org.apache.jasper.compiler.Validator Maven / Gradle / Ivy
/*
* Licensed to the Apache Software Foundation (ASF) under one or more
* contributor license agreements. See the NOTICE file distributed with
* this work for additional information regarding copyright ownership.
* The ASF licenses this file to You under the Apache License, Version 2.0
* (the "License"); you may not use this file except in compliance with
* the License. You may obtain a copy of the License at
*
* http://www.apache.org/licenses/LICENSE-2.0
*
* Unless required by applicable law or agreed to in writing, software
* distributed under the License is distributed on an "AS IS" BASIS,
* WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
* See the License for the specific language governing permissions and
* limitations under the License.
*/
package org.apache.jasper.compiler;
import java.lang.reflect.Method;
import java.util.ArrayList;
import java.util.HashMap;
import java.util.Hashtable;
import java.util.Iterator;
import java.util.Locale;
import javax.el.ELException;
import javax.el.ExpressionFactory;
import javax.el.FunctionMapper;
import javax.servlet.jsp.JspFactory;
import javax.servlet.jsp.tagext.FunctionInfo;
import javax.servlet.jsp.tagext.PageData;
import javax.servlet.jsp.tagext.TagAttributeInfo;
import javax.servlet.jsp.tagext.TagData;
import javax.servlet.jsp.tagext.TagExtraInfo;
import javax.servlet.jsp.tagext.TagInfo;
import javax.servlet.jsp.tagext.TagLibraryInfo;
import javax.servlet.jsp.tagext.ValidationMessage;
import org.apache.jasper.JasperException;
import org.apache.jasper.compiler.ELNode.Text;
import org.apache.jasper.el.ELContextImpl;
import org.xml.sax.Attributes;
/**
* Performs validation on the page elements. Attributes are checked for
* mandatory presence, entry value validity, and consistency. As a side effect,
* some page global value (such as those from page directives) are stored, for
* later use.
*
* @author Kin-man Chung
* @author Jan Luehe
* @author Shawn Bayern
* @author Mark Roth
*/
class Validator {
/**
* A visitor to validate and extract page directive info
*/
private static class DirectiveVisitor extends Node.Visitor {
private final PageInfo pageInfo;
private final ErrorDispatcher err;
private static final JspUtil.ValidAttribute[] pageDirectiveAttrs = {
new JspUtil.ValidAttribute("language"),
new JspUtil.ValidAttribute("extends"),
new JspUtil.ValidAttribute("import"),
new JspUtil.ValidAttribute("session"),
new JspUtil.ValidAttribute("buffer"),
new JspUtil.ValidAttribute("autoFlush"),
new JspUtil.ValidAttribute("isThreadSafe"),
new JspUtil.ValidAttribute("info"),
new JspUtil.ValidAttribute("errorPage"),
new JspUtil.ValidAttribute("isErrorPage"),
new JspUtil.ValidAttribute("contentType"),
new JspUtil.ValidAttribute("pageEncoding"),
new JspUtil.ValidAttribute("isELIgnored"),
new JspUtil.ValidAttribute("deferredSyntaxAllowedAsLiteral"),
new JspUtil.ValidAttribute("trimDirectiveWhitespaces")
};
private boolean pageEncodingSeen = false;
/*
* Constructor
*/
DirectiveVisitor(Compiler compiler) {
this.pageInfo = compiler.getPageInfo();
this.err = compiler.getErrorDispatcher();
}
@Override
public void visit(Node.IncludeDirective n) throws JasperException {
// Since pageDirectiveSeen flag only applies to the Current page
// save it here and restore it after the file is included.
