dominance eyedness as there is an overall righthandedness in the population i mean do most people require less lens corrections for the one eye than the other if so what kinds of percentages can be attached to this thanks yes there is such a thing as eye dominance although i am not sure ifthis dominance refers to perscription strengthas i recall if you selectively close your dominant eye you will percievethat the image shifts this will not happen if you close your other eyei believe that which eye is dominant is related to handedness but icant recall the relation at the momentbarry d benowitzi read a great book about eye dominance several years ago so there is onebook out thereat least one there were several types of eye dominance where a person looks in theirmemory usually indicates a type of eye dominanc another type is related tocoordination activities like hitting a ball another for reading i didnt read one that discussed prescription strength although peoplewith bad vision near or far sighted would tend to depend on the strongereye jackiefrom aldridgenetcomcom jacquelin aldridgesubject sweets syndrome my brothers affine has recently been diagnosed with sweetssyndrome also called steroid resistant sweets syndromethis syndrome started after she had had iodine treatment forhyperthyroidism shed been reluctant to have treatment for thehyperthyroidism for many years and apparently started to show exaustionfrom it i understand that she may still be testing high in thyroid levelbut shes isnt being treated by an endocrinologist her previousendocrinologist bowed out when she entered the hospital she entered thehospital because of the sweets syndrome symptoms skin lesionsive looked through the last two years of medline and didnt find anabstract mentioning a correlation between thyroid and sweets i checked a handbook which said that sweets was associated with leukemiaid like a reccomndation for experts who are in new york city or who travelto new york city for the sweets and perhaps for the endocrinologyany information that might help apparently there hasnt been muchimprovement in her condition over the past several months jackie from candeebrtphbnrca candee ellis psubject re help for kidney stones if you think you have kidney stones or your doctor tells you that you dodefinitely follow up on it my sister was diagnosed with kidney stones years ago and given medication to take to dissolve them after thatfailed and she continued to be in great pain they decided she hadendometriosis when they did exploratory surgery they discovered shehad a tumor which turned out to be rhabdomyosarcoma a very rare and agressive cancer i realize this is not what happens in the majorityof cases but you never know what can happen and shouldnt take chancesfrom sharonworldstdcom sharon m gartenbergsubject from srebrenica doctoring in hellsrebrenicas doctor recounts towns living hell by laura pitter tuzla bosnia reuter neret mujanovic was a pathologistwhen he trekked through the mountains to the besieged muslimtown of srebrenica last august but after treating mangled victims of bosnias bloodywar he considers himself a surgeon now im a surgeon with great experience although i have nolicense to practice but if i operate on a person and he livesnormally thats the greatest license a surgeon could have evacuated by the un this week to his home town of tuzlathe muslim physician gave an eyewitness medical assessment ofthe horrors of the yearlong serb siege of srebrenica and thesuffering of the thousands trapped there i lived through hell together with the people ofsrebrenica all those who lived through this are the greatestheroes that humanity can produce he told reporters mujanovic had practiced for two months as an assistantat a local hospital in tuzla but before going to srebrenica hehad never performed a surgical operation on his own now he sayshe has performed major surgery times relying on books forguidance amputating arms and legs times usually withoutanesthetic delivering babies and performing four cesareansections he worked tohour days slept in the hospital for thefirst weeks after his arrival last aug and treated patients he arrived after making the trek over mountains on foot fromtuzla miles northwest of srebrenica about other peoplecarried in supplies and soldiers guided and protected himthrough guerrilla terrain he said his worst memory was of days ago when seven serb shellslanded within one minute in an area half the size of a footballfield killing people immediately and wounding half ofthe dead were women and children the people had come out for a rare day of sunshine and thechildren were playing soccer there was no warning theblood flowed like a river in the street he said there were pieces of women all around and you could notpiece them together one woman holding her two children in herhands was lying with them on the ground dead they had noheads before mujanovic arrived with his supplies conditions weredeplorable he said many deaths could have been prevented hadthe hospital had surgical tools facilities and medicine the six general practitioners who had been operating beforehe arrived had even less surgical experience than he did theydidnt know the basic principles for amputating limbs once he arrived the situation improved he said but bymidseptember he had run out of supplies bandages were washed and boiled five times sometimesthey were falling apart in my hands he said doctors had noanesthetic and could not give patients alcohol to numb the painbecause it increased bleeding people were completely conscious during amputations andstomach operations he said blood transfusions wereimpossible because they had no facilities to test blood types i felt destroyed psychologically mujanovic said the situation improved after dec when a convoy arrivedfrom the belgian medical group medecins sans frontieres but mujanovic said the military predicament worsened inmiddecember after bosnian serbs began a major offensive in theregion every day we had air strikes and shellings then the hunger set in between middecember and midmarch when us planes beganair dropping food between and people were dying every dayfrom complications associated with malnutrition he said i know for sure that the air drop operation saved thepeople from massive death by hunger and starvation he said according to mujanovic around people died insrebrenica of them children during a year of siege mujanovic plans to return to srebrenica in three weeks aftervisiting his wife who is ill in tuzla they say im a hero he said there were thousands ofpeople standing at the sides of the road crying and waving wheni left and i cried too sharon machlis gartenbergframingham ma usaemail sharonworldstdcomfrom turpincsutexasedu russell turpinsubject re great post was candida bloomin article noringcygwfmnetcomcom noringnetcomcom jon noring writes of course they are working on the theory that candida overbloom with penetration into mucus membrane tissue with associated mild inflammatory response can and does occur in a large number of people if you reject this yeast hypothesis then id guess youd view this research as one more wasteful and quixotic endeavor stay tunedi do not have enough medical expertise to have much of an opinionone way or another on hidden candida infections i canunderstand the skepticism of those who see this associated withvarious general kinds of symptoms while there is a lack of soliddemonstration that this happens and causes such general symptomsto understand this skepticism one only needs to know of pastfailures that shared these characteristics with the notion ofhidden candida infection there have been quite a few and theproponents of all thought that the skeptics were overly skepticalon the other hand i am happy to read that some people aresufficiently interested in this possibility spurred bysuggestive clinical experience to research it further thedoubters may be surprised it has happened beforei realize that admitting ignorance in the face of ignorance maynot endear me to those who are so sure they know one way oranother and indeed perhaps some of them do know i am theone who is currently ignorant but i find this the most honestroute and so i am happy with itrussellfrom jgnassiathenamitedu john angelo gnassisubject re candidayeast bloom fact or fictionin an article jon noring writesin article rindenterprisebihharvardedu david rind writesdo you believe that any quacks exist how about quack diagnoses istrue focus of the medical profession the ama and the boards should focuson these quacks instead of devoting unbelievable energy on searchanddestroymissions to pull the licenses of those doctors who are trying nontraditional or not fully accepted treatments for their desperate patientsthat traditionalaccepted medicine cannot helpif i prescribe itraconazole for a patients sinusitis neither the amafda state licensing board nor abfp will be knocking on my door to askwhy this is a specious argumenton their backs and peepee on themselves in obedience what do they teachyou in medical school how to throw your authority aroundamong other things how to evaluate new theories and treatmentslet me put it another way to make my point clear quack is a nebulous wordlacking in any precision its sole use is to obfuscate the issues at handfunny i thought it meant one who fraudulently misrepresents hisability and experience in the diagnosis and treatment of disease orthe effects to be achieved by the treatment he offers dorlandsth certainly more precision than conveyed by chronic yeastthe indiscriminate use of this word is a sure sign of incompetency and comingfrom any medical doctor or wannabe where competency is expected is realscarythe inability to discriminate between fraudulent or erroneousrepresentations is far more frightening it is fraud to promote atreatment where the evidence for it is either lacking or against itand the quacksalver knows so or error if the honest practitionerdoesnt know so failure to speak out against either bespeaksincompetencyps may i suggest seriously that if the doctors and wannabedoctors on the net who refuse to have an open mind on alternative treatments and theories such as the yeast theory should create your own moderated groupmay i reply seriously that if the practitioners and proponents ofnonscientific medicine have left their minds so open that the partsof their brains that do critical evaluation have fallen out they shouldlearn to edit their newsgroup headers to conform to the existinghierarchy and divisions john angelo gnassi lab of computer science jgnassihstbmemitedu massachusetts general hospital eternal student boston massachusetts usa the earth be spanned connected by a network walt whitmanfrom abfreenetcarletonca robert allisonsubject re frequent nosebleedsin a previous article mcovingtaisunaiugaedu michael covington saysin article aaseastarseashell bebmzasruchvpkhchevroncom beverly m zalan writesmy year son is so plagued lots of vaseline up his nose each night seems to keep it under control but let him get bopped there and hell recur for days also allergies colds dry air all seem to contribute but again the vaseline or ad ointment or neosporin all seem to keep them from recurringif you can get it you might want to try a canadian overthecounter productcalled secaris which is a watersoluble gel compared to vaseline or othergreasy ointments secaris seems more compatible with the moisture thatsalready theresecaris is reasonably inexpensive cdn for a tube and is indeed anover the counter medication why it does not appear to be available in theus i dont know its manufactured in montrealits a nasal lubricant and is intended to help nosebleeds that result fromdry mucous membranesfrom some of the replies to my original posting its evident that somepeople do not secrete enough mucous to keep their nose lining protectedfrom environmental influences ie dry air but ive had no responsesfrom anyone with experience with rutin is there another newsgroup thatmight have specifics on herbal remediesbut thanks to all those who did reply with their experiences robert allisonfrom elgsilverlcsmitedu elizabeth glasersubject net address for whoi am looking for the email address of the world health organizationin particular the address for the department of nursing or the chiefscientist for nursing dr miriam hirschfeld the snailmail address ihave is the following world health organization avenue appia geneva switzerlandplease respond directly to me thank you for your assistance elg elizabeth glaser rnelgsilverlcsmitedusubject why isolate itfrom chinszeiscalstateedu christopher hinszdoes anyone on this newsgroup happen to know why morphine wasfirst isolated from opium if you know why or have an idea for where icould look to find this info please mail mecshany suggestionas would be greatly appreciated kilimanjaro is a pretty tricky climb most of its up until you reachthe very very top and then it tends to slope away rather sharplysir george head obe jclogic the point is frozen the beast is dead what is the differencegavin millarrrrrrrrrr jcfrom mutrhuxaecnbguedu todd r haverstocksubject re request gyro souvlaki saucein article aprdonnersandiegoncrcom daveldavelpcsandiegoncrcom dave lord writesin article rpcnrmterminatorrsitdumichedu donald mackiedonaldmackiemedumichedu writes in article aprlocuscom michael trofimoff tronfafnirlalocuscom writes would anyone out there in netland happen to have an authentic surefire way of making this great sauce that is used to adorn gyros and souvlaki im not sure of the exact recipe but im sure acidophilus is one of the major ingredients its plain yoghurt with grated cucumber and coriander other spices aresometimes used some people use half yoghurt and half mayonaisein the kind i have made i used a lite sour cream instead of yogurt may notbe as good for you but i prefer the taste a few small bits of cuke inaddition to the grated cuke may also finish the sauce off nicelytrhmutrhuxaecnbguedufrom reswgalenmedvirginiaedu robert e schmiegsubject re quackquack was re candidayeast bloom fact or fictionkenisiscnscaltechedu writes i dont know the first thing about yeast infections but i am a scientist no scientist would take your statement no convincing empirical evidence to support the existence of systemic yeast syndrome to tell you anything except an absence of data on the questionthe burden of proof rests upon those who claim the existenceof this syndrome to date these claims are unsubstantiatedby any available data hopefully as a scientist you wouldtake issue with anyone overstating their conclusions basedupon their data beasties with present methods even if they were there noring and the fellow from oklahoma sorry forgot your name have also suggested one set of anecdotal evidence in favor based on their personal experiences namely that when people with certain conditions are given antifungals many of them appear to get better gee i have many interesting and enlightening anecdotes aboutmyself my friends and my family but in the practice ofmedicine i expect and demand more rigorous rationales forbasing therapy than aunt susies brotherinlaw anecdotal evidence may provide inspiration for a hypothesisbut rarely proves anything in a positive sense and unlikemathematics boolean logic rarely applies directly to medicalissues and so evidence of exceptions does not usuallydisprove but rather modifies current concepts of disease so if you have any evidence against the hypothesis for example controlled doubleblind studies showing that the antifungals dont do any better than sugar water then lets hear it if you dont then what we have is anecdotal and uncontrolled evidence on one side and abject disbelief on the other in which case please there is no point in yelling back and forth at each other any longer since neither side has any convincing evidence either positive or negative i would characterize it not as abject disbelief but rather scientific outrage over vastly overstated conclusions it appears to me the main question now is whether the proponents can marshall enough anecdotal evidence in a convincing and documented enough manner to make a good case for carrying out a good controlled doubleblind study of antifungals or else forget convincing anybody else to carry out the test just carry it out themselves and also whether they can adequately define the patient population or symptoms on which such a study should be carried out to provide a fair test of the hypothesisi have no problem with such an approach but this is not whatis happening in the trenches of this diagnosisbob schmiegfrom noringnetcomcom jon noringsubject adenocarcinoma of the lungsputting aside our substantial differences id like to ask the knowledgeableones to give feedback on this let me explainone of my family members last week was discovered to have a brain tumor afterhaving some difficulties with walking and writing she is years oldotherwise she is in fine health the discovery was made via cat scansshe then had mri scans done where small cancerous areas were discoveredin her lungs biopsies showed it to be adenocarcinoma one spot isin the lungs and another in the pneumothorax the oncologists believethe cancer started in the lungs and caused the brain tumor she smokeduntil four years agoanyway id like feedback as to what adenocarcinoma is how it is differentfrom other cancers how she will be treated luckily the tumor is rightbelow the skull and can be easily removed and statistically what arethe chances for full remissionrecoverythanksjon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom xhozakgwwmichedusubject prk referral in canadacould some please refer me to someone who can perform prk photo refractive keratostomy in canada preferably eastern portion ive looked inthe yellow pages with little success and if someone has had a good orbad for that matter experience that would be especially helpful if youcould please let me knowthankskurt hozakhozaklabccwmichedu preferred addressfrom aldridgenetcomcom jacquelin aldridgesubject re cholistasisspfatfree dietpregnancyaldridgenetcomcom jacquelin aldridge writesi decided to come back and amend this so it quotes me and has addedcommentsheartaccessdigexcom g writeshiit started to hurt when i lay on my right side and then it hurt no matter what position i was in next i noticed that when i ate greasy or fatty foods i felt like my entire abdomen had turned to stone and the pain in the area got worse however if i ate sauerkraut or vinegar or something to cut the fat it wasnt as much of a problemso the doctor says i have cholistatis and that i should avoid fatty foods this makes sense and because i was already aware of what seemed to me this cause and effect relationship i have been avoiding these foods on my own but im still able to eat foods with ricotta cheese for instance and other low fat foods but doc wants me to be on a nonfat diet this means no meat except fish and chicken wo skin i do this anyway no nuts fried food cheese etc i am allowed skim milk she said i should avoid anything sweet eg bananas also i must only have one serving of something high in carbohydrates a day potatoes pasta rice she said i cant even cook vegetables in a little bit of oil and that i should eat vegetables raw or steamed im concerned because i understand you need to have some fat in your diet to help in the digestive process and if gfor one week she probably wants to see how you react to the diet if itchanges anything you can live on the diet but you need to up your nonfat calories wherebefore you had a pat of butter now you need a medium apple probably microwavecooked smaller meals but more of them not terrific amounts of meat itshard to digest anyway first even fish fowl and breads have fat secondthe body will make fat out of carbohydrates if it needs them third yourbody like most peoples wasnt bred to live on a high fat modern dietif you read texts about ancient and primative people you will read aboutthe luxury of eating fat how people enjoyed it this was because it was sorare even cows didnt put out nearly the amount of butterfat in milk thatthey do now for comfort and to make the carbohydrate meal last longer eat pasta orrice which give their calories up slowly rather than bread or corn maybesmaller meals as you may be getting less room in the stomach area is thebaby still coming up is it starting to push or rub under your ribs howtight are your clothes you shouldnt be wearing any clothing that compresses your middle be sure not to suck in your stomach when sitting again itwill put pressure on the digestive tract try laying on your sides backand stay in reclining positions for the many hours you are being inactiveeasier on your legs circulation as well you might try letting the babyturn or at least not be forced under the ribs during the last monthswhen you are shortwaisted its easy for that baby to end up right under thediaphram especially if you have tight abdominal muscles if i had mysecond one to do over again i think id have tried to loosen up since hedidnt turn sideways until late and the relief was enormousmaybe this doctor does have a thing about weight gain in pregnancy or maybeshe just nags all her patients this way especially if shes young but this gallbladderwhatever problem that might be coming up is somethingto be avoided if possible you dont want to become ill with it while youare pregnant if you are lucky you can work on getting rid of it after thebaby it is said that doctors have less gallbadder surgery than the restof the population a good part of it is that they are willing to do thedieting etc that helps them avoid surgery also i dont think the surgerylets a person go back to eating a high fat diet nausea etc can vary from person to person and with each pregnancy myfirst pregnancy was miserable during the second i had very little troublesome articles have said that women with nausea had a statistically betterchance of carrying their baby grain of salt here good luckjackiefrom maryuicslcsluiucedu mary e allisonsubject re is msg sensitivity superstitionthese are my last words on the subjectfrom lundbyrtsgmotcom walter f lundby writes as a person who is very sensitive to msg and whose wife and kids are too i want to know why the food industry wants to put msg in foodsome people think it enhances the flavor i personally dont think ithelps the taste it makes me sick so i try to avoid it from dyerspdcccom steve dyer writes sez you such an effect in humans has not been demonstrated in any controlled studies infant mice and other models are useful as far as they go but theyre not relevant to the matter at hand which is not to say that i favor its use in things like baby fooda patently ridiculous use of the additive but we have no reason to believe that msg in the diet effects humans adverselywell i know that msg effects me adversely maybe not permanently butat least temporarily enough that i like to try to avoid the stuff from kiranvillagecom kiran wagle writes if you dont like additives then for godsake get off the net and learn to cook from scratch sheeshexcuse mewhy cant people learn to cook from scratch on the net ive gottenlots of recipes off the net that dont use additivesif you like additives then get off the net and go to your localsupermarket buy lots of packaged foods and you get off the net is it to cover up the fact that the recipes are not very good or the food is poor quality yes and you buy it says something about your taste ehi dont and what happens when the companies forced to submit to your silly notions go out of business because nobody wants to buy their overpriced bad food removing preservatives directly raises food costs by reducing shelf lifehey ill pay my hard earned dollars to buy food that costs morebut does not have preservatives i choose to speak with my pocketbookin many ways from kiranvillagecom kiran wagle you have a good point msg is commonly used in soups in bottled sauces in seasoning mixtures and in the coating on barbecue potato chips nacho cheese doritos breading for many frozen fried foods like fishand chicken etc ad naseum if msg is really the problem we should call this barbecue potato chip syndrome or maybe diner syndrome or the and other natural flavorings syndrome its been a few yearssince ive bought anything labelled with and other naturalflavorings from kiranvillagecom kiran wagle the reaction came the time the msg was in the food that was the only difference same restaurant same ingredients how do you know this in order to demonstrate your claim you would have had to supervise the preparation on both occasions perhaps they used msg both times and lied about it perhaps once they used something that had begun to spoil and produced some bizarre toxin that youre allergic to well i had had similar reactions many times that was when i reallystarted watching carefully reaction to doritos hey guess whats inthere reaction to lawrys season salt guess whats in thereill give you a hint ive had enough problems with many many manydifferent products with msg that i figured out one thingunless i plan on getting sick i wont eat the stuff without myseldane and did i ever learn to read labels please note that i am not saying you are making it up i am just trying to point out that the situation is not always as simple as it might seem which was why i started checking every time i got sick and everytime i got sick msg was somehow involved in one of the food productsand consider there were no other similar ingredients to my knowledge it might not please a medical researcher but it pleased my ownpersonal physician enough for him to give me allergy medicine and mostimportantly its enough proof for me to avoid it and enough proofthat my incredibly frugal fiance didnt flinch when i literally threwout or gave away all the food products in his pantry that had msg and he always flinches when theres waste but it was a simpleexplanation i wont eat this stuff i wont cook with this stuff soi can either throw it out or give it away from patteeucsucoloradoedu donna pattee my guess was that the spice mix on the fries contained msg probably lawrys seasoning salt i love the way that tastes im not saying i never consume anything with msg ive noticed that ihave a certain tolerance level like a small bag of bbq chips oncea month or so it not a problem but that same bag of chips willbother me if i also had chicken bouillon yesterday and lunch at one ofthe chinese restaurants the day before from kelleyhealthyuwaterlooca catherine l kelley all thats needed now is that final step a doubleblind study done on humans there isnt even an ethical question about possible harm as this is a widely used and approved food additivebut some say that only of the population has a problem with msg some say its more like but lets say that its how manypeople would have to be tested that would have a problem also iknow i have a problem with it and i wouldnt volunteer for a testlike thanks guys but i dont want to get sick also im sure thatmost people probably have varying degrees of sensitivities atdifferent times if i have a cold im much more susceptible to thereaction than when im healthy as proven today when im stuffy butfor some silly reason i still gave in and decided to have the bbqchips from kiranvillagecom kiran wagle because too many of you generic rhetorical you not you cathy go around calling this chinese restaurant syndrome thus suggesting to the people you complain to that you experience this only from chinese food msg is prevalent in a lot more things than chinese foodthats why i suggested calling this diner syndrome cathy doesnt i havent saved all my postings but i never called itchinese restaurant syndrome and i never stated i got it only fromchinese food i just thought it would be easiest to conduct mypersonal test at a chinese take out place that i knew would hold ornot hold the msg i cant call up whoever makes doritos and ask themto make me one back of chips without msg on the other hand if one complains about potatoes from a mix or restaurant spice mixes im going to believe them and if anyone says they got msgsick after eating too many barbecue potato chips at a party im really going to believe them well i believe i mentioned that in an earlier post lets see you wrote this message atdate apr but on date apr gmti wrote has anyone had an msg reaction from something other than a chinese restaurant lots of times thats why it was so hard for me to pin down i would probably have been easier if id only have the reaction in a certain type of restaurant but ive had the reaction in chinese restaurants and greek restaurants and italian restaurants and steak places i can tell you when a steak joint uses accent to tenderize their meat oh and just in case anyone thinks im prejudice against eitherchinese food or asian people im not going home to cook some chinesefood for the guy im marrying next week incidentally his last nameis wuso stop it with the flame mailwhy does a woman work ten years to change a mans habits and then complain that hes not the man she married barbra streisand mary allison maryuicslcsluiucedu urbana illinoisfrom jpcavdmsmsfcnasagov j porter clarksubject annual inguinal hernia repairlast year i was totally surprised when my annual physical disclosed aninguinal hernia i couldnt remember doing anything that would havecaused it that is i hadnt been lifting more than other people doand in fact probably somewhat less eventually the thing became morepainful and i had the repair operationthis year i developed a pain on the other side this turned out to beanother inguinal hernia so i go back to the hospital monday foranother fun operationi dont know of anything im doing to cause this to happen im years old and i dont think im old enough for things to start fallingapart like this the surgeon who is doing the operation seems tosuspect a congenital weakness but if so why did it suddenly appearwhen i was and not really as active as i was when i was youngerdoes anyone know how to prevent a hernia other than not liftinganything its rare that i lift more than my monthold or a sackfull of groceries and you may have noticed that your typical grocerysack is fairly small these days is there some sort of exercise thatwill reduce the riskof course my wife thinks its from sitting for long periods of time atthe computer reading news j porter clark jpcavdmsmsfcnasagov or jpcgaiamsfcnasagovnasamsfc flight data systems branchsubject calcium deposits on heart valvefrom johngrezeexecnetcom john grezea friend a year old man has calcium deposits on one of hisheart valves what causes this to happen and what can be done aboutitjohngrezeexecnetcomfrom vraonyxcsduedu vinay raosubject density of the skull bonecould someone tell me what the density of skull bone is or direct me to a reference that contains this info i would appreciate it very muchthanksvinayvinay j rao vraonyxcsduedufrom granteaquariusrosemountcom grant edwardssubject re krillean photographyholfeltzlstcvmstortekcom writes as you know all ready it is the pattern in the bioplasmic energy field that is significantno i didnt already know that ive never even heard of abioplasmic energy field care to explain it its been a few yearssince my last fields class so i may have forgotten or maybe i skippedthat day anyway as ross perot said im all ears well eyes inthis casegrant edwards yow is something violentrosemount inc going to happen to a garbage cangranteaquariusrosemountcom from vraonyxcsduedu vinay raosubject perception of doctors and health carethe following article by columnist mike royko is his humorous commentaryon some of the publics perception of doctors and their salariesi hope some of you will find it as amusing as i didreprinted wo permissiontheres no cure for stupidity of poll on doctors salariesby mike roykotribune media services on a stupidity scale a recent poll about doctors earnings is right up there it almost scored a perfect braindead it was commissioned by some whiny consumers group called families usa the poll tells us that the majority of americans believe that doctors make too much money the pollsters also asked what a fair income would be for physicians those polled said oh about a year would be ok how generous how sporting how stupid why is this poll stupid because it is based on resentment and envy two emotions that ran hot during the political campaign and are still simmering you could conduct the same kind of poll about any group that earns plus and get the same results since the majority of americans dont make those bucks they assume that those who do are stealing it from them maybe the berlin wall came down but dont kid yourself karl marx lives its also stupid because it didnt ask key questions such as do you know how much education and training it takes to become a physician if those polled said no they didnt know then they should have been disqualified if they gave the wrong answers they should have been dropped what good are their views on how much a doctor should earn if they dont know what it takes to become a doctor or maybe a question should have been phrased this way how much should a person earn if he or she must a get excellent grades and a fine educational foundation in high school in order to b be accepted by a good college and spend four years taking courses heavy in math physics chemistry and other lab work and maintain a average or better and c spend four more years of grinding study in medical school with the third and fourth years in clinical training working to hours a week and d spend another year as a lowpay hardwork intern and e put in another three to years of postgraduate training depending on your specialty and f maybe wind up in debt after medical school and g then work an average of hours a week with many family doctors putting in hours or more until they retire or fall over as you have probably guessed by now i have considerably more respect for doctors than does the law firm of clinton and clinton and all the lawyers and insurance executives they have called together to remake americas health care based on what doctors contribute to society they are far more useful than the powerhappy egotripping programspewing social tinkerers who will probably give us a medical plan that is to health what clintons first budget is to frugality but propaganda works and as the stupid poll indicates many americans wrongly believe that profiteering doctors are the major cause of high medical costs of course doctors are wellcompensated they should be americans now live longer than ever but who is responsible for our longevitylawyers congress or the guy flipping burgers in a mcdonalds and the doctors prolong our lives despite our having become a nation of selfindulgent lardbutted tvgaping couch cabbages ah that is not something you heard president clinton or super spouse talk about during the campaign or since but instead of trying to turn the medical profession into a villain they might have been more honest if they had said let us talk about medical care and one of the biggest problems we have that problem is you my fellow american yes you eating too much and eating the wrong foods many of you guzzling too much hooch still puffing away at a pack getting your daily exercise by lumbering from the fridge to the microwave to the couch doing dope and bringing crack babies into the world filling the big city emergency rooms with gunshot victims engaging in unsafe sex and catching a deadly disease while blaming the world for not finding an instant cure you and your habits not the doctors are the single biggest health problem in this country if anything it is amazing that the docs keep you alive as long as they do in fact i dont understand how they can stand looking at your blubbery bods all day so as your president i call upon you to stop whining and start living cleanly now i must go get myself a triple cheesygreasy with double fries do as i say not as i do but for those who truly believe that doctors are overpaid there is another solution dont use them thats right you dont feel well then try one of those spine poppers needle twirlers or have rev bubba lay his hands upon your head and declare you fit or there is the doityourself approach you have chest pains then sit in front of a mirror make a slit here a slit there and pop in a couple of valves youre going to have a kid why throw your money at that overpaid sawbones so he can buy a better car and a bigger house than you will ever have while paying more in taxes and malpractice insurance than you will ever earn just have the kid the oldfashioned way squat and do it and if it survives you can go to the library and find a book on how to give it its shots by the way has anyone ever done a poll on how much pollsters should earnroyko is a pulitzer prizewinning columnist for tribune media servicesvinay j rao vraonyxcsduedufrom oldmancoosdartmouthedu prakash dassubject re is msg sensitivity superstitionin article aprllyenejplnasagov julieeddiejplnasagov julie kangas writesas for how foods taste if im not allergic to msg and i likethe taste of it why shouldnt i use it saying i shouldnt useit is like saying i shouldnt eat spicy food because my neighborhas an ulcerjulie it doesnt necessarily follow that you should use it msg orsomething else for that matter simply because you are not allergicto it for example you might not be allergic to animal fats andlike their taste yet it doesnt follow that you should be using themregularly msg might have other bad or good i am not up on knowledge of msg effects on your body in the long run maybe thatsreason enough not to use it altho your example of the ulcer is funny it isnt anappropriate comparison at allprakash dasfrom ttruskitsmcwedu thomas trusksubject