boolean pageEncodingSeenSave = pageEncodingSeen;
pageEncodingSeen = false;
visitBody(n);
pageEncodingSeen = pageEncodingSeenSave;
}
@Override
public void visit(Node.PageDirective n) throws JasperException {
JspUtil.checkAttributes("Page directive", n, pageDirectiveAttrs,
err);
// JSP.2.10.1
Attributes attrs = n.getAttributes();
for (int i = 0; attrs != null && i < attrs.getLength(); i++) {
String attr = attrs.getQName(i);
String value = attrs.getValue(i);
if ("language".equals(attr)) {
if (pageInfo.getLanguage(false) == null) {
pageInfo.setLanguage(value, n, err, true);
} else if (!pageInfo.getLanguage(false).equals(value)) {
err.jspError(n, "jsp.error.page.conflict.language",
pageInfo.getLanguage(false), value);
}
} else if ("extends".equals(attr)) {
if (pageInfo.getExtends(false) == null) {
pageInfo.setExtends(value);
} else if (!pageInfo.getExtends(false).equals(value)) {
err.jspError(n, "jsp.error.page.conflict.extends",
pageInfo.getExtends(false), value);
}
} else if ("contentType".equals(attr)) {
if (pageInfo.getContentType() == null) {
pageInfo.setContentType(value);
} else if (!pageInfo.getContentType().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.contenttype",
pageInfo.getContentType(), value);
}
} else if ("session".equals(attr)) {
if (pageInfo.getSession() == null) {
pageInfo.setSession(value, n, err);
} else if (!pageInfo.getSession().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.session",
pageInfo.getSession(), value);
}
} else if ("buffer".equals(attr)) {
if (pageInfo.getBufferValue() == null) {
pageInfo.setBufferValue(value, n, err);
} else if (!pageInfo.getBufferValue().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.buffer",
pageInfo.getBufferValue(), value);
}
} else if ("autoFlush".equals(attr)) {
if (pageInfo.getAutoFlush() == null) {
pageInfo.setAutoFlush(value, n, err);
} else if (!pageInfo.getAutoFlush().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.autoflush",
pageInfo.getAutoFlush(), value);
}
} else if ("isThreadSafe".equals(attr)) {
if (pageInfo.getIsThreadSafe() == null) {
pageInfo.setIsThreadSafe(value, n, err);
} else if (!pageInfo.getIsThreadSafe().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.isthreadsafe",
pageInfo.getIsThreadSafe(), value);
}
} else if ("isELIgnored".equals(attr)) {
if (pageInfo.getIsELIgnored() == null) {
pageInfo.setIsELIgnored(value, n, err, true);
} else if (!pageInfo.getIsELIgnored().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.iselignored",
pageInfo.getIsELIgnored(), value);
}
} else if ("isErrorPage".equals(attr)) {
if (pageInfo.getIsErrorPage() == null) {
pageInfo.setIsErrorPage(value, n, err);
} else if (!pageInfo.getIsErrorPage().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.iserrorpage",
pageInfo.getIsErrorPage(), value);
}
} else if ("errorPage".equals(attr)) {
if (pageInfo.getErrorPage() == null) {
pageInfo.setErrorPage(value);
} else if (!pageInfo.getErrorPage().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.errorpage",
pageInfo.getErrorPage(), value);
}
} else if ("info".equals(attr)) {
if (pageInfo.getInfo() == null) {
pageInfo.setInfo(value);
} else if (!pageInfo.getInfo().equals(value)) {
err.jspError(n, "jsp.error.page.conflict.info",
pageInfo.getInfo(), value);
}
} else if ("pageEncoding".equals(attr)) {
if (pageEncodingSeen)
err.jspError(n, "jsp.error.page.multi.pageencoding");
// 'pageEncoding' can occur at most once per file
pageEncodingSeen = true;
String actual = comparePageEncodings(value, n);
n.getRoot().setPageEncoding(actual);
} else if ("deferredSyntaxAllowedAsLiteral".equals(attr)) {
if (pageInfo.getDeferredSyntaxAllowedAsLiteral() == null) {
pageInfo.setDeferredSyntaxAllowedAsLiteral(value, n,
err, true);
} else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral()
.equals(value)) {
err
.jspError(
n,
"jsp.error.page.conflict.deferredsyntaxallowedasliteral",
pageInfo
.getDeferredSyntaxAllowedAsLiteral(),
value);
}
} else if ("trimDirectiveWhitespaces".equals(attr)) {
if (pageInfo.getTrimDirectiveWhitespaces() == null) {
pageInfo.setTrimDirectiveWhitespaces(value, n, err,
true);
} else if (!pageInfo.getTrimDirectiveWhitespaces().equals(
value)) {
err
.jspError(
n,
"jsp.error.page.conflict.trimdirectivewhitespaces",
pageInfo.getTrimDirectiveWhitespaces(),
value);
}
}
}
// Check for bad combinations
if (pageInfo.getBuffer() == 0 && !pageInfo.isAutoFlush())
err.jspError(n, "jsp.error.page.badCombo");
// Attributes for imports for this node have been processed by
// the parsers, just add them to pageInfo.