re krillean photographyin article aprvxcrnacernch filipevxcrnacernch vinci writes how about kirlian imaging i believe the faq for sciskeptics sp has a nice writeup on this they would certainly be most supportive on helping you to build such a device and connect to a kvolt supply so that you can take a serious look at your aura filipe santos cern european laboratory for particle physics switzerlandplease sign the relevant documents and forward the remaining partsto our study effect of kv on human tissue wrapped in filmthanks for your supportdr thomas trusk dept of cellular biology anatomy email to ttruskitsmcwedu medical college of wisconsin milwaukee wi disclaimer ala foghorn leghorn its a joke son a joke i say from backonvmshujiacilsubject re net address for whoin article aprmintakalcsmitedu elgsilverlcsmitedu elizabeth glaser writes i am looking for the email address of the world health organization in particular the address for the department of nursing or the chief scientist for nursing dr miriam hirschfeld the snailmail address i have is the following world health organization avenue appia geneva switzerlandthe domain address of the who is whoarcomchso try sending email to postmasterwhoarcomchjoshbackonvmshujiacil please respond directly to me thank you for your assistance elg elizabeth glaser rn elgsilverlcsmitedufrom danielprincefnzcalcomsocalcom daniel princesubject re is msg sensitivity superstition to milshnmrzmghharvardedu alex milshteyn am having said that i might add that in mho msg does not enhance am flavor enoughf for me to miss it when i go to chinese places am i order food without msg to me msg tastes just like a mixture of salt and sugar i dont think that is the case with most people what does it taste like to you if wishes were horses wed all have to wear hip boots origin one world los angeles b from danielprincefnzcalcomsocalcom daniel princesubject re can men get yeast infections to smithmcmentorccpurdueedu lost boy lb i know from personal experience that men can get yeast infections i lb get rather nasty ones from time to time mostly in the area of the lb scrotum and the base of the penis i used to have problems with recurrent athletes foot until i started drying between my toes with my blow drier after each time i bathe i also dry my pubic area while i am at it to prevent problems you might want to try it my cat types with his tail origin one world los angeles b from westesnetcomcom will estessubject use of haldol in elderlydoes anyone know of research done on the use of haldol in the elderly does shortterm use of the drug ever produce longterm sideeffects afterthe use of the drug my grandmother recently had to be hospitalizedand was given large doses of haldol for several weeks although thedrug has been terminated she has changed from a perky slightlysenile woman into a virtual vegetable who does not talk to anyoneand who cannot even eat or brush her teeth without assistance itseems incredible to me that such changes could take place in thecourse of just one and onehalf months i have to believe that thecombination of the hospital stay and some drugs are in partcatalysts for this any comments will estesinternet westesnetcomcomsubject hypodermic needlefrom bolseneiscalstateedu becky olsenhi i am doing a term paper on the syringe and i have found someinformation it is said that charles pravaz has invented the hypodermicneedle but then i have also found that alexander wood has invented it does anyone know which one it is of if it was anyone else if there isanymore information that is out there could you please send it to methank you very muchbecky olsenfrom haynescatsucscedu jim haynessubject re poisoning with heavy water was re too many mrisall i can remember is that there was an article in scientific americanmaybe years ago as someone else noted rats or mice fed nothingbut heavy water eventually died and the explanation was given haynescatsucsceduhaynescatsbitnetya can talk all ya wanna but its difrent than it wasno it aint but ya gotta know the territory meredith willson the music manfrom donald mackie donaldmackiemedumichedusubject re hypodermic needlein article cvijcoeiscalstateedu becky olsenbolseneiscalstateedu writeshi i am doing a term paper on the syringe and i have found someinformation it is said that charles pravaz has invented thehypodermicneedle but then i have also found that alexander wood has inventedit does anyone know which one it is of if it was anyone else ifthere isanymore information that is out there could you please send it tomethank you very muchbecky olsenlooking in the evolution of anaesthesia by mh armstrong davisonpub williams wilkins baltimore i found the followingchronology charlesgabriel pravaz inventor of thegalvanocautery describes a glass syringe with tapered nozzle thissyringe was intended to be used with a special trocar for injectingferric chloride into aneurysms and thus to heal them by coagulation alexander wood of edinburgh invents the hypodermicneedle and adapts pravazs syringe for use with ityou might also be interested to read about the experiments of sirchristopher wren in described by oldenberg clarck in thephilosophical transactions of the royal society in using asharpened quill and a pigs bladder he injected opium wine and beerinto the veins of dogsdon mackie um anesthesiology will disavowfrom carlsolgpscaltechedu carl j lydicksubject re is msg sensitivity superstitionin article rcfjinnmdsroundupcrhcuiucedu maryuicslcsluiucedu mary e allison writeswhich was why i started checking every time i got sick and everytime i got sick msg was somehow involved in one of the food productswhich points up the studies made by amateurs did you also check every timeyou did not get sick no you say why not check every thing you eat whenyou dont get sick and find out how much msg youre actually consuming all thats needed now is that final step a doubleblind study done on humans there isnt even an ethical question about possible harm as this is a widely used and approved food additivebut some say that only of the population has a problem with msg some say its more like but lets say that its how manypeople would have to be tested that would have a problem also iknow i have a problem with it and i wouldnt volunteer for a testif you knew enough about what the test was about to decide that you didnt wantto participate because it involved msg youdve already made yourselfineligible since msg is detectable by taste how can anybody be so cluelessas to what double blind studies are all aboutcarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itfrom icbalasuacadbitnetsubject re opinions on allergy hay fever shotsin article aprmidwayuchicagoedujacquiergsbuxuchicagoedu eric jacquier saysfrom now on it looks like shots per week for months followed by shot per month or so each shot costs talking about soaring costs and the health care system i wouldcall that a racket we are not talking about rare amazonian grasseshere but the garbage which grows behind the doctors officeapart from this issue i was somewhat disappointed to find outthat you have to keep getting the shots forever is that rightyou might look for an allergy doctor in your area who uses sublingualdrops instead of shots for treatment you are given a small bottle ofantigens drops are placed under the tongue for minutes myallergy to bermuda grass was neutralized this way throughout the treatmentprocess i had to return to the doctors office every month for retestingand a new bottle of antigens after the allergy was completely neutralizeda bottle of maintenance antigens lasts me about months the sublingualdrops are then taken times per week and costs so the cost isless than shots and it is more convenient just to take the drops at homebruce longfrom hchungnyxcsduedu h anthony chungsubject localized fat reduction due to exercise questioni was just wondering if exercises specific to particular regions of thebody such as thighs will basically only tone the thighs or if fatfrom other parts of the body such as breasts would be affected just asmuch h anthony chungc amigas case western reserve university r the school of dentistry future hacpocwrueducabal on ircacisfrom piclfsphyphysicsfsuedu picl accountsubject reuse of haldol and the elderlyim a nursing student and i would like to respond to on haldoland the elderlymessageid aprfsphyphysicsfsueduorganization florida state university school of higher thoughtnewssoftware vaxvms vnews b first im sorry to hear that you have had to see your grandmother gothrough this i know it has to have been toughthere are many things that can cause long term confusion in elderlyadults the change in environment can cause problems anesthetic agentscan cause confusion because the body cannot clear the medicines out ofthe body as easily in addition medications and interactions betweenmedications can cause confusionas far as whether or not haldol can have long lasting effects even afterthe drug has been discontinued i do not know i have not seen anythingto that effect however i also had not been looking for that informationi can see what i can findi can tell you that haldol is an antipsychotic drug and according tothe nursing drug handbook it is especially useful for agitationassociated with senile dementia p it also should not be discontinued abruptly it did not say anything about long lastingeffectsbecause so many things can cause confusion it is hard for me to knowwhat else was going on at the time if i had more history i might be ableto answer you better if you want to send me email with more informationi would be happy to try to help you piece together what might havehappenedelisapiclfsphyphysicsfsuedufrom doylepittedu howard r doylesubject roc curves softwarei understand robert centor has a program called roc analyzer that can beused to do receiver operating characteristic roc curve analysis does anyone know if this is avaliable from an ftp site if not does anyoneknow how to get a copy of ithoward doyledoylepittedufrom donald mackie donaldmackiemedumichedusubject re reuse of haldol and the elderlyin article cazmmailerccfsuedu picl accountpiclfsphyphysicsfsuedu writesadults the change in environment can cause problems anestheticagentscan cause confusion because the body cannot clear the medicines outofthe body as easilythe original poster did not say why his mother had been in hospitalbut i can answer a few general pointselderly patients may exhibit a marked difficulty in coping afterbeing in hospital for a few days the drastic change of environmentwill often unmask how marginally they have been coping at home evenyoung people find the change unsettlingthough we have thought that this decrement in function after say anaesthesia and surgery for a fractured hip a common event in theelderly was due to anaesthesia there is good evidence that thechange of situation is much more important some hospitals havetried a rapid transit system for hip fractures aiming to have thepatient back at home within hours of admission the selection ofthe anaesthetic has no effect on the ability to discharge thesepatients earlyanaesthetists who work with the elderly which is almost all of usgenerally take care to tailor the choice and dose of drugs used tothe individual patient even so there is some evidence that fullmental recovery may take a surprisingly long time to return this isthe sort of thing which is detected by setting quite difficulttasks not the gross change that the original poster notedhaloperidol haldol tm is a long acting drug the plasma half lifeof the drug is up to hours if the decanoate a sort of slowrelease formulation is used it may be weeks the elderly aresensitive to haloperidol for a number of reasons without knowingmore it is hard to commentdon mackie his opinionsesiology will disavowfrom lawrence curcio lcbandrewcmuedusubject re use of haldol in elderlyive seen people in their forties and fifties become disoriented anddemented during hospital stays in the examples ive seen drugs weredefinitely involved my own father turned into a vegetable for a short time while in thehospital he was fiftythree at the time and he was on separatemedications the family protested but the doctors were adamant tellingus that none of the drugs interact they even took the attitude that ifhe was disoriented they should put him on something else as well withthe help of an md friend of the family we had all his medicationdiscontinued he had a seizure that night and was put back on one drugtwo days later he was his old self again i guess there arent manymedical texts that address the subject of way interactionsi dont mean this as a cheap shot at the medical profession it is anaspect of hospitals that is very frightening to me docs seem to believethat because they have close control of you its quite all right totake your bodily equilibria into their own hands that control reducesthe chance that the patient will make a mistake but health careproviders can make mistakes too and mistakes can be deadly under thosecircumstances i grant you that sometimes theres no choice nevertheless i suggestyou procure a list of the drugs your grandmother is getting and discussit with an independent doc her problems may not be the effect of haldolat all haldol may have been used validly or it may have beenprescribed because other medication confused her and because thehospital normally prescribes haldol for the confused elderlyjust my opinionlarry obviously not a doc c from jowalkerpolyslocsccalpolyedu the thespiansubject re request gyro souvlaki saucei got this recipe from a watier on the greek island of samosthey use it as a spread for bread there butit is excellent ongyros as well by the way the actual name is tzatzikihere is the recipeyoghurt chopped garlic peeled chopped cucumber salt whitepepper a little olive oil and a little vinegari would love to hear of any other good greek recipes out there jon walkerjowalkeroboecalpolyedufrom dbakerutkvxutkedu baker davidsubject hypodermic syringewhile i dont have an answer for you i reckon blaise pascal is generallycredited with inventing the syringe per se i dont know much about theneedles however i do know of a southwest virginia country doctor whosome thrity or more years ago invented patented used and sold a syringehypodermic needle combination that retracted injected with the flip of atrigger then retracted giving a nearpainless injection the fellow wasdr daniel gabriel and it was termed the gabrielsomebody else syringe did you come across that one plastic disposable syringes came onto themarket about that time and his product went by the wayside to my knowledgefrom piclfsphyphysicsfsuedu picl accountsubject re use of haldol in elderlyin article yfqmlekivcolandrewcmuedu lawrence curcio lcbandrewcmuedu writesive seen people in their forties and fifties become disoriented anddemented during hospital stays in the examples ive seen drugs weredefinitely involved my own father turned into a vegetable for a short time while in thehospital he was fiftythree at the time and he was on separatedrugsno wonder he became confused with so many drugs it is almost impossibleto know which one is causing the problem and because some drugs potentiate the effect of each other they can make the side effectsall the worse and even dangerous kinda like mixing alcohol and antihistamineshe was disoriened the doctors thougt they should put him on somethingelse as wellunfortunately doctors prescribe drugs to treat the side effects ofthe drugs a patient is receiving if one drug they are taking causesthe patients blood pressure to go up many times an antihypertensiveis prescribed instead of reevaluating the need for the original drugthis is why many older adults are trying to take a dozen or so drugsat homeprocure a list of the drugs your grandmother is getting and discussit with an independent doc her problems may not be the effect of haldolat all haldol may have been used validly or it may have beenprescribed because other medication confused her and because thehospital normally prescribes haldol for the confused elderlyi fully agree in addition she proably should be examined by anotherdoctor who can reevaluate the need for the medications she is takingi cant remember the guidelines i either saw in a text or heard duringa lecture but any elderly adult who is receiving medications should havethe need for the drug reevaluated regularly if her current physicianis unwilling to do this find one who will either check the phone book for a physician who specializes in geriatric medicine or gerontology or contact a physician referral line or the american medical societyby finding a geriatric specialist he she will more likely be in tunewith the special needs of elderly adults and maybe can helpfrom danielprincefnzcalcomsocalcom daniel princesubject fibromyalgia cfs and sleep levelsi know that there is a relationship between fibromyalgia and deep sleep i believe that there are five levels of sleep i think that rem sleep is the third deepest level of sleep and that there are two deeper levels of sleep if i am in error in any of this please let me knowwhich level of sleep is thought to be deficient in people with fibromyalgia are there any known sleep disturbances associated with cfs what sleep disturbances if any are associated with clinical depression do antidepressants correct the sleep disturbances in these diseases are there any good books or medical journal articles about sleep disturbances and these diseases thank you in advance for all replies the more inconvenient it is to answer the phone the more it rings origin one world los angeles b from stephenmontcsmissouriedu stephen montgomerysmithsubject pregnency without sexwhen i was a school boy my biology teacher told us of an incidentin which a couple were very passionate without actually havingsexual intercourse somehow the girl became pregnent as spermcells made their way to her through the clothes via persperationwas my biology teacher misinforming us or do such incidents actuallyoccurstephenfrom davidstatcom david dodellsubject hicn medical news part cut here volume number april health infocom network medical newsletter editor david dodell dmd north nd street suite scottsdale arizona usa telephone fax compilation copyright by david dodell dmd all rights reserved license is hereby granted to republish on electronic media for which no fees are charged so long as the text of this copyright notice and license are attached intact to any and all republished portion or portions the health infocom network newsletter is distributed biweekly articles on a medical nature are welcomed if you have an article please contact the editor for information on how to submit it if you are interested in joining the automated distribution system please contact the editor email address editor internet davidstatcom fidonet bitnet atwhasuacad listserv mednewsasuacadbitnet or internet mednewsasuvminreasuedu anonymous ftp vmnodakedu notification list hicnnotifyrequeststatcom fax delivery contact editor for information t a b l e o f c o n t e n t s centers for disease control and prevention mmwr april rates of cesarean delivery malaria among us embassy personnel fda approval of hib vaccine for childreninfants dental news workshop explores oral manifestations of hiv infection food drug administration news fda approves depo provera injectable contraceptive new rules speed approval of drugs for lifethreatening illnesses articles research promises preventingslowing blindness from retinal disease affluent diet increases risk of heart disease general announcments publications for health professionals from national cancer institute publications for patients available from national cancer institute aids news summaries aids daily summary for april to april aids statistics worldwide aids statistics hicnet medical newsletter page ivolume number april centers for disease control and prevention mmwr rates of cesarean delivery united states source mmwr date apr cesarean deliveries have accounted for nearly million of the approximately million annual deliveries in the united states since table the cesarean rate in the united states is the third highest among reporting countries exceeded only by brazil and puerto rico this report presents data on cesarean deliveries from cdcs national hospital discharge survey nhds for and compares these data with previous years data on discharges from shortstay nonfederal hospitals have been collected annually since in the nhds conducted by cdcs national center for health statistics for medical and demographic information were abstracted from a sample of inpatients discharged from participating hospitals the cesareans and vaginal births after a prior cesarean vbac presented in this report are based on weighted national estimates from the nhds sample of approximately women discharged after delivery the estimated numbers of live births by type of delivery were calculated by applying cesarean rates from the nhds to live births from national vital registration data therefore estimates of the number of cesareans in this report will not agree with previously published data based solely on the nhds stated differences in this analysis are significant at the confidence level based on the twotailed ttest with a critical value of in there were cesareans per deliveries the same rate as in and similar to rates during table the primary cesarean rate ie number of first cesareans per deliveries to women who had no previous cesareans for also was stable ranging from to in the cesarean rate in the south was significantly p higher than the rates for the west midwest and northeast rates were higher for mothers aged greater than or equal to years than for younger women in proprietary hospitals than in nonprofit or government hospitals in hospitals with fewer than beds than in larger hospitals and for deliveries for which blue crossblue shield and other private insurance is the expected source of payment than for other sources of payment table the same pattern characterized primary cesarean deliveries since the early s the number and percentage of births to older women increased however if the age distribution of mothers in had remained the same as in the overall cesarean rate in would have been essentially the same as the observed based on the nhds of the approximately live births in an hicnet medical newsletter page volume number april estimated were by cesarean delivery of these an estimated births were repeat cesareans and were primary cesareans since approximately primary cesareans have been performed annually in of women who had a previous cesarean delivered vaginally compared with in of all cesareans in were associated with a previous cesarean with dystocia ie failure of labor to progress with breech presentation with fetal distress and with all other specified complications the average hospital stay for all deliveries in was days in comparison the hospital stay for a primary cesarean delivery was days and for a repeat cesarean days nearly twice the duration for vbac deliveries days or for vaginal deliveries that were not vbacs days in the average hospital stay for all deliveries was days for primary cesareans days for repeat cesareans days and for vbac and nonvbac vaginal deliveries and days respectively reported by office of vital and health statistics systems national center for health statistics cdc editorial note the cesarean rate in the united states steadily increased from through however the findings in this report indicate that rates have been stable since because there is little evidence that maternal and child health status has improved during this time and because cesareans are associated with an increased risk for complications of childbirth a national health objective for the year is to reduce the overall cesarean rate to or fewer per deliveries and the primary cesarean rate to or fewer per deliveries objective postpartum complications including urinary tract and wound infections may account in part for the longer hospital stays for cesarean deliveries than for vaginal births moreover the prolonged hospital stays for cesarean deliveries substantially increase healthcare costs for example in the average costs for cesarean and vaginal deliveries were and respectively the additional cost for each cesarean delivery includes for physician fees and for hospital charges if the cesarean rate in had been the year objective instead of the number of cesarean births would have decreased by versus resulting in a savings of more than billion in physician fees and hospital charges despite the steady increase in vbac rates since several factors may impede progress toward the year national health objectives for cesarean delivery for example vbac rates substantially reflect the number of women offered trial of labor which has been increasingly encouraged since of women who are offered a trial of labor could deliver vaginally a level already achieved by many hospitals trial of labor was routinely offered in of hospitals surveyed in the most recent year for which hicnet medical newsletter page volume number april national data are available when the vbac rate according to nhds data was the year objective specifies a vbac rate of based on all women who had a prior cesarean regardless of whether a trial of labor was attempted to reach the overall cesarean rate goal however increases in the vbac rate will need to be combined with a substantial reduction in the primary rate one hospital succeeded in reducing the rate of cesarean delivery by applying objective criteria for the four most common indications for cesarean delivery by requiring a second opinion and by instituting a peerreview process other recommendations for decreasing cesarean delivery rates include eliminating incentives for physicians and hospitals by equalizing reimbursement for vaginal and cesarean deliveries public dissemination of physician and hospitalspecific cesarean delivery rates to increase public awareness of differences in practices and addressing malpractice concerns which may be an important factor in maintaining the high rates of cesarean delivery references notzon fc international differences in the use of obstetric interventions jama graves ej nchs summary national hospital discharge survey hyattsville maryland us department of health and human services public health service cdc advance data no taffel sm placek pj kosary cl us cesarean section rates an update birth public health service healthy people national health promotion and disease prevention objectives full report with commentary washington dc us department of health and human services public health service dhhs publication no phs danforth dn cesarean section jama hospital insurance association of america table cost of maternity care physicians fees and hospital charges by census region based on consumer price index in source book of health insurance data washington dc hospital insurance association of america committee on obstetrics acog committee opinion no guidelines for vaginal delivery after a previous cesarean birth washington dc american college of obstetricians and gynecologists hicnet medical newsletter page volume number april rosen mg dickinson jc vaginal birth after cesarean a metaanalysis of indicators for success obstet gynecol shiono ph fielden jg mcnellis d rhoads gg pearse wh recent trends in cesarean birth and trial of labor rates in the united states jama myers sa gleicher n a successful program to lower cesareansection rates n engl j med use of trade names and commercial sources is for identification only and does not imply endorsement by the public health service or the us department of health and human serviceshicnet medical newsletter page volume number april malaria among us embassy personnel kampala uganda source mmwr date apr the treatment and prevention of malaria in africa has become a challenging and complex problem because of increasing drug resistance although the risk of acquiring malaria for us citizens and their dependents stationed overseas generally has been low this risk varies substantially and unpredictably during may the office of medical services department of state omsdos and cdc were notified of an increased number of malaria cases among official us personnel stationed in kampala uganda a review of the health records from the embassy health unit ehu in kampala indicated that cases of malaria were diagnosed in official personnel from march through june compared with two cases during the same period in ehu omsdos and cdc conducted an investigation to confirm all reported malaria cases and identify potential risk factors for malaria among us embassy personnel this report summarizes the results of the investigation malaria blood smears from of the reported casepatients were available for review by omsdos and cdc a case of malaria was confirmed if the slide was positive for plasmodium sp of the persons were slideconfirmed as having malaria a questionnaire was distributed to all persons served by the ehu to obtain information about residence activities use of malaria chemoprophylaxis and use of personal protection measures ie using bednets and insect repellents having window and door screens and wearing long sleeves and pants in the evening of the persons eligible for the survey responded risk for malaria was not associated with sex or location of residence in kampala although the risk for malaria was higher among children aged less than or equal to years than among persons greater than years this difference was not significant relative risk rr confidence interval ci eightytwo percent of the cases occurred among persons who had been living in kampala for years compared with those living there less than year travel outside of the kampala area to more rural settings was not associated with increased risk for malaria four malaria chemoprophylaxis regimens were used by persons who participated in the survey mefloquine chloroquine and proguanil chloroquine alone and proguanil alone in addition persons who responded were not using any malaria chemoprophylaxis the risk for malaria was significantly lower among persons using either mefloquine or chloroquine and proguanil than among persons using the other regimens or no prophylaxis rr ci twelve persons not using prophylaxis reported side effects or fear of possible side effects as a reason the risk for malaria was lower among persons who reported using bednets hicnet medical newsletter page volume number april all or most of the time than among persons who sometimes or rarely used bednets rr ci the risk for malaria was also lower among persons who consistently used insect repellent in the evening compared with those who rarely used repellent rr upper confidence limit risk for malaria was not associated with failure to have window or door screens or wear long sleeves or pants in the evening as a result of this investigation ehu staff reviewed with all personnel the need to use and comply with the recommended malaria chemoprophylaxis regimens ehu staff also emphasized the need to use personal protection measures and made plans to obtain insecticideimpregnated bednets and to provide window and door screens for all personnel reported by us embassy health unit kampala uganda office of medical svcs dept of state washington dc malaria br div of parasitic diseases national center for infectious diseases cdc editorial note in uganda the increase in malaria among us personnel was attributed to poor adherence to both recommended malaria chemoprophylaxis regimens and use of personal protection measures during a period of increased malaria transmission and intensified chloroquine resistance in subsaharan africa the findings in this report underscore the need to provide initial and continued counseling regarding malaria prevention for persons living abroad in malariaendemic areas preventive measures that are also important for shortterm travelers to such areas mefloquine is an effective prophylaxis regimen in africa and in most other areas with chloroquineresistant p falciparum however in some areas eg thailand resistance to mefloquine may limit its effectiveness in africa the efficacy of mefloquine compared with chloroquine alone in preventing infection with p falciparum is mefloquine is safe and well tolerated when given at mg per week over a year period the risk for serious adverse reactions possibly associated with mefloquine prophylaxis eg psychosis and convulsions is low ie episodes per users while the risk for less severe adverse reactions eg dizziness gastrointestinal complaints and sleep disturbances is similar to that for other antimalarial chemoprophylactics doxycycline has similar prophylactic efficacy to mefloquine but the need for daily dosing may reduce compliance with and effectiveness of this regimen chloroquine alone is not effective as prophylaxis in areas of intense chloroquine resistance eg southeast asia and africa in africa for persons who cannot take mefloquine or doxycycline chloroquine and proguanil is an alternative although less effective regimen chloroquine should be used for malaria prevention in areas only where chloroquineresistant p falciparum has not been reported countryspecific recommendations for preventing malaria and information hicnet medical newsletter page volume number april on the dosage and precautions for malaria chemoprophylaxis regimens are available from health information for international travel ie yellow book or hours a day by telephone or fax references lobel ho miani m eng t et al longterm malaria prophylaxis with weekly mefloquine in peace corps volunteers an effective and well tolerated regimen lancet world health organization review of central nervous system adverse events related to the antimalarial drug mefloquine geneva world health organization publication no whomal pang l limsomwong n singharaj p prophylactic treatment of vivax and falciparum malaria with lowdose doxycycline j infect dis pang l limsomwong n boudreau ef singharaj p doxycycline prophylaxis for falciparum malaria lancet cdc health information for international travel atlanta us department of health and human services public health service dhhs publication no cdchicnet medical newsletter page volume number april fda approval of use of a new haemophilus b conjugate vaccine and a combined diphtheriatetanuspertussis and haemophilus b conjugate vaccine for infants and children source mmwr date apr haemophilus influenzae type b hib conjugate vaccines have been recommended for use in infants since and their routine use in infant vaccination has contributed to the substantial decline in the incidence of hib disease in the united states vaccines against diphtheria tetanus and pertussis during infancy and childhood have been administered routinely in the united states since the late s and has been associated with a greater than reduction in morbidity and mortality associated with infection by these organisms because of the increasing number of vaccines now routinely recommended for infants a high priority is the development of combined vaccines that allow simultaneous administration with fewer separate injections the food and drug administration fda recently licensed two new products for vaccinating children against these diseases the haemophilus b conjugate vaccine tetanus toxoid conjugate acthib trademark for vaccination against hib disease only and a combined diphtheria and tetanus toxoids and wholecell pertussis vaccine dtp and hib conjugate vaccine tetramune trademark a combination of vaccines formulated for use in vaccinating children against diphtheria tetanus pertussis and hib disease acthib trademark on march the fda approved a new haemophilus b conjugate vaccine polyribosylribitol phosphatetetanus toxoid conjugate prpt manufactured by pasteur merieux serum et vaccins and distributed as acthib trademark by connaught laboratories inc swiftwater pennsylvania this vaccine has been licensed for use in infants in a threedose primary vaccination series administered at ages and months previously unvaccinated infants months of age should receive two doses months apart previously unvaccinated children months of age should receive one dose a booster dose administered at months of age is recommended for all children previously unvaccinated children months of age should receive a single dose and do not require a booster more than of infants receiving a primary vaccination series of acthib trademark consecutive doses at and months of age develop a geometric mean titer of antihaemophilus b polysaccharide antibody greater than ugml this response is similar to that of infants who receive recommended series of previously licensed haemophilus b conjugate vaccines for which efficacy has been demonstrated in prospective trials two us efficacy trials of prpt were terminated early because of the concomitant licensure of other haemophilus b conjugate vaccines hicnet medical newsletter page volume number april for use in infants in these studies no cases of invasive hib disease were detected in approximately infants vaccinated with prpt these and other studies suggest that the efficacy of prpt vaccine will be similar to that of the other licensed hib vaccines tetramune trademark on march the fda approved a combined diphtheria and tetanus toxoids and wholecell pertussis vaccine dtp and haemophilus b conjugate vaccine tetramune trademark available from lederlepraxis biologicals pearl river new york combines two previously licensed products dtp triimmunol registered manufactured by lederle laboratories pearl river new york and haemophilus b conjugate vaccine hibtiter registered manufactured by praxis biologics inc rochester new york this vaccine has been