pageInfo.addImports(n.getImports());
}
@Override
public void visit(Node.TagDirective n) throws JasperException {
// Note: Most of the validation is done in TagFileProcessor
// when it created a TagInfo object from the
// tag file in which the directive appeared.
// This method does additional processing to collect page info
Attributes attrs = n.getAttributes();
for (int i = 0; attrs != null && i < attrs.getLength(); i++) {
String attr = attrs.getQName(i);
String value = attrs.getValue(i);
if ("language".equals(attr)) {
if (pageInfo.getLanguage(false) == null) {
pageInfo.setLanguage(value, n, err, false);
} else if (!pageInfo.getLanguage(false).equals(value)) {
err.jspError(n, "jsp.error.tag.conflict.language",
pageInfo.getLanguage(false), value);
}
} else if ("isELIgnored".equals(attr)) {
if (pageInfo.getIsELIgnored() == null) {
pageInfo.setIsELIgnored(value, n, err, false);
} else if (!pageInfo.getIsELIgnored().equals(value)) {
err.jspError(n, "jsp.error.tag.conflict.iselignored",
pageInfo.getIsELIgnored(), value);
}
} else if ("pageEncoding".equals(attr)) {
if (pageEncodingSeen)
err.jspError(n, "jsp.error.tag.multi.pageencoding");
pageEncodingSeen = true;
compareTagEncodings(value, n);
n.getRoot().setPageEncoding(value);
} else if ("deferredSyntaxAllowedAsLiteral".equals(attr)) {
if (pageInfo.getDeferredSyntaxAllowedAsLiteral() == null) {
pageInfo.setDeferredSyntaxAllowedAsLiteral(value, n,
err, false);
} else if (!pageInfo.getDeferredSyntaxAllowedAsLiteral()
.equals(value)) {
err
.jspError(
n,
"jsp.error.tag.conflict.deferredsyntaxallowedasliteral",
pageInfo
.getDeferredSyntaxAllowedAsLiteral(),
value);
}
} else if ("trimDirectiveWhitespaces".equals(attr)) {
if (pageInfo.getTrimDirectiveWhitespaces() == null) {
pageInfo.setTrimDirectiveWhitespaces(value, n, err,
false);
} else if (!pageInfo.getTrimDirectiveWhitespaces().equals(
value)) {
err
.jspError(
n,
"jsp.error.tag.conflict.trimdirectivewhitespaces",
pageInfo.getTrimDirectiveWhitespaces(),
value);
}
}
}
// Attributes for imports for this node have been processed by
// the parsers, just add them to pageInfo.
pageInfo.addImports(n.getImports());
}
@Override
public void visit(Node.AttributeDirective n) throws JasperException {
// Do nothing, since this attribute directive has already been
// validated by TagFileProcessor when it created a TagInfo object
// from the tag file in which the directive appeared
}
@Override
public void visit(Node.VariableDirective n) throws JasperException {
// Do nothing, since this variable directive has already been
// validated by TagFileProcessor when it created a TagInfo object
// from the tag file in which the directive appeared
}
/*
* Compares page encodings specified in various places, and throws
* exception in case of page encoding mismatch.
*
* @param pageDirEnc The value of the pageEncoding attribute of the page
* directive @param pageDir The page directive node
*
* @throws JasperException in case of page encoding mismatch
*/
private String comparePageEncodings(String thePageDirEnc,
Node.PageDirective pageDir) throws JasperException {
Node.Root root = pageDir.getRoot();
String configEnc = root.getJspConfigPageEncoding();
String pageDirEnc = thePageDirEnc.toUpperCase(Locale.ENGLISH);
/*
* Compare the 'pageEncoding' attribute of the page directive with
* the encoding specified in the JSP config element whose URL
* pattern matches this page. Treat "UTF-16", "UTF-16BE", and
* "UTF-16LE" as identical.