licensed for use in children aged months years for protection against diphtheria tetanus pertussis and hib disease when indications for vaccination with dtp vaccine and haemophilus b conjugate vaccine coincide based on demonstration of co mparable or higher antibody responses to each of the components of the two vaccines tetramune trademark is expected to provide protection against hib as well as diphtheria tetanus and pertussis equivalent to that of already licensed formulations of other dtp and haemophilus b vaccines the advisory committee for immunization practices acip recommends that all infants receive a primary series of one of the licensed haemophilus b conjugate vaccines beginning at months of age and a booster dose at age months the acip also recommends that all infants receive a fourdose primary series of diphtheria and tetanus toxoids and pertussis vaccine at and months of age and a booster dose at years a complete statement regarding recommendations for use of acthib trademark and tetramune trademark is being developed reported by office of vaccines research and review center for biologics evaluation and research food and drug administration div of immunization national center for prevention svcs meningitis and special pathogens br div of bacterial and mycotic diseases national center for infectious diseases cdc references adams wg deaver ka cochi sl et al decline of childhood haemophilus influenzae type b hib disease in the hib vaccine era jama broadhurst le erickson rl kelley pw decrease in invasive haemophilus influenzae disease in us army children through jama murphy tv white ke pastor p et al declining incidence of haemophilus influenzae type b disease since introduction of vaccination jama hicnet medical newsletter page volume number april fritzell b plotkin s efficacy and safety of a haemophilus influenzae type b capsular polysaccharidetetanus protein conjugate vaccine j pediatr acip haemophilus b conjugate vaccines for prevention of haemophilus influenzae type b disease among infants and children two months of age and older recommendations of the immunization practices advisory committee acip mmwr no rr acip diphtheria tetanus and pertussis recommendations for vaccine use and other preventive measures recommendations of the immunization practices advisory committee acip mmwr no rr acip pertussis vaccination acellular pertussis vaccine for reinforcing and booster use supplementary acip statement recommendations of the immunization practices advisory committee acip mmwr no rr acip pertussis vaccination acellular pertussis vaccine for the fourth and fifth doses of the dtp series update to supplementary acip statement recommendations of the immunization practices advisory committee acip mmwr no rr use of trade names and commercial sources is for identification only and does not imply endorsement by the public health service or the us department of health and human serviceshicnet medical newsletter page volume number april dental news international workshop explores oral manifestations of hiv infection nidr research digest written by jody dove march national institute of dental research at the second international workshop on the oral manifestations of hiv infection held january february in san francisco participants explored issues related to the epidemiology basic molecular virology mucosal immunology and oral clinical presentations of hiv infection the workshop was organized by dr john greenspan and dr deborah greenspan of the department of stomatology school of dentistry university of california san francisco an international steering committee and scientific program committee provided guidance the conference drew more than scientists from countries including asia africa europe central america south america as well as the united states and canada support tor the workshop was provided by the national institute of dental research the national cancer institute the national institute of allergy and infectious diseases the nih office of aids research and the procter and gamble company among the topics discussed were the epidemiology of hiv lesions ethics professional responsibility and public policy occupational issues provision of oral care to the hivpositive population salivary hiv transmission and mucosal immunity opportunistic infections pediatric hiv infection and womens issues recommendations recommendations emerged from the workshop to define the association between the appearance of oral lesions and rate of progression of hiv to establish a universal terminology for hivassociated oral lesions to look for more effective treatments for oral manifestations to expand molecular biology studies to understand the relationship between hiv infection and common oral lesions and to study the effects of hiv therapy on oral lesions epidemiology since the first international workshop on oral manifestations of hiv infection was convened five years ago the epidemiology of hiv infection has hicnet medical newsletter page volume number april radically changed in hiv infection was detected and reported largely in homosexual and bisexual males intravenous drug users and hemophiliacs today more hiv infection is seen in heterosexual males and females and in children and adolescents while the predominant impact of hiv infection has been felt in africa a major increase in infection rate is being seen in southeast asia as well five hundred thousand cases have been reported to date in this region and more are appearing all the time researchers are continuing to document the epidemiology of oral lesions such as hairy leukoplakia and candidiasis they also are beginning to explore the relationships between specific oral lesions and hiv disease progression and prognosis socialpolitical issues discussion on the social and political implications of hiv infection focused on changing the publics attitude that aids is retribution for indiscriminate sexual behavior and drug use speakers also addressed health care delivery for hivinfected patients and the need to educate the public about what aids is and how it is acquired saliva and salivary glands conference speakers described transmission issues and the hivinhibitory activity of saliva the strength of which varies among the different salivary secretions whole saliva has a greater inhibitory effect than submandibular secretions which in turn have a greater inhibitory effect than parotid secretions research has shown that at least two mechanisms are responsible for salivary inhibitory activity they attributed the hivinhibitory effect of saliva to the aggregationagglutination of hiv by saliva which may both promote clearance of virus and prevent it reaching a target cell and direct effects on the virus or target cells other topics discussed were the manifestation of salivary gland disease in hivinfected persons and current research on oral mucosal immunity pediatric issues pediatric aids recently has emerged as an area of intense interest with early and accurate diagnosis and proper treatment the life expectancy of hivinfected children has tripled the prevention of transmission of hiv from mother to child may be possible in many cases particularly if the mothers serostatus is known prior to giving birth periodontal and gingival tissue diseasehicnet medical newsletter page volume number april oral health researchers continue to explore periodontal diseases and gingivitis found in individuals with hiv infection recommendations made at the workshop include the standardization of terminology refinement of diagnostic markers standardization of study design and proper consideration of confounding variables resulting from periodontal therapy occupational and treatment issues occupational issues surrounding the treatment of hivinfected individuals and treatment rendered by hivinfected health care professionals still command considerable attention factors under consideration include the costbenefit of hiv testing patienttohealth care provider transmission of hiv infection and the reverse and the use of mainstream versus dedicated facilities for the treatment of hivinfected patients conference participants anticipate that a third international workshop on the oral manifestations of hiv infection will be held in five years or less proceedings from the second workshop will be published by the quintessence company in late end of part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom davidstatcom david dodellsubject hicn medical news part cut here hicnet medical newsletter page volume number april food drug administration news fda approves depo provera injectable contraceptive p food and drug administration for immediate release susan cruzan the food and drug administration today announced the approval of depo provera an injectable contraceptive drug the drug which contains a synthetic hormone similar to the natural hormone progesterone protects women from pregnancy for three months per injection the hormone is injected into the muscle of the arm or buttock where it is released into the bloodstream to prevent pregnancy it is more than percent effectivethis drug presents another longterm effective option for women to prevent pregnancy said fda commissioner david a kessler md as an injectable given once every three months depo provera eliminates problems related to missing a daily dosedepo provera is available in mg single dose vials from doctors and clinics and must be given on a regular basis to maintain contraceptive protection if a patient decides to become pregnant she discontinues the injectionsas with any such products fda advises patients to discuss the benefits and risks of depo provera with their doctor or other health care professional before making a decision to use itdepo proveras effectiveness as a contraceptive was established in extensive studies by the manufacturer the world health organization and health agencies in other countries us clinical trials begun in also found depo provera effective as an injectable contraceptivethe most common side effects are menstrual irregularities and weight gain in addition some patients may experience headache nervousness abdominal pain dizziness weakness or fatigue the drug should not be used in women who have acute liver disease unexplained vaginal bleeding breast cancer or blood clots in the legs lungs or eyesthe labeling advises doctors to rule out pregnancy before prescribing the drug due to concerns about low birth weight in babies exposed to the drug hicnet medical newsletter page volume number april recent data have also demonstrated that longterm use may contribute to osteoporosis the manufacturer will conduct additional research to study this potential effectdepo provera was developed in the s and has been approved for contraception in many other countries the upjohn company of kalamazoo mich which will market the drug under the name depo provera contraceptive injection first submitted it for approval in the united states in the s at that time animal studies raised questions about its potential to cause breast cancer worldwide studies have since found the overall risk of cancer including breast cancer in humans to be minimal if anyhicnet medical newsletter page volume number april new rules speed approval of drugs for lifethreatening illnesses p food and drug administration monica revelle the food and drug administration today announced that it will soon publish new rules to shed the approval of drugs for patients with serious or lifethreatening illnesses such as aids cancer and alzheimers disease these final rules will help patients who are suffering the most serious illnesses to get access to new drugs months or even years earlier than would otherwise be possible said hhs secretary louis w sullivan md the effort to accelerate fda review for these drugs has been a longterm commitment and indeed a hallmark of this administration these rules establish procedures for the food and drug administration to approve a drug based on surrogate endpoints or markers they apply when the drug provides a meaningful benefit over currently available therapies such endpoints would include laboratory tests or physical signs that do not in themselves constitute a clinical effect but that are judged by qualified scientists to be likely to correspond to real benefits to the patient use of surrogate endpoints for measurement of drug efficacy permits approval earlier than if traditional endpoints such as relief of disease symptoms or prevention of disability and death from the disease are used the new rules provide for therapies to be approved as soon as safety and effectiveness based on surrogate endpoints can be reasonably established the drugs sponsor will be required to agree to continue or conduct postmarketing human studies to confirm that the drugs effect on the surrogate endpoint is an indicator of its clinical effectiveness one new drug zalcitabine also called ddc was approved june using a model of this process for treating the human immunodeficiency virus hiv the cause of aids accelerated approval can also be used if necessary when fda determines that a drug judged to be effective for the treatment of a disease can be used safely only under a restricted distribution plan the new rules will help streamline the drug development and review process without sacrificing goad science and rigorous fda oversight said fda commissioner david a kessler md while drug approval will be accomplished faster these drugs and biological products must still meet safety and effectiveness standards required by law hicnet medical newsletter page volume number april the new procedures also allow for a streamlined withdrawal process if the postmarketing studies do not verify the drugs clinical benefit if there is new evidence that the drug product is not shown to be safe and effective or if other specified circumstances arise that necessitate expeditious withdrawal of the drug or biologichicnet medical newsletter page volume number april articles research shows promise for preventing or slowing blindness due to retinal disease national retinitis pigmentosa foundation neutrophilic factors rescue photoreceptor cells in animal tests baltimore md researchers at the university of california san francisco and regeneron pharmaceuticals inc nasdaq regn have discovered that certain naturally occurring substances known as neurotrophic factors can prevent the degeneration of lightsensing cells in the retina of the eye the degeneration of these cells known as photoreceptors is a major cause of visual impairment this research published to in the december issue of the proceedings of the national academy of science pnas holds promise for people who may lose their sight due to progressive retinal degeneration currently no drug treatment for retinal degeneration exists it is estimated that million americans have severe vision loss due to agerelated macular degeneration and americans are affected by retinitis pigmentosus a hereditary disease that causes blindness in addition each year more than people undergo surgical procedures to repair retinal detachments and other retinal traumas the research was funded in part by the rp retinitis pigmentosa foundation fighting blindness regeneron pharmaceuticals and the national eye institute it was conducted by drs matthew m lavail kazuhiko unoki douglas yasurnura michael t matthes and roy h steinberg at ucsf arld dr ceorge yancoooulos regenerons vice president for discovery regeneron holds an exclusive license for this research from ucsf in the research described in the pnas a lightdamage model was used to assess the survivalpromoting activity of a number of naturally occurring substances experimental rats were exposed to constant light for one week eyes that had not been treated with an effective factor lost most of their photoreceptor cells the rods and cones of the retina after light exposure brain derived neurotrophic factor bdnf and ciliary neurotrophic factor cntf were particularly effective in this model without causing unwanted side effects other factors such as nerve growth factor ngf and insulinlike growth factor igf were not effective in these experiments discussing the research dr jesse m cedarbaum regenerons director of clinical research said bdnfs ability to rescue neurons in the retina that have been damaged by light exposure may hold promise for the treatment of agerelated macular degeneration one of the leading causes of vision impairment and for retinal detachment following detachment permanent vision loss may hicnet medical newsletter page volume number april result frorn the death of detached retinal cells it is possible that bdnf could play a role in rescuing those cells once the retina has been reattached surgically retinitis pigmentosa is a slowly progressing disease that causes the retina to degenerate over a period of years or even decades vision decreases to a small tunnel of sight and can result in total blindness it is our hope that research on growth factors will provide a means to slow the progression and preserve useful vision throughout life stated jeanette s felix phd director of science for the rp foundation fighting blindness in addition to the work described regeneron is developing bdnf in conjunction with aingen inc nasdaqamgn as a possible treatment for peripheral neuropathies associated with diabetes and cancer chemotherapy motor neuron diseases parkinsons disease and alzheimers disease by itself regeneron is testing cntf in patients with arnyotrophic lateral sclerosis commonly known as lou gehrigs disease regeneron pharlnaceuticals inc based in tarrytown new york is a leader in the discovery and development of biotechnologybased compounds for the treatment of neurodegenerative diseases peripheral neuropathies and nerve injuries which affect more than seven million americans drs lavail and steinberg of ucsf are consultants to regeneronhicnet medical newsletter page volume number april affluent diet increases risk of heart disease research resources reporter written by mary weideman novdec national institutes of health highfat highcalorie diets rapidly increase risk factors for coronary heart disease in native populations of developing countries that have traditionally consumed diets low in fat these findings according to investigators at the oregon health sciences university in portland have serious implications for public health in both industrialized and developing countries this study demonstrates why we can develop coronary heart disease and have higher blood cholesterol and triglyceride levels it shows also the importance of diet and particularly the potential of the diet to increase body weight thereby leading to a whole host of other health problems in developing countries and affluent nations as well explains principal investigator dr william e connor head of the section of clinical nutrition and lipid metabolism at oregon health sciences university over the past years dr connor and his team have characterized the food and nutrient intakes of the tara humara indians in mexico while simultaneously documenting various aspects of tarahumara lipid metabolism these native mexicans number approximately and reside in the sierra madre occidental mountains in the state of chihuahua the tarahumaras have coupled an agrarian diet to endurance racing probably as a result coronary heart disease which is so prevalent in western industrialized nations is virtually non existent in their culture loosely translated the name tarahumara means fleet of foot reflecting a tribal passion for betting on kickball races in which participants run distances of miles or more while kicking a machetecarved wooden ball the typical tarahumara diet consists primarily of pinto beans tortillas and pinole a drink made of ground roasted corn mixed with cold water together with squash and gath ered fruits and vegetables the tara humaras also eat small amounts of game fish and eggs their food contains approximately percent of total calories as fat of which the majority percent is of vegetable origin dietician martha mcmurry a coinvestigator in the study describes their diet as simple and very rich in nutrients while low in cholesterol and fat the tarahumaras have average plasma cholesterol levels of mg dl lowdensity lipoprotein ldlcholesterol levels of mgdl and highdensity lipoprotein hdlcholesterol levels of to mgdl all of those values are in the good lowrisk range according to the researchers elevated cholesterol and ldlcholesterol levels are considered risk factors for heart hicnet medical newsletter page volume number april disease hdlcholesterol is considered beneficial in previous studies the tarahumaras had been found to be at low risk for cardiac disease although able to respond to highcholesterol diets with elevations in total and ldlcholesterol clinical research center dietitian mcmurry and coinvestigator maria teresa cerqueira established a metabolic unit in a jesuit mission school building near a community hospital in the small village of sisoguichi food was weighed cooked and fed to the study participants under the investigators direct supervision ensuring that subjects ate only food stipulated by the research protocol fasting blood was drawn twice weekly and plasma samples were frozen and shipped to dr connors laboratory for cholesterol triglyceride and lipoprotein analyses regular measurements included participant body weight height and triceps skin fold thickness thirteen tarahumaras five women and eight men including one adolescent were fed their native diet for week followed by weeks of an affluent diet in this study we went up to a concentration of dietary fat that was percent of total calories this is the prototype of the holiday diet that many americans consume a diet high in fat sugar and cholesterol low in fiber elaborates dr conners such dietary characteristics are reflected in the cholesterolsaturation index or csi recently devised research dietitian sonja conner working with dr connor the csi is a single number that incorporates both the amount of cholesterol and the amount of saturated fat in the diet csi indicates the diets potential to elevate the cholesterol level particularly the ldl dr connor explains the tarahumaran diet averages a very low csi of dr connors affluent diet used in the study ranks a csi of the experimental design of this study reflects the importance of establishing baseline plasma lipid levels typical of the native diet before exposing subjects to the experimental diet the standard curve relating dietary food intake to plasma cholesterol demonstrates a leveling off or plateau for consumption of large amounts of fat changes in dietary fat andor cholesterol in this range have little effect on plasma levels you must have the baseline diet almost free of the variables you are going to put into the experimental diet the framingham study for example did not discriminate on the basis of diet between individuals who got heart disease because the diet was already high in fat all subjects were already eating on a plateau dr connor says after weeks of consuming the affluent diet the subjects mean plasma cholesterol levels had in creased by percent primarily in the ldl fraction which rose percent hdlcholesterol increased by per cent and ldl to hdl ratios changed therefore very little plasma triglyceride levels increased by percent and subjects averaged an pound gain in weight according to dr connor lipid changes occurred surprisingly soon yielding nearly the same results after days of affluent diet as after days hicnet medical newsletter page volume number april the increase in hdl carries broad dietary implications for industrialized nations we think hdlcholesterol increased because we increased the amount of dietary fat over the fat content used in the previous tarahumara metabolic study in that study we saw no change in hdl levels after raising the dietary cholesterol but keeping the fat relatively consistent with native consumption in the present study we increased fat intake to percent of the total calories we reached the conclusion in the tarahumara study that hdl reflects the amount of dietary fat in general and not the amount of dietary cholesterol hdl must increase to help metabolize the fat and it increased quite a bit in this study dr connor explains low hdl in the tarahumarans is not typically an important predictor of coronary heart disease because they do not normally consume large amounts of fat or cholesterol hdl remains an important predictor to americans because of their usual high fat intake dr connor recommends a diet for americans that contains less than percent of total calories as fat less than mg of cholesterol and a csi around varying in accordance with caloric needs such a diet is low in meat and dairy fat high in fiber dr connor also comments on recent suggestions that americans adopt a mediterraneanstyle diet the original mediterranean diet in its pristine state consisted of a very low intake of fat and very few animal and dairy products we are already eating a lot of meat and dairy products simply to continue that pattern while switching to olive oil is not going to help the situation the world health organization who is focusing much attention on the emergence of diseases such as coronary heart disease in nations and societies undergoing technological development dr connor says that coronary heart disease starts with a given societys elite who typically eat a different diet than the average citizen if the pattern of afluence increases the entire population will have have a higher incidence of coronary heart disease which places a termendous health care burden on a society who would like the developing countries to prevent coronary heart disease so they can concentrate on other aspects of their economic development and on public health measures to improve general wellbeing rather than paying for unnecessary expensive medical technology dr connors says the overall implication of this study is that humans can readily move their plasma lipids and lipoprotein values into a highrisk range within a very short time by an affluent excessive diet the present rate of coronary heart disease in the united states is percent less than it was years ago so a lot has been accomplished we are changing rapidly he concludeshicnet medical newsletter page volume number april general announcments publications for health professionals available from nci unless otherwise noted the following materials are provided free of charge by calling the ncis publication ordering service cancer because federal government publications are not subject to copyright restriction you are free to photocopy nci material general information anticancer drug information sheets in spanishenglish two sided fact sheets in english and spanish provide information about side effects of common drugs used to treat cancer their proper usage and precautions for patients the fact sheets were prepared by the united states pharmacopeial convention inc for distribution by the national cancer institute single sets only may be ordered cancer rates and risks rd edition this book is a compact guide to statistics risk factors and risks for major cancer sites it includes charts and graphs showing incidence mortality and survival worldwide and in the united states it also contains a section on the costs of cancer pages diet nutrition cancer prevention a guide to food choices this booklet describes what is now known about diet nutrition and cancer prevention it provides information about foods that contain components like fiber fat and vitamins that may affect a persons risk of getting certain cancers it suggests ways to use that information to select from a broad variety of foodschoosing more of some foods and less of others includes recipes and sample menus pages national cancer institute fact book this book presents general information about the national cancer institute including budget data grants and contracts and historical information hicnet medical newsletter page volume number april national cancer institute grants process revised this booklet describes general nci grant award procedures includes chapters on eligibility preparation of grant application peer review eligible costs and post award activities pages physician to physician perspective on clinical trials this minute videocassette discusses why and how to enter patients on clinical trials it was produced in collaboration with the american college of surgeons commission on cancer students with cancer a resource for the educator revised this booklet is designed for teachers who have students with cancer in their classrooms or schools it includes an explanation of cancer its treatment and effects and guidelines for the young persons reentry to school and for dealing with terminally ill students bibliographies are included for both educators and young people pages understanding the immune system this booklet describes the complex network of specialized cells and organs that make up the human immune system it explains how the system works to fight off disease caused by invading agents such as bacteria and viruses and how it sometimes malfunctions resulting in a variety of diseases from allergies to arthritis to cancer it was developed by the national institute of allergy and infectious diseases and printed by the national cancer institute this booklet presents college level instruction in immunology it is appropriate for nursing or pharmacology students and for persons receiving college training in other areas within the health professions pages materials to help stop tobacco use chew or snuff educator package each package contains ten copies of chew or snuff is real bad stuff a brochure designed for seventh and eighth graders that describes the health and social effects of usinghicnet medical newsletter page volume number april smokeless tobacco products when fully opened the brochure can be used as a poster one copy of chew or snuff is real bad stuff a guide to make young people aware of the dangers of using smokeless tobacco this booklet is a lesson plan for teachers it contains facts about smokeless tobacco suggested classroom activities and selected educational resources how to help your patients stop smoking a national cancer institute manual for physicians this is a step bystep handbook for instituting smoking cessation techniques in medical practices the manual with resource lists and tearout materials is based on the results of nci clinical trials pages how to help your patients stop using tobacco a national cancer institute manual for the oral health team this is a handbook for dentists dental hygienists and dental assistants it complements the physicians manual and includes additional information on smoking prevention and on smokeless tobacco use pages pharmacists helping smokers quit kit a packet of materials to help pharmacists encourage their smoking patients to quit contains a pharmacists guide and selfhelp materials for patients school programs to prevent smoking the national cancer institute guide to strategies that succeed this guide outlines eight essential elements of a successful schoolbased smoking prevention program based on nci research it includes a list of available curriculum resources and selected references pages selfguided strategies for smoking cessation a program planners guide this booklet outlines key characteristics of successful selfhelp materials and programs based on nci collaborative research it lists additional resources and references pages smoking policy questions and answers these ten fact sheetshicnet medical newsletter page volume number april provide basic information about the establishment of worksite smoking policies topics range from the health effects of environmental tobacco smoke to legal issues concerning policy implementation strategies to control tobacco use in the united states a blueprint for public health action in the s smoking and control monograph no this volume provides a summary of what has been learned from years of a public health effort against smoking from the early trialand error health information campaigns of the s to the ncis sciencebased project american stop smoking intervention study for cancer prevention which began in it offers reasons why comprehensive smoking control strategies are now needed to address the smokers total environment and to reduce smoking prevalence significantly over the next decade materials for outreach programs cancer prevention and early detection community outreach programs for health professionals three kits are available for community program planners and health professionals to set up local cancer prevention and early detection education projects do the right thing get a new attitude about cancer community outreach program this community outreach kit targets black american audiences it contains materials to help health professionals conduct community education programs for black audiences the kit emphasizes the early detection of breast cancer by mammography and of cervical cancer by the pap test it also discusses smoking and nutrition the kit includes helpful program guidance facts news articles visuals and brochures hagalo hoy community outreach program this community outreach kit targets hispanic audiences it contains bilingual and spanish language materials to help health professionals conduct community education programs the materials educate hispanic audiences about early detection of breast cancer by mammographyhicnet medical newsletter page volume number april and of cervical cancer by pap tests the kit also discusses smoking and related issues the kit includes helpful guidance facts news articles visuals and brochures once a yearfor a lifetime community outreach mammography program this community outreach kit targets all women age or over it supplies community program planners and health professionals with planning guidance facts about mammography news articles visuals and brochures making health communication programs work a planners guide this handbook presents key principles and steps in developing and evaluating health communications programs for the public patients and health professionals it expands upon and replaces pretesting in health communications and making psas work pages support material for community outreach programs the video and slide presentations listed below support the mammography outreach programs once a yearfor a lifetime videotape this minute vhs videotape uses a dramatic format to highlight the important facts about the early detection of breast cancer by mammography una vez al anopara toda una vida videotape this minute spanish videotape informs spanishspeaking women of the need for medical screening particularly mammography it explains commonly misunderstood facts about breast cancer and early detection the program in a dramatic format features edward james olmos and cristina saralegui once a yearfor a lifetime speakers kit slide show this kit includes fullcolor slides and a number coded readytoread script suitable for a mammography presentation to a large group it addresses the misconceptions prevalent about mammography and urges women age and older to get regular mammograms so that breast cancer can be detected as early as possible kithicnet medical newsletter page volume number april includes a guide poster media announcement news feature flyer and pamphlets on mammography this kit is available directly by writing to modern park street north st petersburg fl end of part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom davidstatcom david dodellsubject hicn medical news part cut here call for employers to keep information about the hiv status of healthcare workers confidential but doctors who know of an hivpositive colleague who has not sought advice must inform the employing authority and the appropriate professional regulatory body the guidelines also emphasize the significance of notifying all patients on whom an invasive procedure has been done by an infected healthcare worker a model letter to patients who have come into contact with such an individual is provided along with suggestions for health officials on how to deal with the media in addition a uk advisory panel on hiv infection in healthcare workers has been formed to provide specific occupational recommendations to those treating such patients properties of an hiv vaccine nature vol no p volvovitz franklin and smith gale the questions raised by moore et al about recombinant gp envelope glycoprotein precursor from hiv produced by microgenesys are advantages rather than disadvantages write franklin volvovitz and gale smith of microgenesys in meriden conn moore et al says that gp in a baculovirus expression system does not bind strongly to the cd receptor and that this recombinant gp does not stimulate the same antibodies as the hiv virus does in natural infection but vaccination with recombinant gp in patients infected with hiv broadens hiv specific envelopedirected immune responses including crossreactive antibodies to gp epitopes and cd and cd cytotoxic tcell responses volvovitz and smith claim that they never intended their gp molecule to be identical to the native protein antibody responses against native hiv proteins including the types described by moore et al exist in nearly all aids patients but do not prevent hicnet medical newsletter page volume number april progression of hiv disease in addition the binding of gp or gpantibody complexes to cd has been shown to interfere with antigen specific activation of cd cells and trigger programmed cell death in vitro which may contribute to the pathogenesis of hiv infection the absence of cd binding by the microgenesys gp vaccine may therefore be viewed as an added safety feature phase i studies have demonstrated stable cd counts stimulation of cytotoxic t cells and the suggestion of restoration of immune function based on these and other clinical results microgenesys gp was chosen by researchers at the karolinska institute in sweden for the first phase iii vaccine therapy studies conclude volvovitz and smith hiv infection breast milk and hiv transmission lancet vol no p mok jacqueline there are still more questions than answers regarding hivpositive women breastfeeding their babies writes jacqueline mok of the lancet the antiinfective properties of milk are well documented while the numbers of leukocytes concentrations of lactoferrin and iga and lymphocyte mitogenic activity decline sharply during the first two to three months of lactation to barely detectable levels lactoferrin and iga then increase from three to twelve months with percent of total iga in milk being secretory iga breastfeeding protects infants against gastrointestinal and respiratory illnesses in both normal and uninfected children born to hivpositive mothers the italian national registry of aids discovered that breastfed hiv infected children had a longer median incubation time months than bottlefed infants months breastfed children also had a slower progression to aids there is no agreement on which antibodies offer protection against hiv infection studies of the biological properties of milk from hiv infected women showed the presence of igg and iga antibodies against envelope glycoproteins as well as iga antibodies against core antigens binding of hiv to the cd receptor can be inhibited by a human milk factor in the developing world where infectious disease and malnutrition contribute significantly to infant mortality breast milk is still the best food for infants regardless of the mothers hiv status transmission might be restricted by breastfeeding after colostrum and early milk have been expressed and discarded the possibility remains that breast milk could protect the infant who is already infected with hiv at birth and may even delay progression to aids concludes mok absence of hiv transmission from an infected dentist to his patients journal of the american medical association vol no p dickinson gordon m et al if universal precautions are practiced the risk of hiv transmission from dentist to patient appears to be infinitesimal write gordon m dickinson hicnet medical newsletter page volume number april et al of the university of miami school of medicine in miami fla the researchers contacted all patients treated by a dentist with aids and attempts were made to contact all patients for hiv testing living patients with newly detected hiv infection were interviewed and dna sequence analysis was performed to compare genetic relatedness of their hiv to that of the dentist death certificates were obtained for deceased patients and the medical records of those with diagnoses suggestive of hiv disease or drug abuse and those dying under the age of years were examined in detail there were patients who had undergone procedures of whom were deceased an examination of the death certificates of patients identified five who had died with hiv infection all of whom were either homosexuals or ivdrug users the researchers were able to detect of the remaining patients and agreed to be tested hiv infection was reported in five of the patients including four who had clear evidence of risk factors for the disease one patient who had only a single evaluation by the dentist denied highrisk behavior comparative dna sequence analysis showed that the viruses from the dentists and these five patients were not closely related the study suggests the potential for hiv transmission from a general dentist to his patients is minimal in a setting in which universal precautions are strictly observed conclude dickinson et al april aids patients are susceptible to recurrences of tb study says washington post p a tuberculosis can strike aids patients more than once which makes the resurging health hazard harder to control according to a study published in todays new england journal of medicine people who contract tb usually develop an immunity that protects them if they are exposed to the bacteria again but a person whose immune system is depleted may not be able to fight off a new tb infection doctors found peter m small of the howard hughes medical institute at stanford university director of the study said that in order to protect against reinfection it may be necessary for some people to use tb medicines permanently the study examined the genetic makeup of tb bacteria and how the germs changed over time in patients at kings county hospital in new york hiv infection breast milk and hiv transmission lancet vol no p mok jacqueline there are still more questions than answers regarding hivpositive women breastfeeding their babies writes jacqueline mok of the lancet the antiinfective properties of milk are well documented while the numbers of hicnet medical newsletter page volume number april leukocytes concentrations of lactoferrin and iga and lymphocyte mitogenic activity decline sharply during the first two to three months of lactation to barely detectable levels lactoferrin and iga then increase from three to twelve months with percent of total iga in milk being secretory iga breastfeeding protects infants against gastrointestinal and respiratory illnesses in both normal and uninfected children born to hivpositive mothers the italian national registry of aids discovered that breastfed hiv infected children had a longer median incubation time months than bottlefed infants months breastfed children also had a slower progression to aids there is no agreement on which antibodies offer protection against hiv infection studies of the biological properties of milk from hiv infected women showed the presence of igg and iga antibodies against envelope glycoproteins as well as iga antibodies against core antigens binding of hiv to the cd receptor can be inhibited by a human milk factor in the developing world where infectious disease and malnutrition contribute significantly to infant mortality breast milk is still the best food for infants regardless of the mothers hiv status transmission might be restricted by breastfeeding after colostrum and early milk have been expressed and discarded the possibility remains that breast milk could protect the infant who is already infected with hiv at birth and may even delay progression to aids concludes mok hiv and the aetiology of aids lancet vol no p duesberg peter because there is no proof that hiv is the cause of aids the hypothesis that drug use leads to aids will hopefully become a hindrance to the physiologically azt and psychologically positive aids test toxic public health initiatives writes peter duesberg of the university of californiaberkeley in the lancets march issue schechter et al call duesbergs hypothesis that injected and orally used recreational drugs and azt lead to aids a hindrance to public health initiatives however their hypothesis that hiv is the cause of aids has not attained any public health benefits the us government spends billion annually but no vaccine no therapy no prevention and no aids control have resulted from work on this hypothesis schechter et al conclude that hiv has a key role in cd depletion and aids based on epidemiological correlations with antibodies against hiv and with self reported recreational drug use among homosexuals from vancouver however their survey neglects to disprove duesbergs drugaids hypothesis because it does not provide controlsie confirmed drugfree aids casesand because it does not quantify drug use and ignores azt use altogether to refute duesbergs hypothesis schechter would have to produce a controlled study demonstrating that over a period of up to years hivpositive patients who use recreational drugs or azt or both have the same aids risks as positives who do not do so the year period is claimed by hicnet medical newsletter page volume number april proponents of the hiv hypothesis to be the time needed for hiv to cause aids alternatively they could show that hivfree individuals who have used drugs for years never get aidsdefining illnesses concludes duesberg rapid decline of cd cells after ifna treatment in hiv infection lancet vol no p vento sandro et al interferon ifn which induces autoantibodies and autoimmune diseases in some settings may hasten cd tcell loss in some hiv infected individuals through the amplification of harmful autoimmune reactions write sandro vento et al of the a pugliese hospital in catanzaro italy the researchers report three asymptomatic hiv infected individuals with hepatitis c virus related chronic active hepatitis cah who had a rapid profound decline of cd cells after ifn all three patients throughout the observation were consistently negative for serum hiv p antigen and had circulating antibodies to p sera from all three patients obtained at the end of ifn treatment and testing in enzymelinked immunosorbent assay contained high titres of antibodies reacting to a sequence located in the aminoterminal of the beta chain of all human hla class ii antigens homologous to a sequence located in the carboxy terminus of hiv gp these autoantibodies which also recognize native class ii molecules and may contribute to the elimination of cd t cells in vivo were at low tires in all three patients six months after stopping ifn such autoantibodies were not detected in other patients with hiv infection and hcv related cah treated with ifn and who did not experience cd tcell loss in some hiv infected individuals through the amplification of harmful autoimmune reactions the subjects had a b dr and b dr hla antigen combinations which are linked with a more rapid fall in cd cell counts and clinical progression of hiv disease ifn can induce a very rapid decline of cd cells and should be used cautiously in patients with these hla haplotypes the researchers conclude april tb makes a comeback state government news vol no p voit william and knapp elaine s although tuberculosis was once believed to be eliminated in the united states it is emerging again among the homeless aids patients immigrants minorities and prisoners dr lee b reichman professor of medicine at the university of new jersey medical school and president of the american lung association said right now its a big city problem but potentially its everyones problem the ala predicts that million americans are infected with tb and about percent of them will develop the disease because their immune systems are depressed especially those with aids or hiv gene hicnet medical newsletter page volume number april tammes a centers for disease control expert said that is why the cdc has issued guidelines warning hospitals and institutions not to mix aids with tb patients state health officials believe the tb is also spreading because those who are most susceptible are the least likely to follow through with treatment in addition the increase is attributed to a shortage of public health services in new york city tb is an epidemic because the number of cases is increasing faster than we can treat people said dr george diferdinando director of the new york state tb control according to diferdinando curbing the spread of tb entails keeping percent or more of diagnosed tb cases in treatment about percent of infected new york city residents dont complete therapy when tb patients dont finish taking their medication multidrug resistant tb can develop which requires taking more expensive drugs and can take two years instead of the normal six months to treat increasing frequency of heterosexually transmitted aids in southern florida artifact or reality american journal of public health vol no p nwanyanwu okey c et al the alarmingly high rate of heterosexually acquired aids cases in southern florida was partially related to misclassification of risk write okey c nwanyanwu et al of the centers for disease control in atlanta ga the researchers investigated such aids cases from broward and coastal palm beach counties all of these cases attributed to heterosexual transmission reported sexual contact with bisexual men injecting drug users or persons born in countries where heterosexual contact is the primary route of hiv transmission medical records of patients in addition to records from social services hiv counseling and testing centers and sexually transmitted disease std clinics were reviewed if no other hiv risk factor was found from medical record review patients were interviewed using a standardized questionnaire once std clinic and other medical records were reviewed men and women were reclassified into other hiv transmission categories after adjustments were made for the reclassification the percentage of aids cases reported from palm beach and broward counties between january and march that was attributed to heterosexual transmission decreased from percent to percent among men and from percent to percent among women while the percentage of heterosexually transmitted aids cases in southern florida decreased after adjustment was made for reclassified cases it still remained above the national average the researchers concludehicnet medical newsletter page volume number april aids statistics world health organization geneva organisation mondiale de la sante geneve weekly epidemiological record releve epidemiologique hebdomadaire january th year acquired immunodeficiency syndrome aids data as at december syndrome dimmunodeficience acquise sida donnees au decembre number date of of cases reportcountryarea nombre date paysterritoire de cas de notifi cationafrica afriquealgeria algerie angola benin benin botswana burkina faso burundi cameroon cameroun cape verde capvert central african republic republique centrafricaine chad tchad comoros comores congo cote divoire djibouti egypt egypte equatorial guinea guinee equatoriale ethiopia ethiopie hicnet medical newsletter page volume number april gabon gambia gambie ghana guinea guinee guineabissau guineebissau kenya lesotho liberia liberia libyan arab jamahiriya jamahiriya arabe libyenne madagascar malawi mali mauritania mauritanie mauritius maurice morocco maroc mozambique namibia namibie niger nigeria nigeria reunion reunion rwanda sao tome and principe sao tomeetprincipe senegal senegal seychelles sierra leone somalia somalie south africa afrique du sud sudan soudan swaziland togo tunisia tunisie uganda ouganda united republic of tanzania republiqueunie de tanzanie zaire zaire zambia zambie zimbabwe total hicnet medical newsletter page volume number april americas ameriquesanguilla antigua and barbuda antiguaetbarbuda argentina argentine bahamas barbados barbade belize bermuda bermudes bolivia bolivie brazil bresil british virgin islands iles vierges britanniques canada cayman islands iles caimanes chile chili colombia colombie costa rica cuba dominica dominique dominican republic republique dominicaine ecuador equateur el salvador french guiana guyane francaise grenada grenade guadeloupe guatemala guyana haiti haiti honduras jamaica jamaique martinique mexico mexique montserrat netherlands antilles and aruba antilles neerlandaises et aruba nicaragua panama paraguay peru perou hicnet medical newsletter page volume number april saint kitts and nevis saintkittsetnevis saint lucia saintelucie saint vincent and the grenadines saint vincentetgrenadines suriname trinidad and tobago triniteettobago turks and caicos islands iles turques et caiques united states of america etatsunis damerique uruguay venezuela total asia asieafghanistan bahrain bahrein bangladesh bhutan bhoutan brunei darussalam brunei darussalam burma see myanmar birmanie voir myanmarcambodia cambodge chinaa chinea cyprus chypre democratic peoples republic of korea republique populaire democratique de coree hong kong india inde indonesia indonesie iran islamic republic of iran republique islamique d iraq israel israel hicnet medical newsletter page volume number april japan japon jordan jordanie kuwait koweit lao peoples democratic republic republique democratique populaire lao lebanon liban macao malaysia malaisie maldives mongolia mongolie myanmar nepal nepal oman pakistan philippines qatar republic of korea republique de coree saudi arabia arabie saoudite singapore singapour sri lanka syrian arab republic republique arabe syrienne thailand thailande turkey turquie united arab emirates emirats arabes unis viet nam yemen yemen total europealbania albanie austria autriche belarus belarus belgium belgique bulgaria bulgarie czechoslovakia tchecoslovaquie denmark danemark finland finlande hicnet medical newsletter page volume number april france germany allemagne greece grece hungary hongrie iceland islande ireland irlande italy italie latvia lettonie lithuania lituanie luxembourg malta malte monaco netherlands paysbas norway norvege poland pologne portugal romania roumanie russian federation federation de russie san marino saintmarin spain espagne sweden suede switzerland suisse united kingdom royaumeuni yugoslaviab yougoslavieb total oceania oceanieamerican samoa samoa americaines australia australie cook islands iles cook federated states of micronesia etats federes de micronesie fiji fidji french polynesia polynesie francaise guam kiribati mariana islands iles mariannes marshall islands iles marshall nauru new caledonia and dependencies hicnet medical newsletter page volume number april nouvellecaledonie et dependances new zealand nouvellezelande niue palau papua new guinea papouasie nouvelleguinee samoa solomon islands iles salomon tokelau tonga tuvalu vanuatu wallis and futuna islands iles wallis et futuna total world total total mondial a the above statistics relating to china do not include cases of aids inthe province of taiwan les statistiques cidessus se rapportant a la chinene comprennent pas cas de sida dans la province de taiwanb refers to republics and areas of the former socialist federal republic ofyugoslavia bosnia and herzegovina croatia macedonia montenegroserbia slovenia se refere aux republiques et territoires de lanciennerepublique federative socialiste de yougoslavie bosnieherzegovine croatiemacedoine montenegro serbie slovenie hicnet medical newsletter page cut here this is the last part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom davidstatcom david dodellsubject hicn medical news part cut here once a yearfor a lifetime video kit this kit includes a minute vhs videotape that presents common misconceptions about mammography it tells of the benefits gains by the early detection of breast cancer jane pauley and phylicia rashad are the narrators kit includes a guide poster flyer and pamphlets on mammography this kit is available directly by writing to modern park street north st petersburg fl additional resources combined health information database chid a computerized bibliographic database developed and managed by agencies of the us public health service it contains references to health information and health education resources the database provides bibliographic citations and abstracts for journal articles books reports pamphlets audiovisuals product descriptions hardtofind information sources and health promotion and education programs under way in state and local health departments and other locations in addition chid provides source and availability information for these materials so that users may obtain them directly at present there are twentyone subfiles on chid the national cancer institute created the cancer patient education subfile in it serves as a resource for the chid user who is interested in identifying patient education programs for specific cancer patient populations as well as for the user who is trying to locate educational resources available for patient or family cancer education citations include the contact person at cancer centers so the user can follow up directly with the appropriate person to access chid check with your local library most medical school university hospital and public libraries subscribe to commercial database vendorshicnet medical newsletter page volume number april final report an integrated oncology workstation revised this book provides a conceptual overview of what a clinical information system for practicing oncologists might include a database of electronic patient chart records combined with access to a knowledge base of information resources such as pdq cancerlit and medlinean integration of data and knowledge combined to create a clinical oncology workstation the concept was developed as a means to assist the oncologist and his or her office staff in the daily management of patient care and clinical trials this book can be obtained by contacting dr robert esterhay project officer computer communications branch building room bethesda md scientific information services of the national cancer institute this booklet from the international cancer information center icic describes each icic product or service including scientific journals journal of the national cancer institute and nci monographs specialized current awareness publications cancergrams and oncology overviews and online databases pdq and cancerlit to obtain copies of the booklet write to international cancer information center dept jjj national cancer institute bldg rm bethesda maryland or fax your request to hicnet medical newsletter page volume number april publications for patients available from the nci free copies of the following patient education materials are available in single copy or bulk by calling the ncis publication ordering service cancer cancer prevention chew or snuff is real bad stuff this brochure designedfor seventh and eighth graders describes the health and socialeffects of using smokeless tobacco products when fully openedthe brochure can be used as a poster clearing the air a guide to quitting smoking thispamphlet designed to help the smoker who wants to quit offers avariety of approaches to cessation pages diet nutrition cancer prevention the good news thisbooklet provides an overview of dietary guidelines that mayassist individuals in reducing their risks for some cancers itidentifies certain foods to choose more often and others tochoose less often in the context of a total healthpromotingdiet pages why do you smoke this pamphlet contains a selftest todetermine why people smoke and suggests alternatives andsubstitutes that can help them stop early detection breast exams what you should know this pamphlet providesanswers to questions about breast cancer screening methodsincluding mammography the medical checkup breast selfexamination and future technologies includes instructions forbreast selfexamination pages cancer tests you should know about a guide for people and over this pamphlet describes the cancer tests important forpeople age and older it informs men and women of the examsthey should be requesting when they schedule checkups with theirdoctors it provides a checklist for men and women to recordwhen the cancer tests occur and it describes the steps to followhicnet medical newsletter page volume number april should cancer be found pages do the right thing get a mammogram this brochure targetsblack women age or older it describes the importance ofregular mammograms in the early detection of breast cancer itstates the nci guidelines for mammography once a year for a lifetime this brochure targets all womenage or older it describes the importance of regularmammograms in the early detection of breast cancer it statesthe nci guidelines for mammography questions and answers about breast lumps this pamphletdescribes some of the most common noncancerous breast lumps andwhat can be done about them includes instructions for breastselfexamination pages questions and answers about choosing a mammography facilitythis brochure lists questions to ask in selecting a qualitymammography facility also discusses typical costs and coverage testicular selfexamination this pamphlet containsinformation about risks and symptoms of testicular cancer andprovides instructions on how to perform testicular selfexamination the pap test it can save your life this easytoreadpamphlet tells women the importance of getting a pap test itexplains who should request one how often it should be done andwhere to go to get a pap test general research reports indepth reports covering currentknowledge of the causes and prevention symptoms detection anddiagnosis and treatment of various types of cancer individualreports are available on the following topics bone marrow transplantation cancer of the colon and rectum cancer of the lung cancer of the pancreas melanomahicnet medical newsletter page volume number april oral cancers the immune system how it works this booklet written ata high school level explains the human immune system for thegeneral public it describes the sophistication of the bodysimmune responses the impact of immune disorders and therelation of the immune system to cancer therapies present andfuture pages what you need to know about cancer this series ofpamphlets discusses symptoms diagnosis treatment emotionalissues and questions to ask the doctor includes glossary ofterms and other resources individual pamphlets are available onthe following topics bladder bone brain breast cervix colon and rectum dysplastic nevi esophagus hodgkins disease kidney larynx lung melanoma multiple myeloma nonhodgkins lymphoma oral cancers ovary pancreas prostate skin testis uterus patient education anticancer drug information sheets in spanishenglish twosided fact sheets in english and spanish provide informationabout side effects of common drugs used to treat cancer theirhicnet medical newsletter page volume number april proper usage and precautions for patients the fact sheets wereprepared by the united states pharmacopeial convention inc fordistribution by the national cancer institute single sets onlymay be ordered advanced cancer living each day this booklet addressescoping with a terminal illness by discussing practicalconsiderations for the patient the family and friends pages chemotherapy and you a guide to selfhelp duringtreatment this booklet in questionandanswer format addressesproblems and concerns of patients receiving chemotherapyemphasis is on explanation and selfhelp pages eating hints recipes and tips for better nutrition duringcancer treatment this cookbookstyle booklet includes recipesand suggestions for maintaining optimum nutrition duringtreatment all recipes have been tested pages facing forward a guide for cancer survivors this bookletpresents a concise overview of important survivor issuesincluding ongoing health needs psychosocial concerns insuranceand employment easytouse format includes cancer survivorsexperiences practical tips recordkeeping forms and resourcesit is recommended for cancer survivors their family andfriends pages patient to patient cancer clinical trials and you thisminute videocassette provides simple information for patientsand families about the clinical trials process produced incollaboration with the american college of surgeons commission oncancer questions and answers about pain control a guide forpeople with cancer and their families this booklet discussespain control using both medical and nonmedical methods theemphasis is on explanation selfhelp and patient participationthis booklet is also available from the american cancer society pages radiation therapy and you a guide to selfhelp duringtreatment this booklet addresses concerns of patients receivingforms of radiation therapy emphasis is on explanation andselfhelp pageshicnet medical newsletter page volume number april taking time support for people with cancer and the peoplewho care about them this sensitively written booklet forpersons with cancer and their families addresses the feelings andconcerns of others in similar situations and how they have coped pages what are clinical trials all about this booklet isdesigned for patients who are considering taking part in researchfor new cancer treatments it explains clinical trials topatients in easytounderstand terms and gives them informationthat will help them decide about participating pages when cancer recurs meeting the challenge again thisbooklet details the different types of recurrence types oftreatment and coping with cancers return pages breast cancer education series breast biopsy what you should know this booklet discusses biopsy procedures it describes what to expect in the hospital and while awaiting a diagnosis pages breast cancer understanding treatment options this booklet summarizes the biopsy procedure and examines the pros and cons of various types of breast surgery it discusses lumpectomy and radiation therapy as primary treatment adjuvant therapy and the process of making treatment decisions pages mastectomy a treatment for breast cancer this booklet presents information about the different types of breast surgery it explains what to expect in the hospital and during the recovery period following breast cancer surgery breast selfexamination for mastectomy patients is also described pages after breast cancer a guide to followup care this booklet is for the woman who has completed treatment it explains the importance of checking for possible signs of recurring cancer by receiving regular mammograms getting breast exams from a doctor and continuing monthly breast selfexams it offers advice for managing the physical and emotional side effects that may accompany surviving breasthicnet medical newsletter page volume number april cancer pages pediatric cancer education series help yourself tips for teenagers with cancer this magazinestyle booklet is designed to provide information and support to adolescents with cancer issues addressed include reactions to diagnosis relationships with family and friends school attendance and body image pages hospital days treatment ways this hematologyoncology coloring book helps orient the child with cancer to hospital and treatment procedures pages managing your childs eating problems during cancer treatment this booklet contains information about the importance of nutrition the side effects of cancer and its treatment ways to encourage a child to eat and special diets pages talking with your child about cancer this booklet is designed for the parent whose child has been diagnosed with cancer it addresses the healthrelated concerns of young people of different ages it suggests ways to discuss diseaserelated issues with the child pages when someone in your family has cancer this booklet is written for young people whose parent or sibling has cancer it includes sections on the disease its treatment and emotional concerns pages young people with cancer a handbook for parents this booklet discusses the most common types of childhood cancer treatments and side effects and issues that may arise when a child is diagnosed with cancer offers medical information and practical tips gathered from the experience of others pages spanish language publications si desea hablar con un especialista en informacion sobre elcancer por favor llame al cancer cancer preventionhicnet medical newsletter page volume number april a time of changede nina a mujer this bilingual fotonovela was developed specifically for young women it discusses various health promotion issues such as nutrition no smoking exercise and pelvic pap and breast examinations pages datos sobre el habito de fumar y recomendaciones para dejar de fumar this bilingual pamphlet describes the health risks of smoking and tips on how to quit and how to stay quit pages guia para dejar de fumar this booklet is a fullcolor selfhelp smoking cessation booklet prepared specifically for spanishspeaking americans it was developed by the university of california san francisco under an nci research grant pages early detection hagase la prueba pap hagalo hoypor su salud y su familia this bilingual brochure tells women why it is important to get a pap test it gives brief clear information about who needs a pap test where to go to get one and how often the pap test should be done hagase un mamograma una vez al anopara toda una vida this bilingual brochure describes the importance of mammograms in the early detection of breast cancer it gives brief information about who is at risk for breast cancer how a mammogram is done and how to get one la prueba pap un metodo para diagnosticar cancer del cuello del utero this booklet in spanish answers questions about the pap test including how often it should be done significance of results and other diagnostic tests and treatments pages lo que usted debe saber sobre los examenes de los senos this booklet in spanish explains the importance of the three actions recommended by the nci to detect breast cancer as early as possible requesting regular mammography getting an annual breast exam from the doctor and performing a monthly breast selfexam pageshicnet medical newsletter page volume number april preguntas y respuestas sobre la seleccion de un centro de mamografia this brochure lists questions and answers to ask in selecting a quality mammography facility patient education anticancer drug information sheets in spanishenglish two sided fact sheets in english and spanish provide information about side effects of common drugs used to treat cancer their proper usage and precautions for patients the fact sheets were prepared by the united states pharmacopeial convention inc for distribution by the national cancer institute single sets only may be ordered datos sobre el tratamiento de quimioterapia contra el cancer this flyer in spanish provides a brief introduction to cancer chemotherapy pages el tratamiento de radioterapia guia para el paciente durante el tratamiento this booklet in spanish addresses the concerns of patients receiving radiation therapy for cancer emphasis is on explanation and selfhelp pageshicnet medical newsletter page volume number april aids news summaries aids daily summary for april to april the centers for disease control and prevention cdc national aids clearinghouse makes available the following information as a public service only providing this information does not constitute endorsement by the cdc the cdc clearinghouse or any other organization reproduction of this text is encouraged however copies may not be sold copyright information inc bethesda md april absence of hiv transmission from an infected orthopedic surgeon journal of the american medical association vol no p von reyn c fordham the risk of hiv transmission from an hivpositive surgeon to patient is extremely low provided that the surgeon strictly adheres to universal infection control procedures write c fordham von reyn et al of the dartmouthhitchcock medical center in lebanon nh the researchers contacted former patients on whom an hivpositive orthopedic surgeon performed invasive procedures between january and june the orthopedic surgeon voluntarily withdrew from practice after testing positive for hiv a total of former patients underwent hiv testing representing percent of patients on whom the orthopedic surgeon performed invasive procedures during the year period patients were tested from each year and from each category of invasive procedure all patients were found to be negative for hiv by enzymelinkedimmunosorbent assay two former patients reported known hiv infection prior to surgery the examination of aids case registries and vital records neglected to detect cases of hiv infection among former surgical patients the estimated cost of the initial patient notification and testing was with the single most expensive activity being counseling and testing this accounted for percent of the total expense the patient notification and testing were conducted while maintaining the confidentiality of the orthopedic surgeon who was an active participant in the planning and execution of the study notifying patients of the infected surgeons hivstatus is both disruptive and expensive and is not routinely recommended the researchers conclude investigation of potential hiv transmission to the patients of an hivinfected surgeon journal of the american medical association vol hicnet medical newsletter page volume number april no p smith rogers audrey et al the risk of hiv transmission during surgery is so remote that it will be quantified only by gathering data from multiple methodologically similar investigations writes audrey smith rogers et al of the johns hopkins university school of medicine in baltimore md the researchers identified a total of persons in hospital databases who underwent invasive surgical procedures between and and for whom the hivpositive surgeon was listed as the operating surgeon the aids case registries were reviewed for all patients having undergone invasive procedures and death certificates were obtained among the patients were dead had no address had test results known and did not respond to the questionnaire no study patient name was found in reported aids case registries one newly detected hivpositive patient was determined to have been most probably infected in during a transfusion there was no hiv transmission in personhours of surgical exposure suggesting that hiv transmission to patients is unlikely to occur more frequently than once per personhours of surgical exposure the researchers determined there is no evidence to suggest that the surgeon failed to adhere to standard infectioncontrol guidelines over percent of the patients with invasive procedures chose to be tested and of those whose results were revealed only one person was found to be infected