*/
if (configEnc != null) {
configEnc = configEnc.toUpperCase(Locale.ENGLISH);
if (!pageDirEnc.equals(configEnc)
&& (!pageDirEnc.startsWith("UTF-16") || !configEnc
.startsWith("UTF-16"))) {
err.jspError(pageDir,
"jsp.error.config_pagedir_encoding_mismatch",
configEnc, pageDirEnc);
} else {
return configEnc;
}
}
/*
* Compare the 'pageEncoding' attribute of the page directive with
* the encoding specified in the XML prolog (only for XML syntax,
* and only if JSP document contains XML prolog with encoding
* declaration). Treat "UTF-16", "UTF-16BE", and "UTF-16LE" as
* identical.
*/
if ((root.isXmlSyntax() && root.isEncodingSpecifiedInProlog()) || root.isBomPresent()) {
String pageEnc = root.getPageEncoding().toUpperCase(Locale.ENGLISH);
if (!pageDirEnc.equals(pageEnc)
&& (!pageDirEnc.startsWith("UTF-16") || !pageEnc
.startsWith("UTF-16"))) {
err.jspError(pageDir,
"jsp.error.prolog_pagedir_encoding_mismatch",
pageEnc, pageDirEnc);
} else {
return pageEnc;
}
}
return pageDirEnc;
}
/*
* Compares page encodings specified in various places, and throws
* exception in case of page encoding mismatch.
*
* @param thePageDirEnc The value of the pageEncoding attribute of the page
* directive @param pageDir The page directive node
*
* @throws JasperException in case of page encoding mismatch
*/
private void compareTagEncodings(String thePageDirEnc,
Node.TagDirective pageDir) throws JasperException {
Node.Root root = pageDir.getRoot();
String pageDirEnc = thePageDirEnc.toUpperCase(Locale.ENGLISH);
/*
* Compare the 'pageEncoding' attribute of the page directive with
* the encoding specified in the XML prolog (only for XML syntax,
* and only if JSP document contains XML prolog with encoding
* declaration). Treat "UTF-16", "UTF-16BE", and "UTF-16LE" as
* identical.
*/
if ((root.isXmlSyntax() && root.isEncodingSpecifiedInProlog()) || root.isBomPresent()) {
String pageEnc = root.getPageEncoding().toUpperCase(Locale.ENGLISH);
if (!pageDirEnc.equals(pageEnc)
&& (!pageDirEnc.startsWith("UTF-16") || !pageEnc
.startsWith("UTF-16"))) {
err.jspError(pageDir,
"jsp.error.prolog_pagedir_encoding_mismatch",
pageEnc, pageDirEnc);
}
}
}
}
/**
* A visitor for validating nodes other than page directives
*/
private static class ValidateVisitor extends Node.Visitor {
private final PageInfo pageInfo;
private final ErrorDispatcher err;
private final ClassLoader loader;
private final StringBuilder buf = new StringBuilder(32);
private static final JspUtil.ValidAttribute[] jspRootAttrs = {
new JspUtil.ValidAttribute("xsi:schemaLocation"),
new JspUtil.ValidAttribute("version", true) };
private static final JspUtil.ValidAttribute[] includeDirectiveAttrs = { new JspUtil.ValidAttribute(
"file", true) };
private static final JspUtil.ValidAttribute[] taglibDirectiveAttrs = {
new JspUtil.ValidAttribute("uri"),
new JspUtil.ValidAttribute("tagdir"),
new JspUtil.ValidAttribute("prefix", true) };