with hiv the study patients infection was probably the result of a tainted blood transfusion received in as a result there is no evidence that the transmission of hiv from the hivpositive surgeon to any patient transpired the researchers conclude april drug concerns to share aids data new york times p c kolata gina a total of major pharmaceutical companies have decided in a highly unusual move to share aids drugs and information while the drugs are undergoing early clinical testing dr edward scolnick president of the merck research laboratory in rahway nj arranged the collaboration he said that cooperation between companies seemed increasingly significant as it had become clear that combinations of drugs were likely to be more effective in fighting hiv than any drug used alone the researchers are hopeful that hiv when faced with a combination of several drugs requiring mutation at different sites for resistance to develop will be unable to evolve all the mutations at the same time therefore several drugs taken together or one after the other could halt the spread of hiv currently the drug companies do not know what other drugs their competitors are developing the new agreement allows companies to routinely exchange animal data and safety data on new aids drugs an agreement like this will greatly facilitate hicnet medical newsletter page volume number april companies ability to choose the best drug combinations much faster and in a much more efficient way said scolnick he also said that the collaboration would not violate antitrust laws in creating the agreement merck spoke frequently to members of aids advocacy groups including actup dr daniel hoth director of the division on aids at the national institute of allergy and infectious disease said were delighted to see the pharmaceutical industry take this step because we think that increasing the information flow will likely accelerate the discovery of better compounds for aids related stories wall street journal p b philadelphia inquirer p a usa today p b the next step in aids treatment nature vol no p maddox john although azt was found to be ineffective in prolonging the lives of people infected with hiv the findings do not indicate that azt should not be administered in people with fullblown aids writes columnist john maddox azt has been used in the united states in asymptomatic hivpositive people on the basis that administration of the drug appeared to abate the decline of tcell counts however a report in the lancet demonstrated that azt should not be used early in the course of disease while the cd counts of the people given azt were consistently greater than those of patients receiving only placebo the first three years of followup have shown that the proportions of people in the two groups progressing to overt aids or even to death were not significantly different at roughly percent the conclusions are that azt is not an effective aids drug in hivinfected individuals and that cd cell count may not be a reliable proxy for the progression to aids in infected people but nothing is implied by the study of the utility of azt in the treatment of those in whom symptoms have already appearedthere is no case for abandoning that treatment at least on the evidence now available it is much more alarming that the cd count has proven to be an unreliable mark of the efficacy of drug treatment in hiv infection aids researchers should acknowledge hiv is alive from the beginning of infection and turn it into a workable assay of the progress of disease the general application of such an assay will probably in itself provide a better understanding of the pathogenesis of aids concludes maddox infective and antiinfective properties of breastmilk from hivinfected women lancet vol no p van de perre philippe et al a vaccine preparation inducing a persistent immune response of the igm type in the mothers body fluids could be valuable to prevent transmission of hiv from mother to child write philippe van de perre et al of the hicnet medical newsletter page volume number april national aids control program in kigali rwanda the researchers hypothesized that transmission of hiv through breastmilk could be favored by the presence of infected cells by deficiency of antiinfective substances in breastmilk or both factors a total of hivinfected women were enrolled at delivery in kigali rwanda milk samples were collected days months and months post partum hiv igg secretory iga and igm were assayed by western blot for the latter two after removal of igg with protein g in the day and month samples the researchers sought viral genome in milk cells by double polymerase chain reaction with three sets of primers gag pol and env at days months and months post partum hiv specific igg was detected in percent percent and percent of breastmilk samples iga in percent percent and percent and igm in percent percent and percent in children who survived longer than months the risk of infection was associated with lack of persistence of igm and iga in their mothers milk the presence of hivinfected cells in the milk days post partum was strongly predictive of hiv infection in the child by both univariate and multivariate analysis the combination of hiv infected cells in breastmilk and a defective igm response was the strongest predictor of infection igm and iga antihiv in breastmilk may protect against postnatal transmission of hiv the researchers conclude april firms to share aids research in global venture journal of commerce p a a total of fifteen us and european pharmaceutical companies announced tuesday they will swap drug supplies and information on earlystage aids research to hasten the search for combination therapies to fight hiv infection and aids the companies said the unusual move resulted primarily from the increasing concentration of aids research on combination therapies since realizing that hiv is likely to develop resistance to every individual aids drug edward scolnick president of merck co research laboratories led the collaborative effort that took a year of negotiations to come together said participants in addition to merck the other companies involved in the intercompany collaboration for aids drug development are bristolmyers squibb co burroughs wellcome glaxo inc hoffmanla roche eli lilly co pfizer inc smithkline beecham ab astra du pont merck syntex inc boehringer ingelheim miles inc and sigmatau the participants said that all companies involved in aids drug development they were aware of had joined the collaboration and that any company actively involved in hiv antiviral development may participate scolnick said the collaborators would most likely meet every couple of months for a daylong scientific meeting where they will review for one another their preclinical hicnet medical newsletter page volume number april and early clinical data the american foundation for aids research amfar was pleased with the news of the collaboration which it hopes will lead to the development of drug combinations that will reduce viral resistance related story financial times p guidance over hivinfected healthcare workers lancet vol no p horton richard the united kingdoms department of health recently followed the advice of aids experts that there is no scientific reason for routine hiv testing among healthcare workers following recent highly publicized reports of health professionals who contracted hiv the department issued revised guidelines on the management of such cases dr kenneth calman chief medical officer said doctors dentists nurses and other healthcare workers have an ethical duty to seek advice if they have been exposed to hiv infection including if appropriate diagnostic hiv testing he said infected health care workers should not perform invasive procedures that carry even a remote risk of exposing patients to the virus the guidelines end of part internet davidstatcom fax bitnet atwhasuacad fidonet amateur packet ax wbtpywbtpyazusanafrom ronrothrosecom ron rothsubject frequent nosebleedsa from some of the replies to my original posting its evident that somea people do not secrete enough mucous to keep their nose lining protected include small amounts of hot spicy foods with your meals its not a cure but many people find it helpful to create extra mucus you may also consider taking a few drops of iodine in juice or water consult your doctor first which is available otc in canada if you have a sedentary lifestyle exercising sometimes helpsa from environmental influences ie dry air but ive had no responsesa from anyone with experience with rutin is there another newsgroup that a might have specifics on herbal remediesa a robert allison i tried to email you but our board is having internet problems so im not sure whether you got the information on rutin or not rutin is not a herb but part of the bioflavonoid complex you should generally not take rutin by itself but take the whole bioflavonoid complex instead if you dont and there are some exceptions to that youll eventually create a hesperidin deficiency which is the other major component of the bioflavonoid complex i found out the hard way years ago when i recommended rutin after it showed deficient in patients who were not deficient in hesperidin be fore a later retest almost always showed a subsequent deficiency in hesperidin which from then on made me always add bioflavonoids to anyone that had very low levels of rutin most of the time people are equally low in rutin and hesperidin so there is really no reason to take rutin by itself but use the whole bioflavonoid complex instead i have several thousand patients taking them with many claiming that they had been helped with hemorrhoids varicose veins chronic nose bleeds aneurysms gastrointestinal bleeding due to drugs etc one patient in desperation took a whole bottle s in one day for his painful bleeding hemorrhoids without any ill effects they are also nontoxic in very high amounts thats why they can be safely recommended if you are allergic to citrus fruit they are made from their peels pine bark sources are available as well about of patients tested show a bioflavonoid deficiency with the average daily dosage needed being about mg for major complaints mgday is common in case they cannot be taken because of their size and taste they are big and they dont taste that great a product made from pine bark extract gives you the same effect and the tablets are quite small and taste much better however the cost is about seven times higher for the equivalent effect one mg tablet of the pine bark extract gives you about the same effect as mg of bioflavonoids the name for the pine bark product is pycnogenol some canadian brands carrying bioflavonoids are questmg big bitter not chewable swiss herbalmg smooth easier swallowing jamiesonmg medium bitter chewable sisumg pycnogenol small easy swallowing give them a try and see what happensand good luck ron roth internet rnrosecom rosenet ron rothrosehamilton eating radium has strange results tom said brightly rosereader p entered at rosehamilton rosemail usenet rose media hamilton from kxgstpittedu kenneth gilbertsubject re pregnency without sexin article stephenmont stephenmontcsmissouriedu stephen montgomerysmith writeswhen i was a school boy my biology teacher told us of an incidentin which a couple were very passionate without actually havingsexual intercourse somehow the girl became pregnent as spermcells made their way to her through the clothes via persperationwas my biology teacher misinforming us or do such incidents actuallyoccursounds to me like someone was pulling your leg there is only one way forpregnancy to occur intercourse these days however there is alsoartificial insemination and implantation techniques but were speaking ofnatural acts here it is possible for pregnancy to occur if semen isdeposited just outside of the vagina ie coitus interruptus but thatsabout at far as you can get through clothes no way better go talkto your biology teacher kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from ipjunixbrightonacuk fleg software subject artificial intelligence in medicineif you have any information on artificial intelligence in medicine then iwould appreciate it if you could mail me with whatever it is the informationsis needed for a projectthank you ian ian jukes bsc computer science hons year the university of brighton janet email ipjukacbtonunix ipjukacbtonvms from rfmpsuvmpsuedusubject sleep in hospitals was re euse of haldol in elderlyin article yfqmlekivcolandrewcmuedu you say ive seen people in their forties and fifties become disoriented anddemented during hospital stays in the examples ive seen drugs weredefinitely involved speaking from experience one doesnt need drugs to become disorientedduring hospital stays i was in hosp for days in late jan what withgeneral noise at all hours of night staff coming every time i turned overor whatever to check me out i didnt get much sustained sleep at nightspent days groggy dozing and all it was from my perspective was that iwas tired bobm lets reinvent hospital organizationssubject re localized fat reduction due to exercise questionfrom rginzbergeaglewesleyanedu ruth ginzbergin aprmnemosynecsduedu hchungnyxcsduedu writes i was just wondering if exercises specific to particular regions of the body such as thighs will basically only tone the thighs or if fat from other parts of the body such as breasts would be affected just as muchthere are two different mechanisms here toning of muscles and reduction offat exercises specific to particular muscles will tone only those musclesexercised example look at differences in arm circumferences between pitchingarms and nonpitching arms in major league pitchers however if exercisealso leads to reduction of body fat the loss of body fat will be equallydistributed over the entire body there is no way to spot reduce body fatother than surgically through liposuction distribution of body fat isgenetically determined sometimes a very flabby muscle will look like fatso when that muscle gains some muscle tone it may appear as though the fatis changing into muscle but really fat and muscle tissues are totallyseparate and one does not ever change into the otherruth ginzberg rginzbergeaglewesleyaneduphilosophy departmentwesleyan universityusafrom gpivarmaestromitreorg greg pivarniksubject re krillean photographyin article aprscorchapanaorgau billscorchapanaorgau bill dowding writes todamhypcharlesunlvedu brian m huey writes i think thats the correct spelling i am looking for any informationsupplies that will allow doityourselfers to take krillean pictures im thinking that education suppliers for schools might have a appartus for sale but i dont know any of the companies any info is greatly appreciated krillean photography involves taking pictures of minute decapods resident in the seas surrounding the antarctic or pictures taken by them perhaps bill from oz billno flame intended but youre way way off base in simple terms kirilianphotography registers the electromagnetical fields around objects in simpleit takes pictures of your aura greg be still be silentthe rest is easy from dhfncrdfnalgov don husbysubject re krillean photographypoor persons kirlian photography try this at home hold your hand up to a cold window look closely at the stunning corona effects around your fingertips remove hand from window and observe after image invent crackpot theory to explain the effectfrom rindenterprisebihharvardedu david rindsubject re candidayeast bloom fact or fictionin article aprvmsocomokstateedu banschbachvmsocomokstateedu writesi dont like the term quack being applied to a licensed physician davidquestionable conduct is more appropriately called unethicalin my opinion using laetril to treat cancer patients when such treatment has been shown to be ineffective and dangerouscyanide release by the ncihmm this is certainly among the things i would refer to as quacktherapy and would tend to refer to any practitioner who prescribedlaetrile whether licensed or not as a quack there are unethicalbehaviors such as ordering unneccessary tests to increase feeswhich i would not lable as quackish but prescribing known ineffectivetherapies seems to me to be one of the hallmarks of a quack david rindrindenterprisebihharvardedufrom garywscbnewsgcbattcom garyschuettersubject a good place for back surgery hello just one quick question my father has had a back problem for a long time and doctors have diagnosed an operation is needed since he lives down in mexico he wants to know if there is a hospital anywhere in the united states particulary famous for this kind of surgery kind of like houston has a reputation for excellent doctors in eye surgery any additional info or pointers will be appreciated a whole lot thanks in advance gary sheutter att bell labsfrom rindenterprisebihharvardedu david rindsubject re quackquack was re candidayeast bloom fact or fictionin article ravpeinnahgapcaltechedu kenisiscnscaltechedu ken miller writesso if you have any evidence against the hypothesis for examplecontrolled doubleblind studies showing that the antifungals dont do anybetter than sugar water then lets hear it if you dont then what wehave is anecdotal and uncontrolled evidence on one side and abjectdisbelief on the otheri dont have any evidence against water from lourdes curing ms im sure there is anecdotal evidence that it does do you really thinkthat in the absence of a doubleblind study i should be indifferentto the hypothesis that water from lourdes cures msfor what its worth i know of only one double blind study of nystatinfor candida hypersensitivity syndrome it was published in the new england journal i think and showed no benefit on systemicsymptoms though i think it reduced vaginal yeast infections notsurprisingly as i recall the yeast crowd had some major objectionsto the study though i dont remember what they were david rindrindenterprisebihharvardedufrom jtpouporundergradmathuwaterlooca jeff pouporesubject re barbecued foods and health riskhithought id add something to the conversation my girlfriend used to work in a lab studying different natural carcinogensshe mentioned once about the cancerous effect of barbecued foodbasically she said that if you eat barbecued foods with strawberriesa natural carcinogen the slight carcinogenic properties of bothcancel out each otherjeff pouporejtpouporundergradmathuwaterlooca jeff pouporejtpouporundergradmathuwaterloocafrom tronesdxcerncernch jostein lodve tronessubject re krillean photographyin article aprlinusmitreorg gpivarmaestromitreorg greg pivarnik writes in article aprscorchapanaorgau billscorchapanaorgau bill dowding writes krillean photography involves taking pictures of minute decapods resident in the seas surrounding the antarctic or pictures taken by them perhaps bill from oz bill no flame intended but youre way way off base in simple terms kirilian photography registers the electromagnetical fields around objects in simple it takes pictures of your aura greg be still be silentthe rest is easy gregno flame intended but i think you just missed one of the rare attempts ofhumor in sciskeptickrillean against kirilian get itbtw i think youre a bit of base yourself since to my knowledge theelectromagnetic field around a stone is rather abscent but still a stonehas a nice aura on the kirilian photographsdont remember excactly but corona discharge i think is a more fittingexpression than aura think youll find something on this in the skepticfaqcheersjosteinfrom starkdwovaxenetdeccom todd i starksubject re ocdthis is to followup my previous reply on this topic which it has beenpointed out to me might have been dangerously misleading in two spots i stated that psychotherapy meaning talking therapy and so on was used to treat obsessive compulsive disorder which though sometimes true is misleading it is not often found effective particularly by itself primary treatment today usually consists at least in part of drug therapy the most current theories of this condition attribute it to more to biological causes than psychological in places where this distinction becomes important i mentioned that the dsmiiir mentions impulses as a possible diagnostic marker however this might look like somethingpeople associate with psychotic conditions uncontrollable orunpredictable behaviors which is not the case with ocd one of the diagnostic criteria of ocd is that the individualcan and does suppress some of their impulses although theyare an unending source of anxiety the obsessive thoughts and ritualistic actions usually associated with ocd are most frequently very mundane and predictable closer toa superstitious nature than a dangerous nature for the most partsome references one nontechnical and several technicalthat someone was kind enough to supply for mebut was unable to post themself the boy who couldnt stop washing by judith rapaport technical refs pharmacotherapy of oc disorderdonna m jermain and lynn crismonpharmacotherapy epidemiology of ocdseteven a rasmussen and jane eisenj clin psychiatry supplthe waking nightmare an overview of ocdjudith l rapoportj clin psychiatry supplabsence of placebo response in ocdmatig r mavissakalian bruce jones stephen olsonj nerv ment disease vol no and thanks very much to those who supplied constructive criticism to my first post on ocd i hope this helps clarifythe parts that were misleadingkind regardstodd todd i stark starkdwovaxenetdeccom digital equipment corporation philadelphia pa usa a word is the skin of a living thought olliver wendell holmes jr from mechalasgnecnpurdueedu john p mechalassubject re krillean photographyin article rgnnllifnnewsfnalgov dhfncrdfnalgov don husby writespoor persons kirlian photography try this at home hold your hand up to a cold window look closely at the stunning corona effects around your fingertips remove hand from window and observe after image invent crackpot theory to explain the effectadvanced kirlian photography try this at home too get a camera have your subject face you with hisher back to the sun take photo observe the glow behind their silhouetted image on the photo invent crackpot theory to explain the effect john mechalas im not an actor butmechalasgnecnpurdueedu i play one on tvaero engineering purdue university include disclaimerhfrom starkdwovaxenetdeccom todd i starksubject re mind machinesin article csnwwgatriposcom homertriposcom webster homer writesi recently learned about these devices that supposedly induce specific brain wave frequencies in their users simply by wearing them the principle underlying these devices is a well establish principle inpsychology called entrainment whereby external sensory stimuliinfluence gross electrical patterns of brain functionthey are experimental in that people experiment with them and theyare not widely if at all used in medicine for therapeutic purposes given the exception of tens and similar units used for external electrical stimulation usually for pain relief not really a light and sound machinethey are not experimental in the sense of a specific medical category to that effect as with experimental drugs as the fda does not specifically regulate medical devices in the way it does pharmaceuticals i would think that if they work as reported they would be incredibly usefulthere are few reliable studies of therapeutic or enhancement effectsfor mind machines other than those relaxationrelated effects found with meditation or selfhypnosis as well reported benefits are mostly anecdotal andsubjective so far so its hard to generalize about their potential valuea pretty good general nontechnical introduction to a wide varietyof these devices may be found in would the buddha wear a walkman some interesting background material names of suppliers and capsule reviewsof specific equipment do these mind machines aka light and sound machines work can they inducealpha theta andor delta waves in a person wearing them what research ifany has been done on them could they be used in lieu of a tranquilizeror are they just another bit of quackerya more important question might be whether they have enough additionalvalue to be worth investing in biofeedback was found to be a legitimateand reliable effect experimentally under certain conditions in thatit demonstrated that we can influence physiological processes previously considered purely autonomic but never panned out as a particularly valuable therapeutic tool because of the skill level required and the subtlety andtemporary nature of the effects in most cases maybe someone else has more there used to be a whole mailing list devoted to mind machinessomewhere on the netweb homerhomertriposcomkind regardstodd todd i stark starkdwovaxenetdeccom digital equipment corporation philadelphia pa usa a word is the skin of a living thought olliver wendell holmes jr from carlsolgpscaltechedu carl j lydicksubject re krillean photographyin article aprlinusmitreorg gpivarmaestromitreorggreg pivarnik writesin article aprscorchapanaorgau billscorchapanaorgau bill dowding writes todamhypcharlesunlvedu brian m huey writes i think thats the correct spelling i am looking for any informationsupplies that will allow doityourselfers to take krillean pictures im thinking that education suppliers for schools might have a appartus for sale but i dont know any of the companies any info is greatly appreciated krillean photography involves taking pictures of minute decapods resident in the seas surrounding the antarctic or pictures taken by them perhaps bill from oz billno flame intended but youre way way off base in simple terms kirilianphotography registers the electromagnetical fields around objects in simpleit takes pictures of your auragreg flame definitely intended here bill was making fun of the misspelling go look up the word krill also the correct spelling is kirlian itinvolves taking photographs of corona discharges created by attaching thesubject to a highvoltage source not of some aura it works equally wellwith inanimate objectscarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itfrom julieeddiejplnasagov julie kangassubject re is msg sensitivity superstitionin article ckrltdartvaxdartmouthedu oldmancoosdartmouthedu prakash das writesin article aprllyenejplnasagov julieeddiejplnasagov julie kangas writesas for how foods taste if im not allergic to msg and i likethe taste of it why shouldnt i use it saying i shouldnt useit is like saying i shouldnt eat spicy food because my neighborhas an ulcerjulie it doesnt necessarily follow that you should use it msg orsomething else for that matter simply because you are not allergicto it for example you might not be allergic to animal fats andlike their taste yet it doesnt follow that you should be using themregularly msg might have other bad or good i am not up on knowledge of msg effects on your body in the long run maybe thatsreason enough not to use it perhaps i should quit eating mushrooms soya beans and brie cheesewhich all have msg in them it occurs naturallyim not going to quit eating something that i like just becauseit might cause me trouble later or causes problems in somepeople i would much rather avoid stress by not worrying overwhat goes in my mouth and not spending every day reading conflictingreports of what is goodbad for youi may eat some things in quantities that may not be good for mefine ive made my decision and i dont think its appropriatefor anyone to try to convert me its for your own good arethe most obnoxious and harmful words imo in the english orany other languagealtho your example of the ulcer is funny it isnt anappropriate comparison at alli think it is i get tired of people saying dont eat x becauseits bad well x may not be bad for everyone and even ifit is so what give people all the information but dont ramyour decisions down their throatsjuliedisclaimer all opinions here belong to my cat and no one elsefrom banschbachvmsocomokstateedusubject re candidayeast bloom fact or fictionin article rgobethsdndevharvardedu rindenterprisebihharvardedu david rind writes in article aprvmsocomokstateedu banschbachvmsocomokstateedu writesi dont like the term quack being applied to a licensed physician davidquestionable conduct is more appropriately called unethicalin my opinion using laetril to treat cancer patients when such treatment has been shown to be ineffective and dangerouscyanide release by the nci hmm this is certainly among the things i would refer to as quack therapy and would tend to refer to any practitioner who prescribed laetrile whether licensed or not as a quack there are unethical behaviors such as ordering unneccessary tests to increase fees which i would not lable as quackish but prescribing known ineffective therapies seems to me to be one of the hallmarks of a quack david rindone of the responsibilities of a licensed physician is to read the medical literature to keep up with changes in medical practice all the clamor over laetril resulted in the nci spending quite a bit of money on clinical trials which provedto me anyway that laetril was ineffective against cancer a physician who continued to use it when better more effective treatments are available may deserve to be called a quack antifungals are in a different class the big question seems to be is it reasonable to use them in patients with gi distress or sinus problems that could be due to candida blooms following the use of broadspectrum antibiotics gorden rubenfeld through email has assured me that most physicians recognize the chance of candida blooms occuring after broadspectrum antibiotic use and they therefore reinnoculate their patients with good bacteria to restore competetion for candida in the body i do not believe that this is yet a standard part of medical practice he deals with critical care patients where fungal infectionsystemic is a real problem and just because he tries to keep good bacteria in his patients does not mean that all physicians do this i think that aspergillis is more likely to be found in the sinus mucus membranes than is candida women have been known for a very long time to suffer from candida blooms in the vagina and a women is lucky to find a physician who is willing to treat the cause and not give give her advise to use the otc antifungal creams since candida colonizes primarily in the anorectal area gi symptoms should be more common than vaginal problems after broadspectrum antibiotic usethe problem we have here david is proof that gi discomfort can be caused by a candida bloom the arguement is that without proof no action is warrentedmedicine has not and probalby never will be practiced this way there has always been the use of conventional wisdom a very good example is kidney stones conventional wisdombecause clinical trails have not been done to come up with an effective prevention was that restricitng the intake of calcium and oxalates was the best way to prevent kidney stones from forming clinical trials focused on drugs or ultrasonic blasts to breakdown the stone once it formed through the recent new england j of medicine article we now know that conventional wisdom was wrong increasing calcium intake is better at preventing stone formation than is restricting calcium intakethe conventional wisdom in animal husbandry has been that animals need to be reinnoculated with good bacteria after coming off antibiotic therapyif it makes sense for livestock why doesnt it make sense for humans david we are not talking about a dangerous treatmentunless you consider yogurt dangerous if this were a standard part of medical practice as gordon r says it is then the incidence of gi distress and vaginal yeast infections should declinemarty bfrom chorleyvmsocomokstateedusubject cs gas and allergic response questhis question derives from the waco incidentcould cs gas particles create an allergic response which would result in laryngospasm and asphyxiation especially in childrendnc in okosucom will disavow my opinion and my existence if necessaryfrom mmeyermdsegticom mark meyersubject re krillean photographyin article aprscorchapanaorgau billscorchapanaorgau bill dowding writes krillean photography involves taking pictures of minute decapods resident in the seas surrounding the antarctic or pictures taken by them perhapsin article aprlinusmitreorg gpivarmaestromitreorg greg pivarnik writes no flame intended but youre way way off base in simple terms kirilian photography registers the electromagnetical fields around objects in simple it takes pictures of your auragreg no flame intended but you have no discernible sense ofhumor what bill wrote was intended to be funny its called ajoke greg look into itbesides kirilian photography is actually photography of myfriends twoyearold son kiril perhaps you meant kirlian mark meyer mmeyerdsegticom texas instruments inc plano tx every day jerry junkins is grateful that i dont speak for ti you have triggered primary defense mechanism blast affirmativefrom subject re barbecued foods and health riskin article csqvedbacsubuffaloedu sfegusubvmccbuffaloedu wrote in article cupportalcom mmmcupportalcom mark robert thorson writes an odd exception to the rule seems to be the product known as gumbo file this is nothing more than coarsely ground dried sassafras leaves this is not only a natural product but a natural product still in its natural form so maybe thats how they evade delany or maybe a special exemption was made to appease powerful louisiana democratsone possible reason is that file is made with sassafras leaves while rootbeer was made with sassafras bark or root bark the leaves contain eithernoor less saffrole than the barkthere is also some sort of treatment which putatively removes saffrole fromsassafras products i have some concentrated sassafras tea extract whichisclaimed to have the saffrole removed i think what we have to keep in mind is that even though it may be illegal to commercially producesell food with carcinogenic substances it is not illegal for people to do such to their own food smoking etc is this truewell the last time that i went to the store to buy sassafras bark to make root beer there was a sign saying that it wasnt sold for humanconsumptionalso when i asked the person if they had wild cherry bark and wintergreenbarkshe made a point of telling me that i couldnt buy sassafras for human consumptioni find the fact that some people reckless enough to step into an automobilelivein fear of dropping dead because of a pork rib quite funny in a sick wayeric pepke internetpepkegwscrifsuedusupercomputer computations research institute mfenet pepkefsuflorida state university span scripepketallahassee fl bitnet pepkefsudisclaimer my employers seldom even listen to my opinionsmetadisclaimer any society that needs disclaimers has too many lawyersfrom nigeldatamandemoncouk nigel ballardsubject re mind machines i use a zygon mind machine as bought in the usa last year althoughits no wonder cure for what ails you it is however very good atstopping you thinkingsound strange well suppose youre tired and want to go to bedsleepbut your head is full of niggling problems to resolve you lay in thebed and quickly they all come to the surface churning around from oneunresolved thing to the next and then back again been there boughtthe tshirti slip on the zygon and select a soothing pattern of light sound andquickly i just cant concentrate on the previous stuff your brainscache kinda gets flushed and you start on a whole new set of stuffa useful addition is the facility to feed the output of a tape playeror cd through the box i use new age elevator muzak to enhance theoverall effectdeffo better than a pillcheers nigel nigel ballard int nigeldatamandemoncouk im pink bournemouth uk cis radioghoi therefore im spam from ncraycom jim knollsubject patti dukes problemdoes anyone have information about the struggles that pattiduke went through in her personal life with severe mood swingsdid she have some form of chemical imbalance that triggeredthese problems i recall that she wrote a book about her troublesdoes someone have the title of that bookfrom jgecsuncedu john eylessubject tick fever aka rocky mtn spottedany rocky mountain spotted fever experts out there the doctor thinks a friend might have thisthe question is doesnt the tick have to bite you you frequently find a tick crawling on you after a walkin the woods around here but you tend to notice it beforeit bites you pulling one out of your skin is somethingyoure not likely to forgetcan you get the fever without it biting you do theysometimes bite you and then let go so you dont realizeyou were bitten i know they will let go once theyve hadtheir fill but you certainly would notice this argghso how do you get the fever if you never pulled a tickoff yourself as opposed to finding one merely crawlingon you john eylesjgecsuncedufrom renee rmecornelledusubject chelation therapydoes anyone here know anything about chelation therapy using edta myuncle has emphesema and a doctor wants to try it on him we arewondering if is there any evidence edta chelation therapy is beneficial for hiscondition or any condition what possible side effects are there how can they be mimimizedplease respond via email to rmecornelleduthanksreneefrom twaincarsonuwashingtonedu barbara hlavinsubject re patti dukes problemin article aprhemlockcraycom ncraycom writesdoes anyone have information about the struggles that pattiduke went through in her personal life with severe mood swingsdid she have some form of chemical imbalance that triggeredthese problems i recall that she wrote a book about her troublesdoes someone have the title of that bookshes published two books about her manicdepressive illness call me anna the autobiography of patty duke patty