private static final JspUtil.ValidAttribute[] includeActionAttrs = {
new JspUtil.ValidAttribute("page", true),
new JspUtil.ValidAttribute("flush") };
private static final JspUtil.ValidAttribute[] paramActionAttrs = {
new JspUtil.ValidAttribute("name", true),
new JspUtil.ValidAttribute("value", true) };
private static final JspUtil.ValidAttribute[] forwardActionAttrs = {
new JspUtil.ValidAttribute("page", true) };
private static final JspUtil.ValidAttribute[] getPropertyAttrs = {
new JspUtil.ValidAttribute("name", true),
new JspUtil.ValidAttribute("property", true) };
private static final JspUtil.ValidAttribute[] setPropertyAttrs = {
new JspUtil.ValidAttribute("name", true),
new JspUtil.ValidAttribute("property", true),
new JspUtil.ValidAttribute("value", false),
new JspUtil.ValidAttribute("param") };
private static final JspUtil.ValidAttribute[] useBeanAttrs = {
new JspUtil.ValidAttribute("id", true),
new JspUtil.ValidAttribute("scope"),
new JspUtil.ValidAttribute("class"),
new JspUtil.ValidAttribute("type"),
new JspUtil.ValidAttribute("beanName", false) };
private static final JspUtil.ValidAttribute[] plugInAttrs = {
new JspUtil.ValidAttribute("type", true),
new JspUtil.ValidAttribute("code", true),
new JspUtil.ValidAttribute("codebase"),
new JspUtil.ValidAttribute("align"),
new JspUtil.ValidAttribute("archive"),
new JspUtil.ValidAttribute("height", false),
new JspUtil.ValidAttribute("hspace"),
new JspUtil.ValidAttribute("jreversion"),
new JspUtil.ValidAttribute("name"),
new JspUtil.ValidAttribute("vspace"),
new JspUtil.ValidAttribute("width", false),
new JspUtil.ValidAttribute("nspluginurl"),
new JspUtil.ValidAttribute("iepluginurl") };
private static final JspUtil.ValidAttribute[] attributeAttrs = {
new JspUtil.ValidAttribute("name", true),
new JspUtil.ValidAttribute("trim"),
new JspUtil.ValidAttribute("omit")};
private static final JspUtil.ValidAttribute[] invokeAttrs = {
new JspUtil.ValidAttribute("fragment", true),
new JspUtil.ValidAttribute("var"),
new JspUtil.ValidAttribute("varReader"),
new JspUtil.ValidAttribute("scope") };
private static final JspUtil.ValidAttribute[] doBodyAttrs = {
new JspUtil.ValidAttribute("var"),
new JspUtil.ValidAttribute("varReader"),
new JspUtil.ValidAttribute("scope") };
private static final JspUtil.ValidAttribute[] jspOutputAttrs = {
new JspUtil.ValidAttribute("omit-xml-declaration"),
new JspUtil.ValidAttribute("doctype-root-element"),
new JspUtil.ValidAttribute("doctype-public"),
new JspUtil.ValidAttribute("doctype-system") };
private final ExpressionFactory expressionFactory;
/*
* Constructor
*/
ValidateVisitor(Compiler compiler) {
this.pageInfo = compiler.getPageInfo();
this.err = compiler.getErrorDispatcher();
this.loader = compiler.getCompilationContext().getClassLoader();
// Get the cached EL expression factory for this context
expressionFactory =
JspFactory.getDefaultFactory().getJspApplicationContext(
compiler.getCompilationContext().getServletContext()).