duke and kenneth turan bantam books anda brilliant madness living with manicdepressive illness patty duke and gloria hochman bantam books barbara from uabdpodpouabedugila stephen hollandsubject re annual inguinal hernia repairin article jpcavdmsmsfcnasagov jpcavdmsmsfcnasagovj porter clark wrotesynopsis young man with inguianl hernia on one side repaired now hasnew hernia on other side what gives he asks and he continues of course my wife thinks its from sitting for long periods of time at the computer reading newsthere is the possibility that there is some degree of constipation causingchronic straining which has caused the bowel movements the classic problems that are supposed to be looked for in someone with a hernia areconstipation chronic cough colon cancer and youre not too young forthat and sitting for long periods of time at the computer reading newsgood luck with your surgerysteve hollandfrom ajagalenmedvirginiaedu amir anthony jazaerisubject re heat shock proteinsby the way ms olmstead dna is not degraded in the stomach norunder ph of its degraded in the duodenum under approxneutral ph by dnaase enzymes secreted by the pancreas mypoint check your facts before yelling at other people for notdoing so just a friendly suggestionaaj from lmtrautsamdahlcom leon traistersubject celery and hypertensionsomewhere or other i read that when a person of chinese heritage wastold that he had high blood pressure he responded by eating celerysorry i dont recall the dosage apparently this is supposed towork in reducing hypertensioncan anyone out there verify this and if it does work does anyoneknow the appropriate amounts and possible sideeffectsthanksleon traister lmtrautsamdahlcomfrom drapergndwtpgtefsdcom pam drapersubject re opinions on allergy hay fever shotsin article icbalasuacadbitnet icbalasuacadbitnet writesyou might look for an allergy doctor in your area who uses sublingualdrops instead of shots for treatment you are given a small bottle ofantigens drops are placed under the tongue for minutes mythis homeopathic remedies i tried the dander one for a month drops three times a day i didnt notice any change whats so ever how long were you using the drops before you noticed a differencefor me this treatment is more expensive because my insurance will cover tradiitional medicinefrom lumensalublamaredusubject precocious puberty am looking for network access to recent research into treatments forprecocious puberty if you know of specifics would appreciate email i have plenty of general textbook type references have a niece whosedaughter is afflicted the mother is an rn and has done a ratherexhaustive search of printed material pls email suggestions to lumensalublamareduthanx dale parish orange texas is the surface of a planet thelamars token perpetual student proper place for a developing voxrecdat industrial civilizationfrom rindenterprisebihharvardedu david rindsubject re candidayeast bloom fact or fictionin article aprvmsocomokstateedu banschbachvmsocomokstateedu writesare in a different class the big question seems to be is it reasonable to use them in patients with gi distress or sinus problems that could be due to candida blooms following the use of broadspectrum antibioticsi guess im still not clear on what the term candida bloom meansbut certainly it is well known that thrush superficial candidalinfections on mucous membranes can occur after antibiotic usethis has nothing to do with systemic yeast syndrome the quackdiagnosis that has been being discussedfound in the sinus mucus membranes than is candida women have been known for a very long time to suffer from candida blooms in the vagina and a women is lucky to find a physician who is willing to treat the cause and not give give her advise to use the otc antifungal creamslucky how since a recent article randomized controlled trial oforal yogurt on reducing vaginal candidiasis ive mentioned to a number of patients with frequent vaginal yeast infections that theycould try eating ounces of yogurt daily it turns out most wouldrather just use antifungal creams when they get yeast infectionsyogurt dangerous if this were a standard part of medical practice as gordon r says it is then the incidence of gi distress and vaginal yeast infections should declineagain this just isnt what the systemic yeast syndrome is about andhas nothing to do with the quack therapies that were being discussedthere is some evidence that attempts to reinoculate the gi tract withbacteria after antibiotic therapy dont seem to be very helpful inreducing diarrhea but i dont think anyone would view this as aquack therapy david rindrindenterprisebihharvardedufrom rhallernsuoregonedu rich hallersubject resound hearing aids and othersi have a fairly severe high frequency hearing loss a recent rough testshowed a gently sloping loss to db down at cps then it falls offa cliff to dbs down from cps on this type of loss is difficultto fit i am currently using some old siemens behind the ear aids whichkeep me roughly functional but leave a lot to be desiredrecently i had an opportunity to test the widex q behind the ear aids forseveral weeks these have four independent programs which are intended tobe customized for different hearing situations and can be reprogramed ifound them to be a definite improvement over my current aids and was aboutto go ahead with them until another local outfit advertised a free trial ofanother programmable system called resoundunfortunately i was only able to try the resound aids in their office forabout minutes and i couldnt compare them head to head with the widexnevertheless it did appear to me that they were superior and i wasimpressed by what i was able to read about the theory behind them which iwill give in a separate posting they also carry the widex aids and had onepatient presumably wealthy who decided to go ahead and get the resoundeven though he had purchased the widex only months agothe problem is that the resound aids are about twice as expensive as thewidex and other programmable aids i could take a trip to europe on thedifference being a lover of bargains and hating to spend money i amhaving a hard time persuading myself to go with the resounds i wouldappreciate any opinions on this and other hearing aids and projectionsabout when and if i might see improvements in technology that arent quiteso expensiverich haller rhallernsuoregonedu university of oregon eugene orusafrom andersomspotcoloradoedu marc andersonsubject re discussions on altpsychoactivesin article fpzyswbomvnuandrewcmuedu charles d nichols cnpandrewcmuedu writesfrom herzogsierralblgov hanan herzogsubject discussions on altpsychoactivesdate apr gmt could the people discussing recreational drugs such as mj lsd mdma etctake their discussions to altdrugs their discussions will receive greatestcontribution and readership there the people interested in strictlysmart drugs ie nootropics should post to this group the two groupsaltdrugs altpsychoactives have been used interchangably latelyi do think that altpsychoactives is a deceiving name altpsychoactivesis supposedly the smart drug newsgroup according to newsgroup lists onthe usenet should we establish an altnootropics or altsdn smart drugs nutrients i have noticed some posts in scimednutrition regardingsmart nutrients we may lower that groups burden as welli beg to disagree with you on this subject if i recall correctlyaltdrugs was being flodded by posts like how do i grow mj how do iuse a bong wow man i just had the coolest trip etc there werequite a few people out there who were versed in pharmacology and biologywho wanted to discuss centrally active substabces at a higher levelwithout all the other crap filling the bandwidth i would suggestthat you proceed to create a newsgroup dedicated to nootropics if youmust have one dedicated to them and leave altpsychoactives to thediscussion of psychoactives including nootropics which are but a smallportion of the realm of centrally active substancesi was wondering if a group called scipharmacology would be releventthis would be used for a more formal discussion about pharmacologicalissues pharmacodynamics neuropharmacology etcjust an informal proposal i dont know anything about the netpoliticsfor adding a newsgroup etcmore altpsychoactives stuff deletedmarcandersomspotcoloradoedufrom rhallernsuoregonedu rich hallersubject resound hearing aid theory as i understand itthe following is based on copies i was given of some articles published inhearing instruments i would appreciate any comments about this and othernew technology for hearing aidsthe resound system was developed on the basis of some research at att andappears to take a different approach from other aids it appears to me thata new programmable aid like the widex just uses a more flexible andprogrammable version of the classical approach of amplifying some parts ofthe spectrum more than others and adding some compression to try and helpout in noisy situationsthe major difference in the resound approach is that it divides thespectrum into low and high frequencies splitting point is programmableapparently based on the fact that lots of vowel information can be found inthe low frequencies while the important consonant informationunfortunately for me is in the high frequencies the two bands then aretreated with different compression schemes which are programable they havealso developed a new fitting algorythm that builds on what they callabnormal growth of loudnessthis latter is interesting and fits my own personal experience though ithink the phrase is missleading what appears to be the case is that as youexceed the minimum threshold for a person with hearing loss the deficitbecomes progresslively less compared to normals and by the time you reachthe too loud point the sensitivity curves appear to converge this meansthat if you just boost all sound levels you are overloading at the highend for people with hearing losses hence what you want is progressivelyless amplification as the signal get closer to the maximum tolerable pointyou want to boost low volume sounds more than high and do so potentiallydifferently for the low and high frequency parts of the spectrum speciallyfor someone like me who is relatively normal up to cps and then fallsoff a cliffaids with simple compressors dont descriminate between energy in the lowand high frequencies and can therefor compress useful high frequencyinformation because of high volume of low frequency componentsparticularly impressive was the resound performance with whispered speechand in simulated restaurant noise situations rich haller rhallernsuoregonedu university of oregon eugene orusafrom nodroghardyuwashingtonedu gordon rubenfeldsubject re candidayeast bloom fact or fictionbanschbachvmsocomokstateedu writesto candida blooms following the use of broadspectrum antibiotics gorden rubenfeld through email has assured me that most physicians recognize the chance of candida blooms occuring after broadspectrum antibiotic use and they therefore reinnoculate their patients with good bacteria to restore competetion for candida in the body i do not believe that this is yet a standard part of medical practice nor is it mine what i tried to explain to marty was that it is clearlyunderstood that antibiotic exposure is a risk factor for fungal infections which is not the same as saying bacteria prevent fungal infections marty made this sound like a secret known only to veternarians andbiochemists anyone who has treated a urinary tract infection knownsthis at some centers preop liver transplant patients receive boweldecontamination directed at retaining good anaerobic flora in an attemptto prevent fungal colonization in this soontobe high risk group i alsouse lactobacillus to treat enteral nutrition associated diarrhea that maybe in part due to alterations in gut flora however it is not part ofmy routine practice to reinnoculate patients with good bacteria afterantibiotics i have seen no data on this practice preventing or treatingfungal infections in at risk patients whether or not it is a logicalextension from the available observations ill leave to those of you whobase strong opinions and argue over such speculations in the absence ofclinical trials one place such therapy has been described is in treating particularlyrecalcitrant cases of c difficile colitis not a fungal infection thereare case reports of using stool ie someone elses enemas to repopulatethe patients flora dont try this at home not give give her advise to use the otc antifungal creams since candida colonizes primarily in the anorectal area gi symptoms should be more common than vaginal problems after broadspectrum antibiotic use except that it isnt at least symptomatically apparent diseasemedicine has not and probalby never will be practiced this way there has always been the use of conventional wisdom a very good example is kidney stones conventional wisdombecause clinical trails have not been done to come up with an effective prevention was that restricitng the intake of calcium and oxalates was the best way to prevent kidney stones from forming clinical trials focused on drugs or ultrasonic blasts to breakdown the stone once it formed through the recent new england j of medicine article we now know that conventional wisdom was wrong increasing calcium intake is better at preventing stone formation than is restricting calcium intake seems like this is an excellent argument for ignoring anecdotalconventional wisdom a euphemism for no data and doing a good clinicaltrial like au dismukeswe wadejs leejy dockerybk hainjdti a randomized doubleblind trial of nystatin therapy for the candidiasis hypersensitivity syndrome see commentsso nengljmed dec p psychological tests results the three activetreatment regimens and the allplacebo regimen significantly reduced both vaginal and systemic symptoms p less than but nystatin did not reduce the systemic symptoms significantly more than placebo conclusions in women with presumed candidiasis hypersensitivity syndrome nystatin does not reduce systemic or psychological symptoms significantly more than placebo consequently the empirical recommendation of longterm nystatin therapy for such women appears to be unwarranted does this trial address every issue raised here no jon noring was notsurprised at this negative trial since they didnt use sporanox despitecrooks recommendation for nystatin maybe they didnt avoid thosecarbohydrates the conventional wisdom in animal husbandry has been that animals need to be reinnoculated with good bacteria after coming off antibiotic therapyif it makes sense for livestock why doesnt it make sense for humans david we are not talking about a dangerous treatmentunless you consider yogurt dangerous if this were a standard part of medical practice as gordon r says it is then the incidence of gi distress and vaginal yeast infections should decline marty youve also changed the terrain of the discussion from empiricitraconazole for undocumented chronic fungal sinusitis with systemichypersensitivity symptoms noring syndrome to the yoghurt and vitamintherapy of undocumented candida enteritis elaine palmer syndrome withsystemic symptoms there is significant difference between the cost andrisk of these two empiric therapeutic trials are we talking about realcandida infections the whole yeast connection hypothesis the efficacyof routine bacterial repopulation in humans or the ability of anecdotallyeffective therapies challenged by a negative randomized trial to confirman etiologic hypothesis post hoc ergo propter hoc we cant seem tofocus in on a disease a therapy or a hypothesis under discussion im lostfrom banschbachvmsocomokstateedusubject pmscan it be prevented by a diet changethis question came up in sci med nutrition and im posting my answer here only medical schools in the us teach courses on human nutrition we have already seen what a lack of nutrition education can do when candida and kidney stones present themselves to the medical communityi think that the best example of where us medicine is really missing the mark when it comes to a knowledge of nutrition is pms so many womenand their husbands suffer from this disorder that it is really criminal that most physicians in the us are not taught that pms is primarily caused by diet and diet changes can prevent it from ever happpening before shooting your flames read the entire article and then decide if flaming is justifiedfrom a poster in sci medi nutrition in a psychological anthropology course i am taking we got sidetracked onto a short conversation about pms some rumors shared by several of the students included ideas that vitamin levels sugar intake and caffeine intake might affect pms symptoms is there any data on this or is it just so much hooey many thanks michael ive wanted to reply to this post ever since i saw it but i got sidetracked with candida pms is a lot like candida blooms most physicians dont recognize it as a specific disease entity here is everything that you would ever want to know about pmspremenstrual syndrome has been divided into four specific subgroupspmtaanxietypmtddepressionanxietydepressionirritabilityforgetfulnessinsomniaconfusiondepressionlethargypmtccravingpmthhyperhydrationcraving for sweetsweight gainincreased appetitebreast congestion and tendernesssugar ingestion causes abdominal bloating and tenderness headacheedema of the face and extremities palpitations fatigue or fainting pmta is characterized by elevated blood estrogen levels and low progesterone levels during the luteal phase of a womens cyclepmtc is caused by the ingestion of large amounts of refined simple carbohydrates during the luteal phase of a womens cycle there is increased glucose tolerance with a flat glucose curve after oral glucose challenge the metabolic findings believed to be responsible for pmtc are a low magnesium and a low prostaglandin e this condition of hypoglycemia is not unique to pms but there are a number of different causes of hypoglycemia magnesium and pge seem to be specific to pms hypoglycemiaa am j psychiatry unrefined complex carbohydrate should be substituted for sugar magnesium supplementation and alpha linoleic acid supplementationincreased to of the total calories using safflower oil or evening primrose oil as sources of alpha linoleic acidpmtd is characterized by elevated progesterone levels during the midluteal phase of a womens cycle another cause of pmtd has been found to be lead toxicityin women without elevated progesterone levels during the midluteal phase effect of metal ions on the binding of estridol to human endometrial cystol fertil steril pmth is associated with water and salt retention along with an elevated serum aldosterone level salt restriction b magnesium and vitamin e for breast tenderness have all been effective in treating pmththis general discussion of the pms syndromes came forma management of the premenstrual tension sundromes rational for a nutritional approach a year in nutritional medicine j bland ed keats publishing b nutritional factors in the etiology of premenstrual tension syndromes j reprod medc premenstrual tension prob obstet gynecol treatment has traditionally involved progesterone administration if you can find a doctor who will treat you for pmsjust about as hard as finding one that will treat you for candida blooms while progesterone will work supplementation with vitamins and minerals works even better there really has been an awful lot of research done on pmsmuch more than candida blooms many of these studies have been what are called experimental controlled studiesthe type of rigorous clinical studies that doctors like to see donehere are a few of these studiescarbohydrate experimental controlled study effect of a lowfat highcarbohydrate diet on symptoms of cyclical mastopathy lancet pts with severe persistent cyclical mastopathy of at least years duration were randomly selected to receive specific training to reduce dietary fat to of total calories and increase complex carbohydrate ingestion or given general dietary advise with no training after months there was a significant reduction in the severity of the breast swelling and tenderness in the trained group as reported by selfreported symptoms as well as physical exams which quantitated the degree of breast swelling tenderness and nodularityvitamin a experimental controlled study the use of vitamin a in premenstrual tension acta obstet gynecol scand pts with severe recurring pms received to iu vitamin a daily or a placebo serum retinol levels were monitored and high dose supplementation was discontinued when evidence of toxicity occuredserum retinol above ugml the intent of the study was to load the liver up with vitamin a and get a normal pool sizeiu to iu and then see if this normal vitamin a pool could prevent pms getting the high dose vitamin a had complete remission of the symptoms of pms only getting the placebo reported getting complete relief of pms sysmptoms of the vitamin a treated group reported no improvement in pms symptomsexperimental controlled study premenstrual tension treated with vitamin a j clinical endocrinology pts received iu of vitamin a daily starting on day of their cycle with supplementation continuing until the onset of pms symptoms after months all pts reported a significant improvement in pms symptoms vitamin a supplementation was stopped once evidence of toxicity was demonstrated and all pts were followed for one year after high dose vitamin a supplementation was stopped pms symptoms did not reoccur in any of these pts for upto one year after the vitamin a supplementation was stoppedmost americans do not have a normal store of vitamin a in their liver these studies and several others were designed to see if getting a normal store of vitamin a into the liver could eliminate pms of all the vitamins given for pmsvitamin a b and vitamin e vitamin a has shown the best single effect this is probably because vitamin a is involved in steroid estrogenprogesterone metabolism in the liver getting your liver full of vitamin a seems to be one of the best things that you can do to prevent the symptoms of pms but vitamin a is toxic and you dont want to be trying to do this without being seen by a physician who can monitor you for vitamin a toxicityvitamin b experimental doubleblind crossoverr study pyridoxinevitamin b and the premenstrual syndrome a randomized crossover trialjr coll gen pract women aged with moderate to severe pms randomly received mg b daily or placebo after months the groups were switched and followed for another months b had a significant effect on the emotional aspects of pmsdepression irritability and tiredness other symptoms of pms were not significanttly affected by b supplementationexperimental doubleblind study the efects of vitamin b supplementation on premenstrual sysmptoms obstet gynecol pts with moderate to severe pms received mg b daily or placebo for months analysis of convergence showed that b significantly improved premenstrual symptoms related to the autonomic nervous systemdizziness and vomiting as well as behavior changespoor mental performance decreased social interaction anxiety depression and water retention were not improved by b supplementationvitamin b is below the rda for both american men and women birth control pills and over different drugs increase the b requirement in man women on birth control pills should be supplemented with mg of b per day the dose should be increased if symptoms of pms appear dr david r rubinow who heads the biological psychiatry branch of nimh was quoted in clin psychiatry news december as stating that b should be considered the firstline drug for pmsover progesterone and if the patient does not respond then other treatments should be tried vitamin b can be toxicnerve damage if consumed in doses of mg or more each day vitamin e experimental doubleblind study efficacy of alphatocopherol in the treatment of premenstrual syndrome j reprod med pts received iu vitamin e daily for cycles or a placebo vitamin e treated pts had who reported a significant reduction in physical symptomsweight gain and breast tenderness while the placebo group had who reported a significant reduction in physical symptoms the vitamin e group reported that had a significant reduction in anxiety versus for the placebo group for depression the vitamin e group had with a significantdecrease in depression compared with for the placebo groupexperimental doubleblind study the effect of alphatocopherol on premenstrual symptomalogy a double blind study j am coll nutr pts with benign breast disease and pmt randomly received vitamin e at iu iu or iu daily or placebo after months of supplementation iu of vitamin e or higher significantly improved pmta and pmtc the iu dose was needed to significantly improve pmtd no dose of vitamin e significantly improved pmthother studies have shown that a higher vitamin e doses will relieve pmth symptomsmagnesium experimental doubleblind study magnesium prophylaxis of menstrual migraine effects on itracellular magnesium headache pts with perimenstrual headache received mg daily of magnesium as magnesium pyrrolidone carboxylic acid or a placebo treatment was started on the th day of the cycle and continued until menstruation after months the pain total index was significantly lower in the magnesium group magnesium treatment was also assocoiated with a significant reduction in the menstrual distress questionnaire scores pretreatment magnesium levels in lymphocytes and polymorphonuclear leukocytes were significantly lower in this group of pts compared to control women who did not suffer from pms after treatment magnesium levels in these cells was raised into the normal rangeexperimental doubleblind study oral magnesium successfully relieves premenstrual mood changes obstet gynecol pts aged randomly received either magnesium carboxylic acid mg of mg per day or a placebo from the th day of the cycle to the onset of the menstrual flow after cycles both groups received magnesium the menstrual distress questionnaire score of the cluster pain was significantly reduced during the second cyclemonth for the magnesium treatment group as well as the placebo group once they were switched to magnesium supplementation in addition the total score on the menstrual distress questionnaire was significantly decreased by magnesium supplementation the authors suggest that magnesium supplemenation should become a routine treatment for the mood changes that occur during pmsthere are numerous observational studies that have been published in the medical literature which also suggest that pms is primarily a disorder that arises out of a hormone imbalance that is dietary in nature but since observational studies are considered by most physicians in sci med to be anecdotal in nature i have not bothered to cite them there are also over a half dozen good experimental studies that have been done on multivitamin and mineral supplementation to prevent pms ive chosen the best specific studies on individual vitamins and minerals to try to point out that pms is primarily a nutritional disorder but doctors dont recognize nutritional disorders unless they can see clinical pathologyberiberi pellagra scruvy etc pms is probably the best reason why every doctor being trained in the us should get a good course on human nutrition pms is really only the tip if the iceberg when it comes to nutritional disorders its time that medicine woke up and smelled the rosesheres some studies which show the importance in multivitaminmineral supplementation andor diet change in preventing pmsexperimental study effect of a nutritional programme on premenstrual syndrome a retrospective analysis complement med res pts were given dietary instructions and supplemented with optiviter plus additional vitamin c vitamin e magnesium zinc and primrose oil the dietary instructions were to take the supplements and switch to a low fat complex carbohydrate diet on a retrospective analysis of the pts reported an improvement in their pms symptoms with of the sample stating that they no longer suffered from pms experimental doubleblind study role of nutrition in managing premenstrual tension syndromes j reprod med a low fat high complex carbohydrate diet along with optivite supplementation significantly decreased pms scores compared with diet change and placebo after months on the experimental program the vitaminmineral supplementated group had significantly decreased estradiol and increased progesterone in serum during the midlutel phase of their cycleexperimental doubleblind study clinical and biochemical effects of nutritional supplementation on the premenstrual syndrome j reprod med pts randomly given optivite tablets per day or a placebo the treated groups showed a significant decrease in pms symptoms compared to the placebo another group of pts got optivite tablets per day or placebo for this second group of patients no significant effect of supplementation on pms symptoms was observedmartin banschbach phdprofessor of biochemistry and chairmandepartment of biochemistry and microbiologyosu college of osteopathic medicine w th sttulsa ok without discourse there is no remembering without remembering there is no learning without learning there is only ignorance from brownspkhpcom pat r brownsubject re helpreflux esophagitisplease post your results a close friend has this condition andhas asked these same questions from mikeqfreddycnatekcom mike quigleysubject re pregnency without sexin article stephenmont stephenmontcsmissouriedu stephen montgomerysmith writeswhen i was a school boy my biology teacher told us of an incidentin which a couple were very passionate without actually havingsexual intercourse somehow the girl became pregnent as spermcells made their way to her through the clothes via persperationwas my biology teacher misinforming us or do such incidents actuallyoccurohboy here we go again and one wonders why the americaneducation system is in such abysmal shapefrom scheibersageccpurdueedu jennifer scheibersubject re pregnency without sexin article bluecispittedu kxgstpittedu kenneth gilbert writesin article stephenmont stephenmontcsmissouriedu stephen montgomerysmith writeswhen i was a school boy my biology teacher told us of an incidentin which a couple were very passionate without actually havingsexual intercourse somehow the girl became pregnent as spermcells made their way to her through the clothes via persperationwas my biology teacher misinforming us or do such incidents actuallyoccursounds to me like someone was pulling your leg there is only one way forpregnancy to occur intercourse these days however there is alsoartificial insemination and implantation techniques but were speaking ofnatural acts here it is possible for pregnancy to occur if semen isdeposited just outside of the vagina ie coitus interruptus but thatsabout at far as you can get through clothes no way better go talkto your biology teacher kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer what is the likely hood of conception if sperm is deposited just outsidethe vagina ie chance j e n n i f e r s c h e i b e r email scheibersageccpurdueedu school of nursing purdue universityfrom easultbiscritedu ea storysubject re krillean photographyin article rgrsvinnmprgapcaltechedu carlsolgpscaltechedu writesgregflame definitely intended here bill was making fun of the misspelling go look up the word krill also the correct spelling is kirlian itinvolves taking photographs of corona discharges created by attaching thesubject to a highvoltage source not of some aura it works equally wellwith inanimate objectstrue but what about showing the missing part of a leaf is thiscorona discharge that is a dry turtle that turtle is not moistezra story a student at rit andeasultbiscritedu his trusty mailing addressfrom grenuspastureecnpurdueedu karen m grenussubject thermogenicshiim an avid dieter and the new miracle drug seems to involve thermogenics the drug is claimed to stimulate the brown fat to burn food creating eat as opposed to the fat being stored there are all sorts ofwarnings about fevers elevated blood pressure and heart rate ectthe silver lining is that apparently some weight loss does not require a change in diet is this possible are the pills dangerous or justhoaxeskarenfrom dsewtroiccrochesteredu david sewellsubject theophyllineephedrine and water bioavailabilitydoes anyone know if either theophylline or ephedrine or the two incombination can reduce the bodys ability to make use of available water i had kind of an odd experience on a group hikerecently becoming dehyrated after about hours of rigoroushiking despite having brought gallons of water c litersi drank close to twice as much as anyone else and no one else wasdehydrated i dont think general physical condition was an issuesince i was in at least the middle of the pack in terms of generalstamina so far as i could tellit may be that i just plain need more water than most people but i amwondering if theophylline andor ephedrine might be aggravating thingsi took a couple of primatene tablets during the hike to control asthma mg ephedrine mg theophylline i gather that both thosedrugs are diuretics so now im wondering does that mean they canreduce the bodys ability to utilize available water would it be aparticularly stupid thing to take that medication during hotweatherexercise i always assumed diuresis just meant you urinated a lot butthat wasnt the case yesterdayfrom banschbachvmsocomokstateedusubject re chelation therapyin article rhseinnfkcnewsstandcitcornelledu renee rmecornelledu writes does anyone here know anything about chelation therapy using edta my uncle has emphesema and a doctor wants to try it on him we are wondering if is there any evidence edta chelation therapy is beneficial for his condition or any condition what possible side effects are there how can they be mimimized please respond via email to rmecornelledu thanks reneeedtachelation therapy has been used by some physicians to try to remove calcium from calcified plaques in the arterial systemnot approved for such use there is also the possibility that lung tissue in patients with lung disease has become calcifiedchest xrays would show this there are sideeffects to the use of edta because it is not specific for calciumit also binds other minerals i think that there have been some deaths when edta chelation therapy has been used because of mineral imbalances that were not detected and corrected in animal studies the best way to remove calcium from plaques in rabbits was to supplement the rabbits with vitamin c and magnesiumrabbits already synthesize their own vitamin c the extra vitamin c was given in their diets to help the magnesium displace the calcium from the plaquesthe calcification process that occurs in both plaques and the lung probably can be prevented if magnesium is used in supplemental form most patietns with calcium deposits are found to be deficient in calcium magnesium interrationships in ischemic heart disease a review am j clin nutr supplementation with magnesium will prevent clacification of blood vessels the importance of magnesium deficiency in cardiovascular disease am heart j the need to measure the serum concentration in all patients with heat disease cannot be overemphasized this is a review article effect of dietary magnesium on development of atherosclerosis in cholesterolfed rabbits atherosclerosis magnesium supplementation greatly decreased the formation of plaques in rabbits feed a diet that had by weight cholesterrol added to their normal foodsince edta will also bind magnesium ive never really liked its use for the reversal of athersclerosis or now apparently in emphesema patientsmarty bfrom blixmiltoncsuiucedu gunnar blixsubject need info on circumcision medical cons and prosi need information on the medical including emotional pros andcons of circumcision at birth i am especially interested inreferences to studies that indicate disadvantages or refute studiesthat indicate advantages a friend who is a medical student iswriting a survey paper and apparently the studies she has run intoare all for circumcision the main argument being a lower risk ofpenile cancerplease email responses as i am not a frequent reader of either groupi will summarize to the net gunnar blix good advice is one of those insults that blixcsuiucedu ought to be forgiven unknown gunnar blix good advice is one of those insults that blixcsuiucedu ought to be forgiven unknown from banschbachvmsocomokstateedusubject re candidayeast bloom fact or fictionin article rhbcfhsdndevharvardedu rindenterprisebihharvardedu david rind writes in article aprvmsocomokstateedu banschbachvmsocomokstateedu writesare in a different class the big question seems to be is it reasonable to use them in patients with gi distress or sinus problems that could be due to candida blooms following the use of broadspectrum antibiotics i guess im still not clear on what the term candida bloom means but certainly it is well known that thrush superficial candidal infections on mucous membranes can occur after antibiotic use this has nothing to do with systemic yeast syndrome the quack diagnosis that has been being discussed found in the sinus mucus membranes than is candida women have been known for a very long time to suffer from candida blooms in the vagina and a women is lucky to find a physician who is willing to treat the cause and not give give her advise to use the otc antifungal creams lucky how since a recent article randomized controlled trial of oral yogurt on reducing vaginal candidiasis ive mentioned to a number of patients with frequent vaginal yeast infections that they could try eating ounces of yogurt daily it turns out most would rather just use antifungal creams when they get yeast infections yogurt dangerous if this were a standard part of medical practice as gordon r says it is then the incidence of gi distress and vaginal yeast infections should decline again this just isnt what the systemic yeast syndrome is about and has nothing to do with the quack therapies that were being discussed there is some evidence that attempts to reinoculate the gi tract with bacteria after antibiotic therapy dont seem to be very helpful in reducing diarrhea but i dont think anyone would view this as a quack therapy david rindyogurt contains lactobacillus acidophilus and l bulgaricus l acidophilus is the major bacteria in the vaginal tract and is primarily responsible for keeping the vaginal tract acidic and yeast free most of the commercial yogurt sold in the us has a very low l acidophilus and l bulgaricus count neither of these bacteria are obligate anaerobes with are much more important in dealing with the diarrhea problem gordon r has told me through email that he gives his patients l acidophilus and several different obligate anaerobeswhich setup shop in the colon but he hasnt told me which ones yet the lactobacillus genera are mostly facultative anaerobes and will setup shop where they have access to oxygen if given a chancemouth anus sinus cavity and vagina having these good bacteria around will greatly decrease the chance of candida blooms in the anal region or the vagina i have not proposed a systemic action for candida blooms i know that others swear that all kinds of symptoms arise from the evil yeast blooms in the body im not ready to buy that yet i do believe that complications at specific sitesvagina anal and maybe lower colon sinus and mouth can result from antibiotic use which removes the competing bacteria from these sites and thus lets candida grow uncheckedrestoring the right bacterial balance is the best wayin my opinion to get rid of the problem antifungals a low carbohydrate diet and vitamin a supplementation may all help to minimize the local irritation until the good bacteria can take over control of the food supply again and lower the ph to basically starve the candida outmarty bfrom banschbachvmsocomokstateedusubject re candidayeast bloom fact or fictionin article rhfrkinnshelleyuwashingtonedu nodroghardyuwashingtonedu gordon rubenfeld writes banschbachvmsocomokstateedu writes to candida blooms following the use of broadspectrum antibiotics gorden rubenfeld through email has assured me that most physicians recognize the chance of candida blooms occuring after broadspectrum antibiotic use and they therefore reinnoculate their patients with good bacteria to restore competetion for candida in the body i do not believe that this is yet a standard part of medical practice nor is it mine what i tried to explain to marty was that it is clearly understood that antibiotic exposure is a risk factor for fungal infections which is not the same as saying bacteria prevent fungal infections marty made this sound like a secret known only to veternarians and biochemists anyone who has treated a urinary tract infection knowns this at some centers preop liver transplant patients receive bowel decontamination directed at retaining good anaerobic flora in an attempt to prevent fungal colonization in this soontobe high risk group i also use lactobacillus to treat enteral nutrition associated diarrhea that may be in part due to alterations in gut flora however it is not part of my routine practice to reinnoculate patients with good bacteria after antibiotics i have seen no data on this practice preventing or treating fungal infections in at risk patients whether or not it is a logical extension from the available observations ill leave to those of you who base strong opinions and argue over such speculations in the absence of clinical trials one place such therapy has been described is in treating particularly recalcitrant cases of c difficile colitis not a fungal infection there are case reports of using stool ie someone elses enemas to repopulate the patients flora dont try this at home not give give her advise to use the otc antifungal creams since candida colonizes primarily in the anorectal area gi symptoms should be more common than vaginal problems after broadspectrum antibiotic use except that it isnt at least symptomatically apparent disease medicine has not and probalby never will be practiced this way there has always been the use of conventional wisdom a very good example is kidney stones conventional wisdombecause clinical trails have not been done to come up with an effective prevention was that restricitng the intake of calcium and oxalates was the best way to prevent kidney stones from forming clinical trials focused on drugs or ultrasonic blasts to breakdown the stone once it formed through the recent new england j of medicine article we now know that conventional wisdom was wrong increasing calcium intake is better at preventing stone formation than is restricting calcium intake seems like this is an excellent argument for ignoring anecdotal conventional wisdom a euphemism for no data and doing a good clinical trial like au dismukeswe wadejs leejy dockerybk hainjd ti a randomized doubleblind trial of nystatin therapy for the candidiasis hypersensitivity syndrome see comments so nengljmed dec p psychological tests results the three activetreatment regimens and the allplacebo regimen significantly reduced both vaginal and systemic symptoms p less than but nystatin did not reduce the systemic symptoms significantly more than placebo conclusions in women with presumed candidiasis hypersensitivity syndrome nystatin does not reduce systemic or psychological symptoms significantly more than placebo consequently the empirical recommendation of longterm nystatin therapy for such women appears to be unwarranted does this trial address every issue raised here no jon noring was not surprised at this negative trial since they didnt use sporanox despite crooks recommendation for nystatin maybe they didnt avoid those carbohydrates the conventional wisdom in animal husbandry has been that animals need to be reinnoculated with good bacteria after coming off antibiotic therapyif it makes sense for livestock why doesnt it make sense for humans david we are not talking about a dangerous treatmentunless you consider yogurt dangerous if this were a standard part of medical practice as gordon r says it is then the incidence of gi distress and vaginal yeast infections should decline marty youve also changed the terrain of the discussion from empiric itraconazole for undocumented chronic fungal sinusitis with systemic hypersensitivity symptoms noring syndrome to the yoghurt and vitamin therapy of undocumented candida enteritis elaine palmer syndrome with systemic symptoms there is significant difference between the cost and risk of these two empiric therapeutic trials are we talking about real candida infections the whole yeast connection hypothesis the efficacy of routine bacterial repopulation in humans or the ability of anecdotally effective therapies challenged by a negative randomized trial to confirm an etiologic hypothesis post hoc ergo propter hoc we cant seem to focus in on a disease a therapy or a hypothesis under discussion im lostcandida can do that to you gordon i think that the best clinical trial for candida blooms would involve giving women with chronic vaginal candida blooms l acidophilus orally and see it it can decrease the frequency and extent of candida blooms in the vagina since most of the candida seems to be migrating in from the anal region and l acidophilus should be able keep the candida in check if it can make it through the intestinal tract and colonize in the anus where it will have access to oxygenjust like it does in the vagina as much stuff as there is in the lay press about l acidophilus and vaginal yeast infections im really amazed that someone has not done a clinical trial yet to check it outthe calcium and kidney stone story is not a good reason to throw all conventional wisdom out the window where would medicine be if conventional wisdom had not been used to develop many of the standard medical practices that could not be confirmed through clinical trialsthe clinical trial is a very new arrival on the medical sceneand a very important one the lack of proof that reinnoculation with good bacteria after antibiotic use is important to the health of a patient is no reason to dismiss it outofhand especially if reinnoculation can be done cleaply and safelylike it is in animal husbandrymarty bfrom foomhfoopcmy dr foo meng howsubject how to gain accessto whomever who can help mei am a doctor from kota bharu kelantan malaysia i have recently hooked up my private home computer to email via the local telephone company i am really interestedin corresponding with other doctors or medical researchers through email i also hopeto be able to subscribe to a news network on medicinecan someone please tell me what i should do i am completely new to this and have no idea about the vast capabilities of emailthank you for your attentionfrom plebrunminfvubacbe philippe lebrunsubject re pregnency without sexin article stephenmont stephenmontcsmissouriedu stephen montgomerysmith writes when i was a school boy my biology teacher told us of an incident in which a couple were very passionate without actually having sexual intercourse somehow the girl became pregnent as sperm cells made their way to her through the clothes via persperation was my biology teacher misinforming us or do such incidents actually occursperm deposited near the entrance of the vagina has been known to causepregnancy even in the presence of a hymen i doubt that sperm could make it through a layer of cloth then find the right path to a waiting ovumbut it might be possibleso it is possible for a woman to be both virgin and pregnantalso some hymens are sufficiently loose to allow nearnormal intercoursewithout rupturing the problem when investigating these phenomenae isof course getting an honest account of what exactly happenedphilippefrom plebrunminfvubacbe philippe lebrunsubject re frozen shoulder and lawn mowingin article apruxctseiuedu cfaksuxctseiuedu alice sanders writes ihave had a frozen shoulder for over a year or about a year it is still partially frozen and i am still in physical therapy every week but the pain has subsided almost completely until last week when i mowed the lawn for twenty minutes each two days in a row i have a push type power mower the pain started back up a little bit for the first time in quite a while and i used ice and medicine again can anybody explain why this particular activity which does not seem to stress me very much generally should cause this shoulder problemyou need to use your shoulder muscles to push the mower if you havent beendoing much exercise as i suppose you havent then a constant minutelong effort can cause stiffness and crampsphilippefrom nigel allen nigelallencanremcomsubject occupational injuries and disease workers memorial dayhere is a press release from the american federation of state county and municipal employees unions point to deadly workplaces afscme other unionscommemorate workers memorial day to national desk labor writer contact janet rivera of the american federation of state countyand municipal employees aflcio washington april the american federation of state county and municipal employees afscme and other unionsof the aflcio on wednesday april will commemorate the fifthannual workers memorial day a day to pay homage to the million workers who are killed injured or diseased on the job this year afscme will focus its workers memorial day efforts anthe dangerous environment in which corrections officers must workearlier this month an afscme corrections officer robertvallandingham was killed by inmates who overtook the correctionsfacility in lucasville ohio the law and order agenda of the s has resulted in a steadyincrease in the prison population for the past five years onjn the prison population was projectionsshow a continued increase in the number of inmates with anexpected prison population of in the conditions which this burgeoning prison population hascreated for corrections officers is partially reflected in thenumber of assaults by inmates against staff assaults againststaff increased dramatically between and and remainhigh in there were assaults by inmates against staffcompared to such assaults in the increased number of inmates has brought on the dangerouscombination of overcrowding and understaffing for example in ohioofficertoinmate ratio is to the second worst ratio inthe nation the national average is to other health andsafety issues facing corrections officers include aids hepatitisb tuberculosis stress and chemical hazards afscme has more than members who work in the nationsfederal state and local correctional facilities correction officers are not alone in performing their jobs underlifethreatening conditions every year american workersdie from jobrelated injuries and tens of thousands more die fromoccupational disease public employees do some of the nationsmost dangerous jobs perilous occupations include highway workers highway workers are often injured and frequently killed by moving traffic because work zones are not barricaded or dont have proper lighting health care workers hospitals have the highest number of jobrelated injuries and illnesses of any private sector employer and nursing homes ranked fifth there were more than jobrelated illnesses and injuries in private sector hospitals in up almost percent over the previous year it is generally believed that health care workers employed at public sector hospitals and nursing homes have a significantly higher rate of injuries and illnesses than do their private sector counterparts health and safety issues facing health care workers include exposure to tuberculosis and the hiv virus back injuries and high levels of stress social workers social workers who work in mental health institutions are often the victims of assaults and sometimes fatal attacks for instance last october a man carrying a semiautomatic handgun walked into the schuyler county social services building in watkins glenn ny and fatally shot social services workers before turning the gun on himself there are two basic problems first is a growing lack of support services for people who dont have the help they need because workers are overworked some clients are not given the adequate amount of counselling such conditions may cause clients to become more frustrated the quality of the clients is also becoming more violent as more are moved out of the institutions nearly million workers have been killed by workplace hazardssince osha was passed moreover as afscme president gerald wmcentee explains osha does not provide workplace safetyprotections for public employees more than public employees are killed each year on thejob yet states still provide no federallyapproved oshacoverage for public employees said mcentee this despite thefact that public employees highway workers health care workerscorrections officers to name but a few do some of the mostdangerous work in our society this year we are fighting forpassage of osha reform legislation to give all workers greaterrights and protections and finally guarantee all public employeessafe workplaces we need the public support to be successful government workers suffer percent more injuries than privatesector workers and these injuries are almost percent moresevere public employees were exempted from osha when the law was passedin and today public employees in more than half the stateshave no osha coverage canada remote systems toronto ontariofrom noringnetcomcom jon noringsubject re candidayeast bloom fact or fictionin article nodroghardyuwashingtonedu gordon rubenfeld writes marty youve also changed the terrain of the discussion from empiricitraconazole for undocumented chronic fungal sinusitis with systemichypersensitivity symptoms noring syndrome to the yoghurt and vitamintherapy of undocumented candida enteritis elaine palmer syndrome withsystemic symptoms there is significant difference between the cost andrisk of these two empiric therapeutic trials are we talking about realcandida infections the whole yeast connection hypothesis the efficacyof routine bacterial repopulation in humans or the ability of anecdotallyeffective therapies challenged by a negative randomized trial to confirman etiologic hypothesis post hoc ergo propter hoc we cant seem tofocus in on a disease a therapy or a hypothesis under discussion im lostpoint im beginning to see that part of the disagreements about the wholeyeast issue is on differing perceptions and on differing meaningsof words medical doctors have a very specific and specialized jargonnecessary for precise communication within their field which im fullycognizant of since i too speak jargonese when with my peers for thesituation in scimed many times the words or phrases used by doctors canhave a different and more specific meaning than the same word used in theworld at large causing significant miscommunication one example wordand very relevant to the yeast discussion is the exact meaning of systemicit is now obvious to me that the meaning of this word is very specific muchmore so than its meaning to a nondoctor there is also the observation ofthis newsgroup that both doctors and nondoctors come together on essentiallyequal terms which when combined with the jargon issue can further fanthe flames this is probably the first time that practicing doctors getreally beat up by nondoctors for their views on medicine which theyotherwise dont see much of in their practice except for the occasionaldifficult patientpoint i understand the viewpoint among many practicing doctors that they will notprescribe any treatmentstherapies for their patients unless such treatmentshave been shown to be effective and the risks understood from wellconstructedclinical trials usually doubleblind or that such treatmentstherapies arepart of an approved and funded clinical trial to these doctors to do anydifferently would in this belief system be unethical practice and itfollows that any therapy not on the accepted list is therefore a nontherapy it does not even exist nor does the underlying hypothesis ortheory have any validity even if it sounds very plausible by extrapolationof what is currently known anecdotal evidence has no value either froma treatment pointofviewand by and large as a scientist myself i am glad that medical practicescience takes such a rigorous approach to medical treatment however asalso being a human being last i checked and having been one of those peoplethat has been significantly helped by a currently unaccepted treatment wherestandard medicine was not able to help me has caused me to sit back andwonder if holding such an extreme and rigid scientific viewpoint is initself unethical from humanitarian considerations after all the underlyingintent of the scientific approach to medicine is to protect the health ofthe patient by providing the best possible care for the patient so thepatient should come first when considering treatmentwhat we need is a slightly modified approach to treatment that satisfies boththe scientific and the humanitarian viewpoints in an earlier post ioutlined a crazy idea for doing just that the gist of it was to give anyphysician freedom and encouragement by the medical community to prescribealternate not yet proven therapies maybe supported by anecdotal evidencefor patients who all avenues of accepted therapies have been exhaustedand not until then the patient would be fully informed that suchtherapiestreatments are not supported by the proper clinical trials and thatthere are real potential risks with real possibilities of no benefit derivedfrom themthis approach satisfies the need for scientific rigor it also satisfiesthe humanitarian needs of the patient and the reality is that many patientswho have reached a deadend in the treatment of their symptoms using acceptedmedicine will go outside the orthodox medical community either to thedoctors who are brave enough to prescribe such treatments at the risk of losingtheir license or worse to nondoctors who have not had the proper medicaltraining this approach also recognizes this reality and keeps the controlmore within orthodox medicine with the benefits that the information gleanedcould help focus limited resources towards future clinical trials in the mostproductive way everybody wins in this admittedly rosecolored approach imsure there are real problems with this approach as well it is presentedmore as a strawman to stimulate discussionhopefully what i write here may give the scimed doctors a better idea as towhy i am open to alternative therapies as well as why i have realdifficulty read apparent hostility with the coldness of the purescientific approach to medicine i believe the best approach to medicaltreatment is one where both the humanitarian aspects are balanced with andby the scientific aspects anything else is just not good medicine imhojust my nf leanings i guess commentsjon noring charter member infj clubif youre dying to know what infj means be brave email me ill send info jon noring noringnetcomcom jkn international ip freds gourmet chocolate carlton place phone chips worlds best livermore ca vmail who are you read altpsychologypersonality thats where the action isfrom kxgstpittedu kenneth gilbertsubject re pregnency without sexin article czfnmentorccpurdueedu scheibersageccpurdueedu jennifer scheiber writesin article bluecispittedu kxgstpittedu kenneth gilbert writessounds to me like someone was pulling your leg there is only one way forpregnancy to occur intercourse these days however there is alsoartificial insemination and implantation techniques but were speaking ofnatural acts here it is possible for pregnancy to occur if semen isdeposited just outside of the vagina ie coitus interruptus but thatsabout at far as you can get through clothes no way better go talkto your biology teacher what is the likely hood of conception if sperm is deposited just outsidethe vagina ie chance hmmm i really dont know probably quite low overall why dont weget a couple hundred willing couples together and find out kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from ebrandtjarthurclaremontedu eli brandtsubject re krillean photographyin article mmeyeraprmdsegticom mmeyermdsegticom mark meyer writesbesides kirilian photography is actually photography of myfriends twoyearold son kiril perhaps you meant kirliani think it was a typo for karelian photography which is thepractice of taking pictures of either finns or russians dependingon whom one asks eli ebrandtjarthurclaremontedufrom dyerspdcccom steve dyersubject re candidayeast bloom fact or fictionin article aprvmsocomokstateedu banschbachvmsocomokstateedu writesneither of these bacteria are obligate anaerobes with are much more important in dealing with the diarrhea problemthe diarrhea problem what diarrhea problem first candidal overgrowth isnot a frequent problem during antibiotic therapy and not all cases ofantibioticrelated diarrhea have anything to do with candida but a caseof vaginal candidiasis or oral thrush after antibiotic therapy isnt goingto surprise anyone either thats not what people are disagreeing withantifungals a low carbohydrate diet and vitamin a supplementation may all help to minimize the local irritation until the good bacteria can take over control of the food supply again and lower the ph to basically starve the candida outoh really whered you come up with this you know its reallyappalling to see you try to comment authoritatively on clinical mattersin a bizarre synthesis from reading reports in the literaturebobbing for citations in the research literature isnt medicinei hope youre not giving the wrong idea to your medical students steve dyerdyerursamajorspdcccom aka imaharvardrayssdlinusmcspdccdyerfrom klausiprigojp klaus hofmannsubject cats and pregnancyhelloi heard that a certain disease toxoplasmosys is transmitted by cats whichcan harm the unborn fetus does anybody know about it is it a problem to have a cat in the same apartmentthanks klaus hofmannnational institute of materials and chemical research higashi tsukuba ibaraki japanfrom hosspanixcom felix the catsubject re a good place for back surgerygaryschuetter garywscbnewsgcbattcom wrote hello just one quick question my father has had a back problem for a long time and doctors have diagnosed an operation is needed since he lives down in mexico he wants to know if there is a hospital anywhere in the united states particulary famous for this kind of surgery kind of like houston has a reputation for excellent doctors in eye surgery any additional info or pointers will be appreciated a whole lotthere is one hospital that is here in new york city that is famous for itsorthopedists namely the hospital for special surgery they are located onthe upper east side of manhattan if you want their address and phone letme know ill get them i dont know them off hand felix the cat the wonderful wonderful cat meow hosspanixcomfrom battincyclopsiucfindianaedu laurence gene battinsubject re krillean photographyin article aprultbiscritedu ea story easultbiscritedu wrote in article rgrsvinnmprgapcaltechedu carlsolgpscaltechedu writes gregflame definitely intended here bill was making fun of the misspelling go look up the word krill also the correct spelling is kirlian it involves taking photographs of corona discharges created by attaching the subject to a highvoltage source not of some aura it works equally well with inanimate objects true but what about showing the missing part of a leaf is this corona dischargeno its called not wiping off the apparatus after taking a picture of thewhole leafgene battinbattincyclopsiucfindianaeduno sig yetfrom hosspanixcom felix the catsubject med school admissionhi all ive applied for the class of at quite a number of schools and have gotten rejects interviews and no responsesany one know when the heck these people send out their acceptance lettersaccording to the med school admissions book theyre supposed to send outthe number of their class in acceptances by mid march whats going on iam losing my sanity checking my mailbox every dayalso does anyone have some useful alternatives in case i dont get in ikind of looked into chiropractic and podiatry but they really dontinterest me thanks felix the cat the wonderful wonderful cat meow hosspanixcomfrom mymailintegralstavropolsu sidelnikov igor vladimirovichsubject pleasehelp a patient mail newsservkiaesusubject please help dear ladies and gentlemen we should be grateful for any information about address and or email address of lomalinda hospital approximate position usa california near vaimor town miles from losangelos a patient needs consultation in this clinics before operation with respect igor v sidelnikovquitfrom mcglehighedu marc gabrielsubject lymenet newsletter vol lyme disease electronic mail network lymenet newsletter volume number i introductionii announcementsiii news from the wiresiv questions n answersv oped sectionvi jargon indexvii how to subscribe contribute and get back issuesi introduction in this issue of the newsletter we learn of the cdcs announced concern forthe resurgence of infectious diseases in the united states thanks tojonathan lord for sending me the upi release the cdc announced they wouldfeature a new series of articles in the morbidity and mortality weeklyreport on these infectious diseases ld is one of them we will keep youup to date on this seriesin addition we feature a the wall street journal article on the legal issuessurrounding ld we also look at lymes effects from the perspective ofurologists in an abstract entitled urinary dysfunction in lyme diseasefinally terry morse asks an intriguing question about a ticks habitatmarcii announcements source the lyme disease updatesubject call for articlesattention health care professionalsthe lyme disease update would like to publish your articles on lyme diseasediagnosis lyme treatment and the effects on lyme on lyme patients physicaland mental healththe ldu has a monthly circulation of our mailing list includes lymepatients physicians researchers county health departments and over lyme support groups nationwide we strive to give our readers uptodateinformation on lyme disease prevention diagnosis and treatment and asource for support and practical advice on living with lyme diseasearticles for the ldu should be approximately to words and shouldaddress lyme disease issues in nonscientific language to submit yourarticle mail to lyme disease update po box evansville in or fax to one year subscriptions to the lyme disease update are outside theus mail your subscription requests to the above address or call for more informationiii news from the wires sender jonathan lord jmlsuvapcmailvirginiaedusubject resurgence of infectious disease concerns cdcdate thursday april atlanta upi a resurgence of infectious diseases blamed on newlyemerging viruses and bacteria pose a major challenge for the nationshealth care system federal health officials said thursdaythe centers for disease control and prevention reporting its latestfindings in an investigation of contaminated hamburger meat thatsickened hundreds in states and killed at least four said it willput renewed emphasis on battling infectious diseasespart of that emphasis includes a new series titled emerginginfectious diseases to be featured in the cdcs morbidity mortalityweekly report which has a wide circulation in the health communitythe issue also will top the agenda of a twoday meeting of scientificcounselors to update the cdcs draft plan for dealing with the growingthreat of infectious ailmentsthis is an issue that has been coming and we do have a responsibilityto deal with it said dr ruth berkelman deputy director of the cdcsnational center for infectious diseasesthere were more cases of malaria in the us in than in any yearsince the s and latin america is experiencing a cholera epidemicthe first in this century she saidresistance of diseasecausing agents to antibiotics is also a problemwe are seeing much more antibiotic resistance than we have in the pastberkleman said she said even common ear infections frequently seen inchildren are becoming resistant to antibiotic treatmentdespite predictions earlier this century that infectious diseaseswould soon be eliminated as a public health problem infectious diseasesremain the major cause of death worldwide and a leading cause of illnessand death in the united states the cdc saidit cited the emergence since the s of a myriad of newlyidentified pathogens and syndromes such as escherichia coli oh adeadly bacterial infection the hepatitis c virus hiv the virus thatcauses aids legionnaires disease lyme disease and toxic shock syndromethe incidences of many diseases widely presumed to be under controlsuch as cholera malaria and tuberculosis have increased in many areasthe cdc said it said efforts at control and prevention have beenundermined by drug resistancesource wall street journalreference pbheadline lymedisease ruling raises liability issuesthe tick that causes lyme disease may have found a new way to causedamage legal liabilitya federal judges decision holding a property owner liable for notdoing enough to protect workers from lyme disease is getting as muchattention as the latest medical study on the disease a flulikeillness that can cause severe physical and mental disabilities and inrare instances death the decision last week has put property ownerson notice that they may have to do more than protect themselves fromthe ticksthey also may have to protect themselves from litigation ifsomeone becomes infected while on the propertythe decision by us district judge robert j ward in new york cameafter a weeklong trial in a case involving four track workers for thelong island railroad judge ward found that the workers contracted thedisease after they were bitten by ticks while on the job he orderedthe new york stateowned commuter line to pay the workers more than to compensate for pain and suffering in addition to medicalexpenses and lost wagessummer camps schools companies with facilities in rural orsemirural areas and homeowners who rent to vacationers are among thegroups that need to be worried about this ruling says stephen lkass an attorney at new york law firm berle kass case who wrote alegal article three years ago warning property owners of the potentialliability even a family that invites friends over for a backyardbarbecue might be potentially liablelawsuits for insect bites while rare arent unheardof a summervacationer in southampton ny last year sued the owner of the homeshe rented claiming that a tick on the property gave her rockymountain spotted fever in also on long island a jury orderedan outdoor restaurant to pay more than million to a patron who wasstung by a bee causing an allergic reaction and permanentquadriplegia the judge later threw out the award citing no evidencethat a beehive was near the restaurantbut lawyers say that the attention to lyme disease throughout thecountry its most prevalent in new england the middle atlanticstates wisconsin minnesota and the northwest may make thisparticular insect bite a particularly litigious onethe illness already has proved to be a source of controversy in thecourtroom over such issues as the type of medical care insurers willcover and medical malpractice claims against doctors for notdiagnosing the diseaselawyers say workerscompensation claims related to lyme diseasehave become common in some states in recent years payments inworkerscompensation cases however are limited to medical costs andlost earningsthe case before judge ward dealt with a potentially much morelucrative avenue for damages because it involved the question ofnegligence unlike the workers compensation process the law governinginjuries to rail workers allows for a finding of negligence and as aresult for additional payments for pain and suffering propertyowners and lawyers say that negligence claims can be made in manyother situations where people are exposed to the ticks that carry thediseaseira m maurer a partner at new york law firm elkind flynn maurer who represented the rail workers says the decision will helpto establish the duty of all sorts of property owners to protectagainst lyme diseaselawyers caution that despite judge wards decision winning alawsuit for damages caused by lyme disease may prove difficult forone thing victims have to demonstrate that they have pinned down whenand where they got the tick bite judge ward found that the plaintiffsin the railroad case got lyme disease while working on property ownedby the railroad even though none of the men remembered being bittenthe workers who werent outdoorsmen likely to be exposed elsewhere tothe insects said they saw ticks in the high grass that surroundedsome work sitesa spokeswoman for the railroad says that there was no proof thatthe four men were bitten while on the job and that the railroad isconsidering an appeal the railroad also disputes judge wards findingthat it didnt do enough to protect employees the spokeswoman saysthe railroad provides track workers with insect repellent and specialpants to protect against bug bitesdebate in the scientific community over lyme disease could open upsome legal defenses for property owners such as questioning whether avictim actually has the disease rather than some other illnessearlier this week the journal of the american medical associationreported that doctors overly diagnose patients as having lyme diseaseand damages awarded to a victim also might be influenced by medicaldisputes over the degree of harm that lyme disease causesbecause of health and safety concerns some groups and companiesalready take special measures to protect against lyme disease lastyear at its headquarters in franklin lakes nj becton dickinson co began using damminix a pesticide made by ecohealth inc of bostonthat is designed to kill ticks carrying the disease the medicalsupply companys headquarters include a acre park and the companywas worried that employees who walk on its trails for recreation mightget infectedruth lister a spokeswoman for the american camping association inindianapolis says that many youth camps accredited by herorganization also have begun to check children for ticks and carolekatz a member of the board of the fire island pines property ownersassociation says her group spends each year to treat theiracre site off the coast of new york with the tickkillingpesticidetitle urinary dysfunction in lyme diseaseauthors chancellor mb mcginnis de shenot pj kiilholma p hirsch ihdepartment of urology jefferson medical college thomas jeffersonuniversity philadelphia pennsylvaniareference j urol jan lyme disease which is caused by the spirochete borrelia burgdorferi isassociated with a variety of neurological sequelae we describe patientswith neuroborreliosis who also had lower urinary tract dysfunctionurodynamic evaluation revealed detrusor hyperreflexia in patients anddetrusor areflexia in detrusor external sphincter dyssynergia was notnoted on electromyography in any patient we observed that the urinary tractmay be involved in respects in the course of lyme disease voidingdysfunction may be part of neuroborreliosis and the spirochete maydirectly invade the urinary tract in patient bladder infection by thelyme spirochete was documented on biopsy neurological and urologicalsymptoms in all patients were slow to resolve and convalescence wasprotracted