getExpressionFactory();
}
@Override
public void visit(Node.JspRoot n) throws JasperException {
JspUtil.checkAttributes("Jsp:root", n, jspRootAttrs, err);
String version = n.getTextAttribute("version");
if (!version.equals("1.2") && !version.equals("2.0") &&
!version.equals("2.1") && !version.equals("2.2") &&
!version.equals("2.3")) {
err.jspError(n, "jsp.error.jsproot.version.invalid", version);
}
visitBody(n);
}
@Override
public void visit(Node.IncludeDirective n) throws JasperException {
JspUtil.checkAttributes("Include directive", n,
includeDirectiveAttrs, err);
visitBody(n);
}
@Override
public void visit(Node.TaglibDirective n) throws JasperException {
JspUtil.checkAttributes("Taglib directive", n,
taglibDirectiveAttrs, err);
// Either 'uri' or 'tagdir' attribute must be specified
String uri = n.getAttributeValue("uri");
String tagdir = n.getAttributeValue("tagdir");
if (uri == null && tagdir == null) {
err.jspError(n, "jsp.error.taglibDirective.missing.location");
}
if (uri != null && tagdir != null) {
err
.jspError(n,
"jsp.error.taglibDirective.both_uri_and_tagdir");
}
}
@Override
public void visit(Node.ParamAction n) throws JasperException {
JspUtil.checkAttributes("Param action", n, paramActionAttrs, err);
// make sure the value of the 'name' attribute is not a
// request-time expression
throwErrorIfExpression(n, "name", "jsp:param");
n.setValue(getJspAttribute(null, "value", null, null, n
.getAttributeValue("value"), n, null, false));
visitBody(n);
}
@Override
public void visit(Node.ParamsAction n) throws JasperException {
// Make sure we've got at least one nested jsp:param
Node.Nodes subElems = n.getBody();
if (subElems == null) {
err.jspError(n, "jsp.error.params.emptyBody");
}
visitBody(n);
}
@Override
public void visit(Node.IncludeAction n) throws JasperException {
JspUtil.checkAttributes("Include action", n, includeActionAttrs,
err);
n.setPage(getJspAttribute(null, "page", null, null, n
.getAttributeValue("page"), n, null, false));
visitBody(n);
}
@Override
public void visit(Node.ForwardAction n) throws JasperException {
JspUtil.checkAttributes("Forward", n, forwardActionAttrs, err);
n.setPage(getJspAttribute(null, "page", null, null, n
.getAttributeValue("page"), n, null, false));
visitBody(n);
}
@Override
public void visit(Node.GetProperty n) throws JasperException {
JspUtil.checkAttributes("GetProperty", n, getPropertyAttrs, err);
}
@Override
public void visit(Node.SetProperty n) throws JasperException {
JspUtil.checkAttributes("SetProperty", n, setPropertyAttrs, err);
String property = n.getTextAttribute("property");
String param = n.getTextAttribute("param");
String value = n.getAttributeValue("value");
n.setValue(getJspAttribute(null, "value", null, null, value,
n, null, false));
boolean valueSpecified = n.getValue() != null;
if ("*".equals(property)) {
if (param != null || valueSpecified)
err.jspError(n, "jsp.error.setProperty.invalid");
} else if (param != null && valueSpecified) {
err.jspError(n, "jsp.error.setProperty.invalid");
}
visitBody(n);
}
@Override
public void visit(Node.UseBean n) throws JasperException {
JspUtil.checkAttributes("UseBean", n, useBeanAttrs, err);
String name = n.getTextAttribute("id");
String scope = n.getTextAttribute("scope");
JspUtil.checkScope(scope, n, err);
String className = n.getTextAttribute("class");
String type = n.getTextAttribute("type");
BeanRepository beanInfo = pageInfo.getBeanRepository();
if (className == null && type == null)
err.jspError(n, "jsp.error.usebean.missingType");
if (beanInfo.checkVariable(name))
err.jspError(n, "jsp.error.usebean.duplicate");
if ("session".equals(scope) && !pageInfo.isSession())
err.jspError(n, "jsp.error.usebean.noSession");
Node.JspAttribute jattr = getJspAttribute(null, "beanName", null,
null, n.getAttributeValue("beanName"), n, null, false);
n.setBeanName(jattr);
if (className != null && jattr != null)
err.jspError(n, "jsp.error.usebean.notBoth");
if (className == null)
className = type;
beanInfo.addBean(n, name, className, scope);
visitBody(n);
}
@SuppressWarnings("null") // type can't be null after initial test
@Override
public void visit(Node.PlugIn n) throws JasperException {
JspUtil.checkAttributes("Plugin", n, plugInAttrs, err);