relapses of active lyme disease and residual neurologicaldeficits were common urologists practicing in areas endemic for lymedisease need to be aware of b burgdorferi infection in the differentialdiagnosis of neurogenic bladder dysfunction conservative bladdermanagement including clean intermittent catheterization guided by urodynamicevaluation is recommendediv questions n answers note if you have a response to this question please forward it to theeditorsender terry morse morsetccmailorstedusubject question on lyme vectors and compost piles when i visited my sister on long island ny i was cautioned to avoid thecompost heap in her back yard as she thinks this is where she becameinfected a friend of mine here in oregon who has a compost heap would like me toback that claim up with documentation do lymecarrying ticks hang out incompost heapsthank youv oped section this section is open to all subscribers who would like to express an opinionvi jargon index bb borrelia burgdorferi the scientific name for the ld bacteriumcdc centers for disease control federal agency in charge of tracking diseases and programs to prevent themcns central nervous systemelisa enzymelinked immunosorbent assays common antibody testem erythema migrans the name of the bulls eye rash that appears in of the patients early in the infectionifa indirect fluorescent antibody common antibody testld common abbreviation for lyme diseasenih national institutes of health federal agency that conducts medical research and issues grants to research interestspcr polymerase chain reaction a new test that detects the dna sequence of the microbe in question currently being tested for use in detecting ld tb and aidsspirochete the ld bacterium its given this name due to its spiral shapewestern blot a more precise antibody testvii how to subscribe contribute and get back issues subscriptionsanyone with an internet address may subscribesend a memo to listservlehigheduin the body typesubscribe lymenetl your real namefax subscriptions are also available send a single page fax to for further informationdeletionssend a memo to listservlehigheduin the body typeunsubscribe lymenetlcontributionssend all contributions to lymenetllehighedu or fax them to all are encouraged to submit questions news items announcements andcommentariesback issuessend a memo to listservlehigheduin the body typeget lymenetlnewsletters xyy where xvol and yyissue example get lymenetlnewsletters will get vol issuelymenet the internet lyme disease information sourceeditorinchief marc c gabriel mcglehighedu fax contributing editors carl brenner brennerlamontldgocolumbiaedu john setel odonnell jodequatorcomadvisors caroljane stolow director william s stolow president the lyme disease network of new jersey chief proofreader ed mackey elmlehigheduwhen comments are presented with an attribution they do not necessarilyrepresent the opinionsanalyses of the editorthis newsletter may be reproduced andor posted on bulletin boards freelyas long as it is not modified or abridged in any waysend all bug reports to mcglehighedufrom badboynetcomcom jay kellersubject re can men get yeast infectionscan men get yeast infections spread them what kind of symptomsmy ent doctor told me that it is not uncommon for the wife to get a vaginalyeast infection after the husband takes antibiotics in fact this recentlyhappened to my wife explanation is that the antibiotics kill the yeastscompetition they then thrive and increased yeast around the penis spreadthe infection during intercourse i was on ceclor for days then my wifegot the yeastjay kellerbadboynetcomcomfrom garyconcavecswitsacza gary taylorsubject umbilical herniacould anyone give me information on umbilical herniasthe patient is over weight and has a protruding herniasurgery may be risky due to the obesitywhat other remedies could i trythanx in advancedr gary taylorfrom sppzabriskieberkeleyedu steve popesubject re can men get yeast infectionsa woman once told me her doctor told her that icould catch asymptomatically her yeast infectionfrom her then give it back to her causinga relapseprobably bogus but if not its another reason to uselatexstevefrom badboynetcomcom jay kellersubject re proventil inhalerin article bbcdebrickysubysuedu rickysubysuedu rick marsico writesdoes the proventil inhaler for asthma relief fall into the steroidor nonsteroid category looking at the product literature itsnot clearnonsteroid proventil is a brand of albuterol a bronchodilator regardsjay kellerasthmatic proventilheadfrom reswgalenmedvirginiaedu robert e schmiegsubject re med school admissionhosspanixcom writes hi all ive applied for the class of at quite a number of schools and have gotten rejects interviews and no responsesthree possible results after interview rejection outright acceptance outright the infamous wait list if you are on a wait list your entrance into medical schoolis dependent upon some other applicant withdrawing theiracceptance this can happen as late as day of startingclasses any one know when the heck these people send out their acceptance letters according to the med school admissions book theyre supposed to send out the number of their class in acceptances by mid march whats going on i am losing my sanity checking my mailbox every dayyou can always call the admissions office the secretariesshould have some idea of when a decision might be made on yourapplication be calm respectful and friendly secretarieshave more power than you might realize and you never knowcould be the dean of admissions answering the phone also does anyone have some useful alternatives in case i dont get in iif you dont get in this year sit down and reevaluateyourself your motives desires and goals that are directingyou into medicine your academic and extracurricularaccomplishments make a decision about whether you reallywant to be a medical doctor i had classmates who dropped outin the first semester of med school because they found it wasnot what they wanted to do i have friends who applied fouryears in a row before they were accepted medicine as acareer is a choice you must make for yourself dont bepushed into it because of your parentsfamilysignificantother if you still want to be a medical doctor determine how youcan improve your application a letter of recommendation froma professor who knows you well and can give an honest positiverecommendation is far better than one from a bigshot famousprofessor who only vaguely remembers your face also dontbe afraid to ask these people if they can give you an honestand positive recommendation give them a chance to say nosorry instead of the medical school saying no sorry ihave turned down writing recommendations for some studentsbecause i did not know them well enough to make any meaningfulcomments and some because i honestly could not recommend themat that point rewrite your personal statement take it by an englishprofessor or some other friendly person with skill andexperience in writing and proofreading and get theircriticism both about what you are saying as well as how yousay itreview your academic accomplishments if your grades are poorin some area dont be afraid to spend some time in furthercoursework evidence of determined committment will helphere if you filled your premedicine curriculum with gutcourses it usually showslook at your extracurricular involvements participating inlocal philanthropic or service organizations is a plussubstantial leadership roles in an organization help alsobeware of resume padding such things are not difficult tospot and weed outoverall a clear conception of where you wish to head and whyyou want to get there combined with an honest selfappraisalof skills and aptitude will be the best path to take inapplying to any program medical or whathaveyougood luck with the process as tom petty says the waitingis the hardest part at least emotionally bob schmiegfrom badboynetcomcom jay kellersubject sinus surgery septoplasty my ent doctor recommended surgery to fix my sinuses i have a very deviatednasal septum probably the result at least partially from several fracturesone side has approximately of normal flow of course i have known thisfor years but recently discovered that i suffer from chronic sinus infectiondiscovered during an mri after a severe migraine a ct scan subsequently confirmed the problems in the sinuseshe wants to do endoscopic sinus surgery on the ethmoid maxillary frontaland sphenoid along with nasal septoplastyhe explained the procedure and the risks what i would like to know is ifthere is anyone out there who can tell me i had this surgery and it helpedmeive already heard from a couple who said they had it and it didntreally help themi am a moderately severe asthmatic ent doc says large percentage see somerelief of their asthma after sinus surgery also he said it is not unheard ofthat migraines go away after chronis sinusitis is relievedi am any relevant information is appreciatedregardsjay kellersunnyvale californiabadboynetcomcomfrom jpricedpwcom janice pricesubject iridology any credence to iti saw a printed up flyer that stated the person was alicensed herbologist and iridologistwhat are your opinionshow much can you tell about a persons health by looking into their eyesfrom chchovnetibmcom chulhee cho subject prohibit for spiral meningitisi like to know how effective prohibit is to prevent spiral meningitisfor a child who is five years old i heard its from canadawhat sort of side effects etcchulhee chofrom stephen dubin sdubinigcapcorgsubject re pregnency without sexi think you must have the same hygiene teacher i had in there is a story about the civil war about a soldier who was shot in thegroin the bullet after passing through one of his testes then enteredthe abdomen of a young woman standing nearby later when she a youngwoman of unimpeachible virtue was shown to be pregnant the soldier didthe honorable thing of marrying her according to this story they livedhappily ever after perhaps the most famous of mr raus classes was the time he would comeinto class brandishing an aluminum turning mandrel tapering from about to over a inch length he would say boys do you knowwhat this is its a medical instrument called a cock reamer and itsused to unclog your penis when you have vd they just ram it up therewithout an anesthetic needless to say this had a chilling effecti didnt have lascivious thoughts for at least an hour later in lifeas i perused medical instrument catelogs and saw the slender flexibleurethral sounds that are actually used i could not escape thinkingthat i might one day see reamer cock style of rau from mmatusevradfordvakededu melissa n matusevichsubject re pregnency without sexspeaking of educational systems i recently had a colleaguetell me that the reason one of our fifth grade students is sophysically developed is because she was sexually abused as a youngerchild this she went on to say kicks the pituitary gland intoaction and causes pubertyfrom kiranvillagecom kiran waglesubject re is msg sensitivity superstitioni wrotekw if you dont like additives then for godsake kw get off the net and learn to cook from scratch sheeshmary allison exclaimsma excuse mema why cant people learn to cook from scratch on the net ma ive gotten lots of recipes off the net that dont use additivesbecause one simply cant cook on the net nor can one cook while on thenet cooking is best done in a kitchen on a stove gotcha grini said this out of general frustration at people not anyone in particular who seem to expect packaged food to conform to their tastes in other words if packaged foods are not to your liking prepare foods that arema if you like additives then get off the net and go to your localma supermarket buy lots of packaged foods and you get off the neti dont have strong feelings about additives as long as i cant taste emas for the rest of your reply to me i am sorry it it seemed as if i was picking on you i wasnt trying to do so please accept my apologies kiran from chungyrebeccaitsrpiedu yau felix chungsubject nasopharinx carcenomahi does anyone know the possible causes of nasoparynx carcenomaand what are the chances of it being hereditaryalso in the advacned cases what is the general procedure to reduce the pain the area as it prevents the patient from eatingdue to the excessive pain of swallowing and even talkingthanksffrom kxgstpittedu kenneth gilbertsubject re cats and pregnancyin article apretlgojp klausiprigojp klaus hofmann writeshelloi heard that a certain disease toxoplasmosys is transmitted by cats whichcan harm the unborn fetus does anybody know about it is it a problem to have a cat in the same apartmenthaving the cat around is not a problem but the pregnant woman should notchange the litter box toxoplasmosis can be transmitted from the stool ofsome cats kenneth gilbert university of pittsburgh general internal medicine dammit not a programmer from tegarrulkyvxlouisvilleedusubject herpes questioni am looking for some clarification on a subject that i am trying to find someinformation onhow is hsv herpes transmitted i currently know that it can be transmittedduring inflammation but what i am looking for is if it can be transmitted during in other periods also i want to know if you can be accurately tested for it while you are not showing symtomsif you can help i would greatly appreciate ittegfrom limgraphicsrentcom julie limsubject re is msg sensitivity superstitionmichaeliastateedu michael m huang writes msg is common in many food we eat including chinese though some oriental restaurants might put a tad too much in them ive noticed that when i go out and eat in most of the chinese food restaurants i will usually get a slight headache and an ununsual thirst afterwards this happens to many of my friends and relatives too and heh we eat chinese food all the time at home but we dont use msg when were cooking for ourselves heck i seem to feel like that every time i eat out including in the cafeteria at work about half the time the headache intensifies until nothing will make it go away except throwing up ick as you might imagine i dont eat out a lot i guess my tolerance for food additives has plummeted since i switched to eating mostly steamed veggies theyre easy to fix thats all i wont even mention what happened the last time i ate corned beef oops too late the graphics bbs its better than a sharp stick in the eye internet limgraphicsrentcom julie lim uucp rutgersbobsboxgraphicslimfrom andreaunityncsuedu andrea m freekwiatkowskisubject re can men get yeast infectionssteve pope sppzabriskieberkeleyedu wrote a woman once told me her doctor told her that i could catch asymptomatically her yeast infection from her then give it back to her causing a relapse probably bogus but if not its another reason to use latex steveit isnt bogus i had chronic vaginal yeast infections that would go awaywith cream but reappear in about weeks i had been on rounds ofantibiotics for a resistant sinus infection and my husband had been onamoxicillin also for a sinus infection after six months of this i wentto a gynecologist who had me culture my husband seminal fluid after days incubation he had quite a bit of yeast growth it was confirmed bythe lab a round of nizerol for him cleared both of usandrea kwiatkowskifrom aldridgenetcomcom jacquelin aldridgesubject re pregnency without sexmmatusevradfordvakededu melissa n matusevich writesspeaking of educational systems i recently had a colleaguetell me that the reason one of our fifth grade students is sophysically developed is because she was sexually abused as a youngerchild this she went on to say kicks the pituitary gland intoaction and causes pubertynonsense ive taught fifth sixth seventh there are a few early puberty types in fifth and it has nothing to do with early sexual experience jackiefrom russpmafireinelgov russ brownsubject re nasopharinx carcenomain article yzdrpiedu chungyrebeccaitsrpiedu yau felix chung writeshi does anyone know the possible causes of nasoparynx carcenomaand what are the chances of it being hereditarynasopharyngeal cancer is roughly dont have references at hand times more prevalent in chinese than caucasians particularly those chinesefrom southern china one province or region has an extraordinary excess the chinese and others have done major studies some association withthe epsteinbarr virus has been notedalso in the advacned cases what is the general procedure to reduce the pain the area as it prevents the patient from eatingdue to the excessive pain of swallowing and even talkingpalliative radiotherapy is usedfrom suttonvxcrnacernch suttonbernslsubject hip replacementfrom turpincsutexasedu russell turpinsubject re need info on circumcision medical cons and prosin article cygthcsuiucedu blixmiltoncsuiucedu gunnar blix writes i need information on the medical including emotional pros and cons of circumcision at birth i pity those who hope that medical knowledge can resolve issuessuch as this this issue has been rehashed in scimed time andtime again the bottom line is this in normal circumstancesboth the medical advantages of and the medical risks ofcircumcision are minor this means that the decision is left tothe religious cultural ethical and aesthetic mores of theparents at best or to the habit of the concerned hospital orcaregivers at worst as prospective parents you should do what you want in thisregard and not worry about it too much in terms of decisionsyou make for your child it will have far less importance thanmany such as which schools you choose that most parentsthink about only a little this question will undoubtedly push the buttons of people whofeel that the decision to circumcise your infant or not is amomentous medical decision it is notrussellfrom tuserazbukakharkovua subject we can supply you with the transplantants other the private scietific industrial firm intercom cansupply you with the transplantants that could be delivered accordingto your order selection and preparation of the materials is carried out by thequalified personnel having year experience in this sphere we provide immunological selection of tissues on the special request aids syphilis other infection diseases tests biochemical tests we guarantee deliverance of our products within temperaturehabital providing their prime condition oyarosha st apart kharkov ukraine tel fax email tuserazbukakharkovuarelayussreunetfrom donald mackie donaldmackiemedumichedusubject re iridology any credence to itin article aadpwcom janice price jpricedpwcomwriteshow much can you tell about a persons health by looking into theireyesby looking at the iris iridology virtually nothinglooking at the retina allows one to visualise the small bloodvessels and is helpful in assessing various systemic diseaseshypertension and diabetes for exampledon mackie his opinionum will disavowfrom mmmcupportalcom mark robert thorsonsubject re thermogenicsfirst off if im not mistaken only hibernating animals have brown fatnot humanssecondly your description sounds just like dinitrophenol this is anuncoupler of respiratory chain oxidative phosphorylation put in laymansterms it shortcircuits the mitochondria causing food energy to beturned into heatdnp was popular in the s for weight reduction in controlledamounts it raises body temperature as the body compensates for thereduced amount of useful energy available it is very dangerousit would be wiser to adjust to your present body form rather thanplay around with dnpbut if you insist i suggest you look up the literature in your ownuniversity library you can obtain dnp by taking a first yearorganic chemistry lab course and swiping it from the supplies itsa commonlyused reagentfrom mmmcupportalcom mark robert thorsonsubject re hypodermic needlescientific american had a nice short article on the history of thehypodermic about or years ago prior to liquid injectablesthere were paddlelike needles used to implant a tiny pill under theskinfrom rindenterprisebihharvardedu david rindsubject re candidayeast bloom fact or fictionin article aprvmsocomokstateedu banschbachvmsocomokstateedu writesoxygenjust like it does in the vagina as much stuff as there is in the lay press about l acidophilus and vaginal yeast infections im really amazed that someone has not done a clinical trial yet to check it outive mentioned this study a couple of times now ingestion of yogurtcontaining lactobacillus acidophilus as prophylaxis for candidalvaginitis annals of internal medicine do youhave a problem with the study because they used yogurt rather thancapsules of lactobacillus even though it had positive resultsthe study was a crossover trial of daily ingestion of ounces ofyogurt there was a marked decrease in infections while women wereingesting the yogurt problems with the study included very smallnumbers patients enrolled and many protocol violations only patients were analyzed still the difference in rates of infectionbetween the two groups was so large that the study remains fairlybelievable david rindrindenterprisebihharvardedufrom lawrence curcio lcbandrewcmuedusubject re can men get yeast infectionsmy then wife used to get recurrent yeast infections one day herdoctor sent her home with medication for her and a pill for me i tookthe pill upon her insistence and was very relieved the next day when ilooked it up in the pdr it only rarely causes testicular atrophyanyway men apparently do get yeast infectionsfrom wieselelishacsyaleedu elisha wieselsubject info colonics and purificationrecently ive come upon a body of literature which promotes coloncleansing as a vital aid to preventive medicine through nutrition inparticular dr bernard jenssen in his book colon cleansing forhealth and longevity the title actually escapes me but it is verysimilar to that claims that regular selfadministered colonicsalong with certain orally ingested debrisloosening agents booststhe immune system to a significant degreehe also plugs a unique appliance called the colema board whichfacilitates the selfadministration of colonics it sells for over from a californiabased company he also plugs vitratoxproducts as his chemical agents of choice these include volcanic ashsupposedly for its electrical charge and psyllium powder for itsbulkinessif anyone knows anything about colon cleansing theory itsparticulars or the colema board and related products id be veryinterested to hear about research and personal experiencethis article is crossposted to altmagick as the issue touches uponfasting and cleansing through a ritual system of purification eli wieselcsyaleedu elisha wiesel davenport college yale university wieselminervacisyaleedu school homefrom wieselelishayaleedu elisha wieselsubject info colonics and purificationrecently ive come upon a body of literature which promotes coloncleansing as a vital aid to preventive medicine through nutrition inparticular dr bernard jenssen in his book colon cleansing forhealth and longevity the title actually escapes me but it is verysimilar to that claims that regular selfadministered colonicsalong with certain orally ingested debrisloosening agents booststhe immune system to a significant degreehe also plugs a unique appliance called the colema board whichfacilitates the selfadministration of colonics it sells for over from a californiabased company he also plugs vitratoxproducts as his chemical agents of choice these include volcanic ashsupposedly for its electrical charge and psyllium powder for itsbulkinessif anyone knows anything about colon cleansing theory itsparticulars or the colema board and related products id be veryinterested to hear about research and personal experiencethis article is crossposted to altmagick as the issue touches uponfasting and cleansing through a ritual system of purification eli wieselcsyaleedu elisha wiesel davenport college yale university wieselminervacisyaleedu school homefrom piclfsphyphysicsfsuedu picl accountsubject re cats and pregnancyin article apretlgojp klausiprigojp klaus hofmann writesi heard that a certain disease toxoplasmosys is transmitted by cats whichcan harm the unborn fetus does anybody know about it is it a problem to have a cat in the same apartmentthe disease you are talking about is toxoplasmosis it is a protozoan that lives and multiplies within cells in cats the protozoan multiplies in theintestinal cells and eggs are shed in the cats feces the protozoa cancross the placenta to infect the fetus the disease may be asymptomaticafter the baby is born or it may be very severe toxo may cause blindnessand mental retardationhaving a cat in the same apartment should not be a problem however pregnantwomen should not scoop or change the cats litterbox in addition whoeverdoes empty the litterbox should thoroughly wash hisher hands before handlinganything else especially foodinformation came from the merck manual th edi hope this information is helpful to youelisapiclfsphyphysicsfsuedufrom danielsiemenscom daniel l theivanayagamsubject usmle formerly national boards part request to medical studentsthis request goes out to medical students who have doneor are planning to sit the usmle or national boards part my wife is sitting this examination in early june this year and wouldlike to have a look at some old national boards part questionsfound in the following books these books are currently out of print the books are retired nbme basic medical science test items nbme published by nbme in selftest in the part basic medical sciences nbme published by nbme in i would appreciate if anyone who has these books is willingto loan it to her for a couple of days obviously i wouldreimburse for you all postage and related charges failingthat it would be beneficial if anyone could point to anylibrary in the ny nj or pa area that may have these booksplease respond by email since i do not read this newsgroupregularlythanks in advancedanielemail daniellearningsiemenscomfrom giamomjduvmocsdrexeledu mike gsubject re need info on circumcision medical cons and prosneed info on circumcision medical cons and prosin article cygthcsuiucedu gunnar blix blixmiltoncsuiuceduwritesi need information on the medical including emotional pros andcons of circumcision at birth i am especially interested inreferences to studies that indicate disadvantages or refute studiesthat indicate advantages a friend who is a medical student iswriting a survey paper and apparently the studies she has run intoare all for circumcision the main argument being a lower risk ofpenile cancerplease email responses as i am not a frequent reader of either groupi will summarize to the netim very surprised that medical schools still push routine circumcisionof newborn males on the population since your friend is not a man shecant imagine what its like to have a penis much less a foreskin iguess if american medicine did an artistic job of circumcising everymale then the visual result would be somewhat more natural inappearancethe penile cancer thing has been completely debunkedshe must begoing to school on a south pacific island tell her to check the journalor urology for circumcision articles i remember at least on an oldjewish man cut at birth who developed penile canceri mean if thecancer risk was that great the europe who have been circumcising likecrazy too teaching a boy how to keep his cockhead clean is the issue alittle proper hygiene goes a long way americans are just too hung up onthe penis to consider cleaning it thats just way too much likemastubation so you have surgical intervention that is basicallyunnecessaryfrom sjgmathswarwickacuk susannah gortsubject allergies and stuff was is msg sensitivity superstition unless i plan on getting sick i wont eat the stuff without my seldane and did i ever learn to read labels it might not please a medical researcher but it pleased my own personal physician enough for him to give me allergy medicine allergy medicine huh is this just to get rid of the resultant migraine orwhatever or does it actually suppress allergic reactions ie like anantihistamine does as far as doctors over here are concerned if you slip upand eat something youre allergic to even if they wont test you to tell youwhat to avoid then tough if a cheap medicine will alleviate your symptomsthen fine otherwise you just suffer one doctor did prescribe me imigran coststhe nhs for tablets after having to rehydrate me because id been throwingup for four solid days and couldnt even drink water but i got taken off itagain when i moved and had to change doctors reasoning they did not know whatthe sideeffects were because it was new ok fine but it has passed thesafety tests to get on the prescription list and anyway i was prepared to takethe risk to have quality of life now the only alternatives i have is to get itprescribed privately which i cannot afford or to pay a private allergyspecialist to test me and tell me what to avoid i am fairly certain i amallergic to more than one chemical additive as a lot of things i cant eat havenothing in common except things i know are safe so testing myself isnt reallyan option there are too many permutations im not saying i never consume anything with msg ive noticed that i have a certain tolerance level like a small bag of bbq chips once a month or so it not a problem but that same bag of chips will bother me if i also had chicken bouillon yesterday and lunch at one of the chinese restaurants the day before yes ive noticed that and i can work it up by eating just under the tolerancelevel fairly regularly if i dont eat anything except home cooking for a monthor so i lose it and have to work it up from scratch a bad experience now iknow what the earlywarning symptoms are though i can usually tell whether i amallergic to food before ive eaten too much of it usuallyfrom kryansteinuwashingtonedu kerry ryansubject looking for info on kemotherapysphello a friend is under going kemotherapysp for breast cancer imtrying to learn what i can about it any info would be appreciatedthanksfrom carlsolgpscaltechedu carl j lydicksubject re krillean photographyin article aprultbiscritedu easultbiscritedu ea story writesin article rgrsvinnmprgapcaltechedu carlsolgpscaltechedu writesgregflame definitely intended here bill was making fun of the misspelling go look up the word krill also the correct spelling is kirlian itinvolves taking photographs of corona discharges created by attaching thesubject to a highvoltage source not of some aura it works equally wellwith inanimate objectstrue but what about showing the missing part of a leaf is thiscorona dischargeyup the demonstration to which you refer consists of placing a leaf betweenthe plates and taking a kirlian photograph of it you then cut off part ofthe leaf put the top plate back on and take another kirlian photograph yousee pretty much the same image in both cases turns out the effect isntnearly so striking if you take the trouble to clean the plates betweenphotographs seems that the moisture from the leaf that you left on the placeconducts electricity surprise surprisecarl j lydick internet carlsolgpscaltechedu nsihepnet solcarldisclaimer hey i understand vaxen and vms thats what i get paid for myunderstanding of astronomy is purely at the amateur level or below sounless what im saying is directly related to vaxvms dont hold me or myorganization responsible for it if it is related to vaxvms you can try tohold me responsible for it but my organization had nothing to do with itfrom pajukcogecmrc paul johnsonsubject re help for kidney stones in article etxmowgarboc etxmowgarboericssonse mats winberg writes isnt there a relatively new treatment for kidney stones involving a noninvasive use of ultrasound where the patient is lowered into some sort of liquid when heshe undergoes treatment im sure ive read about it somewhere if i remember it correctly it is a painless and effective treatment a couple of weeks ago i visited a hospital here in stockholm and saw big signs showing the way to the kidney stone chrusher i saw this a few years ago on tomorrows world lowbrow bbctechnology news program the patient is lowered into a bath ofdeionized water and carefully positioned high intensity pressurewaves are generated by an electric spark in the water you dont getelectrocuted because deionised water does not conduct these waves arefocused on the kidneys by a parabolic reflector and cause the stone tobreak up this is completely painlessof course you then have to get these little bits of gravel throughthe urethra ouchpaul paul johnson pajgecmrccouk tel ext these ideas and others like them can be had gecmarconi research is notfor each from any reputable idealist responsible for my opinionsfrom hdalbnyvmsbitnet chip dunhamsubject re use of haldol in elderlyin article westescxqfrnetcomcom westesnetcomcom will estes writesdoes anyone know of research done on the use of haldol in the elderly does shortterm use of the drug ever produce longterm sideeffects afterthe use of the drug my grandmother recently had to be hospitalizedand was given large doses of haldol for several weeks although thedrug has been terminated she has changed from a perky slightlysenile woman into a virtual vegetable who does not talk to anyoneand who cannot even eat or brush her teeth without assistance itseems incredible to me that such changes could take place in thecourse of just one and onehalf months i have to believe that thecombination of the hospital stay and some drugs are in partcatalysts for this any comments will estesinternet westesnetcomcomhaldol one of the wonder drugs that works wonders if youre a carrot thatishenry dunham chip emtd nremtcoordinator of ems operationshouston field house emshdalbnyvmsbitnetfrom westesnetcomcom will estessubject re use of haldol in elderlylawrence curcio lcbandrewcmuedu wrote ive seen people in their forties and fifties become disoriented and demented during hospital stays in the examples ive seen drugs were definitely involved my own father turned into a vegetable for a short time while in the hospital he was fiftythree at the time and he was on separate medications the family protested but the doctors were adamant telling us that none of the drugs interact they even took the attitude that if he was disoriented they should put him on something else as well with the help of an md friend of the family we had all his medication discontinued he had a seizure that night and was put back on one drug two days later he was his old self again i guess there arent many medical texts that address the subject of way interactionsi saw the same thing happen to my father and i can more or less validate yourtake on hospitals it seems to me that medical science understands preciouslittle about taking care of the human machine drugs are given as aresponse to symptoms and i guess that makes sense since all the studies that validate the effectiveness of those drugs are based on a narrowassessment of the degree of particular symptoms but there seemsto be very little appreciation for the wellbeing of a personoutside of the numbers that appear on a test i watched my dadwither away and lose huge amounts of body fat and muscles tissuewhile in the hospital there is something a little crazy about asystem in which there is more attention paid to giving you everylatest drug available than there is attention paid to whether youhave had enough to eat to prevent loss of muscle tissue it isreally really bizarre will estesinternet westesnetcomcomfrom matthewsoswegoedu harry matthewssubject re pregnency without sexall right listen up what are the possibilities of transmission throughswimming pool water especially if the chlorination isnt up to parive heard of community swimming pools refered to as public urinals so whatelse is going onfrom alexvusevanderbiltedu alexander p zijdenbossubject re krillean photographyflame onreading through the posts about kirlian whatever spellingphotography i couldnt help but being slightly disgusted by thenarrowminded i know it all i dont believe what i cant see ormeasure attitude of many people out therei am neither a real believer nor a disbeliever when it comes tosocalled paranormal stuff but as far as im concerned it is justas likely as the existence of for instance a god which seems to bequite accepted in our societies without any scientific basisi am convinced that it is a serious mistake to close your mind tosomething anything simply because it doesnt fit your current frameof reference history shows that many great people great scientistswere people who kept an open mind and were ridiculed by scepticsespecially the usa should be grateful after all columbus did notdrop off the edge of the earthflame off or end sermon alexfrom pyanehdhwcca ping yansubject what is the medical term for this sensationdear nettersmaybe one of you can explain this from time to time i experience a strange kind of feeling i have all kinds of weird feelings which can be best described as the feeling of losing gravity like that one experiences in a descending elevator needless to say it is not enjoyable it sometimes comes with shortness of breath and extreme fatigue it lasts from a few minutes to an hour and when it lasts that long it makes me sweateninginitially i called it palpitation spelling until i later learnt that the terminology has been reserved for the selfawareness of heart beatsso is there a specific term for this feeling or am i a stragne personi always believe i am unique thankspingfrom groleauesacrdgecom wes groleau xsubject re discussions on altpsychoactivesre serious discussion about drugs vs where can i get a good bong manwhy not have the group moderated that would eliminate some of the idiotssubject vasectomy health effects on womenfrom eskagerbnermalsantarosaedu eric skagerbergdoes anyone know of any studies done on the longterm health effects