throwErrorIfExpression(n, "type", "jsp:plugin");
throwErrorIfExpression(n, "code", "jsp:plugin");
throwErrorIfExpression(n, "codebase", "jsp:plugin");
throwErrorIfExpression(n, "align", "jsp:plugin");
throwErrorIfExpression(n, "archive", "jsp:plugin");
throwErrorIfExpression(n, "hspace", "jsp:plugin");
throwErrorIfExpression(n, "jreversion", "jsp:plugin");
throwErrorIfExpression(n, "name", "jsp:plugin");
throwErrorIfExpression(n, "vspace", "jsp:plugin");
throwErrorIfExpression(n, "nspluginurl", "jsp:plugin");
throwErrorIfExpression(n, "iepluginurl", "jsp:plugin");
String type = n.getTextAttribute("type");
if (type == null)
err.jspError(n, "jsp.error.plugin.notype");
if (!type.equals("bean") && !type.equals("applet"))
err.jspError(n, "jsp.error.plugin.badtype");
if (n.getTextAttribute("code") == null)
err.jspError(n, "jsp.error.plugin.nocode");
Node.JspAttribute width = getJspAttribute(null, "width", null,
null, n.getAttributeValue("width"), n, null, false);
n.setWidth(width);
Node.JspAttribute height = getJspAttribute(null, "height", null,
null, n.getAttributeValue("height"), n, null, false);
n.setHeight(height);
visitBody(n);
}
@Override
public void visit(Node.NamedAttribute n) throws JasperException {
JspUtil.checkAttributes("Attribute", n, attributeAttrs, err);
n.setOmit(getJspAttribute(null, "omit", null, null, n
.getAttributeValue("omit"), n, null, false));
visitBody(n);
}
@Override
public void visit(Node.JspBody n) throws JasperException {
visitBody(n);
}
@Override
public void visit(Node.Declaration n) throws JasperException {
if (pageInfo.isScriptingInvalid()) {
err.jspError(n.getStart(), "jsp.error.no.scriptlets");
}
}
@Override
public void visit(Node.Expression n) throws JasperException {
if (pageInfo.isScriptingInvalid()) {
err.jspError(n.getStart(), "jsp.error.no.scriptlets");
}
}
@Override
public void visit(Node.Scriptlet n) throws JasperException {
if (pageInfo.isScriptingInvalid()) {
err.jspError(n.getStart(), "jsp.error.no.scriptlets");
}
}
@Override
public void visit(Node.ELExpression n) throws JasperException {
// exit if we are ignoring EL all together
if (pageInfo.isELIgnored())
return;
// JSP.2.2 - '#{' not allowed in template text
if (n.getType() == '#') {
if (!pageInfo.isDeferredSyntaxAllowedAsLiteral()) {
err.jspError(n, "jsp.error.el.template.deferred");
} else {
return;
}
}
// build expression
StringBuilder expr = this.getBuffer();
expr.append(n.getType()).append('{').append(n.getText())
.append('}');
ELNode.Nodes el = ELParser.parse(expr.toString(), pageInfo
.isDeferredSyntaxAllowedAsLiteral());
// validate/prepare expression
prepareExpression(el, n, expr.toString());
// store it
n.setEL(el);
}
@Override
public void visit(Node.UninterpretedTag n) throws JasperException {
if (n.getNamedAttributeNodes().size() != 0) {
err.jspError(n, "jsp.error.namedAttribute.invalidUse");
}
Attributes attrs = n.getAttributes();
if (attrs != null) {
int attrSize = attrs.getLength();
Node.JspAttribute[] jspAttrs = new Node.JspAttribute[attrSize];
for (int i = 0; i < attrSize; i++) {
// JSP.2.2 - '#{' not allowed in template text
String value = attrs.getValue(i);
if (!pageInfo.isDeferredSyntaxAllowedAsLiteral()) {
if (containsDeferredSyntax(value)) {
err.jspError(n, "jsp.error.el.template.deferred");
}
}
jspAttrs[i] = getJspAttribute(null, attrs.getQName(i),
attrs.getURI(i), attrs.getLocalName(i), value, n,
null, false);
}
n.setJspAttributes(jspAttrs);
}
visitBody(n);
}
/*
* Look for a #{ sequence that isn't preceded by \.
*/
private boolean containsDeferredSyntax(String value) {
if (value == null) {
return false;
}
int i = 0;
int len = value.length();
boolean prevCharIsEscape = false;
while (i < value.length()) {
char c = value.charAt(i);
if (c == '#' && (i+1) < len && value.charAt(i+1) == '{' && !prevCharIsEscape) {
return true;
} else if (c == '\\') {
prevCharIsEscape = true;
} else {
prevCharIsEscape = false;
}
i++;
}
return false;
}
@SuppressWarnings("null") // tagInfo can't be null after initial test
@Override
public void visit(Node.CustomTag n) throws JasperException {
TagInfo tagInfo = n.getTagInfo();
if (tagInfo == null) {
err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());
}
/*
* The bodycontent of a SimpleTag cannot be JSP.
*/
if (n.implementsSimpleTag()
&& tagInfo.getBodyContent().equalsIgnoreCase(
TagInfo.BODY_CONTENT_JSP)) {
err.jspError(n, "jsp.error.simpletag.badbodycontent", tagInfo
.getTagClassName());
}
/*
* If the tag handler declares in the TLD that it supports dynamic
* attributes, it also must implement the DynamicAttributes
* interface.
*/
if (tagInfo.hasDynamicAttributes()
&& !n.implementsDynamicAttributes()) {
err.jspError(n, "jsp.error.dynamic.attributes.not.implemented",
n.getQName());
}
/*
* Make sure all required attributes are present, either as
* attributes or named attributes (). Also make sure
* that the same attribute is not specified in both attributes or
* named attributes.
*/
TagAttributeInfo[] tldAttrs = tagInfo.getAttributes();
String customActionUri = n.getURI();
Attributes attrs = n.getAttributes();
int attrsSize = (attrs == null) ? 0 : attrs.getLength();
for (int i = 0; i < tldAttrs.length; i++) {
String attr = null;
if (attrs != null) {
attr = attrs.getValue(tldAttrs[i].getName());
if (attr == null) {
attr = attrs.getValue(customActionUri, tldAttrs[i]
.getName());
}
}
Node.NamedAttribute na = n.getNamedAttributeNode(tldAttrs[i]
.getName());
if (tldAttrs[i].isRequired() && attr == null && na == null) {
err.jspError(n, "jsp.error.missing_attribute", tldAttrs[i]
.getName(), n.getLocalName());
}
if (attr != null && na != null) {
err.jspError(n, "jsp.error.duplicate.name.jspattribute",
tldAttrs[i].getName());
}
}
Node.Nodes naNodes = n.getNamedAttributeNodes();
int jspAttrsSize = naNodes.size() + attrsSize;
Node.JspAttribute[] jspAttrs = null;
if (jspAttrsSize > 0) {
jspAttrs = new Node.JspAttribute[jspAttrsSize];
}
Hashtable tagDataAttrs = new Hashtable<>(attrsSize);
checkXmlAttributes(n, jspAttrs, tagDataAttrs);
checkNamedAttributes(n, jspAttrs, attrsSize, tagDataAttrs);
TagData tagData = new TagData(tagDataAttrs);
// JSP.C1: It is a (translation time) error for an action that
// has one or more variable subelements to have a TagExtraInfo
// class that returns a non-null object.
TagExtraInfo tei = tagInfo.getTagExtraInfo();
if (tei != null && tei.getVariableInfo(tagData) != null
&& tei.getVariableInfo(tagData).length > 0
&& tagInfo.getTagVariableInfos().length > 0) {
err.jspError("jsp.error.non_null_tei_and_var_subelems", n
.getQName());
}
n.setTagData(tagData);
n.setJspAttributes(jspAttrs);
visitBody(n);
}
@Override
public void visit(Node.JspElement n) throws JasperException {
Attributes attrs = n.getAttributes();
if (attrs == null) {
err.jspError(n, "jsp.error.jspelement.missing.name");
}
@SuppressWarnings("null") // Exception will have been thrown above
int xmlAttrLen = attrs.getLength();
Node.Nodes namedAttrs = n.getNamedAttributeNodes();
// XML-style 'name' attribute, which is mandatory, must not be
// included in JspAttribute array
int jspAttrSize = xmlAttrLen - 1 + namedAttrs.size();
Node.JspAttribute[] jspAttrs = new Node.JspAttribute[jspAttrSize];
int jspAttrIndex = 0;
// Process XML-style attributes
for (int i = 0; i < xmlAttrLen; i++) {
if ("name".equals(attrs.getLocalName(i))) {
n.setNameAttribute(getJspAttribute(null, attrs.getQName(i),
attrs.getURI(i), attrs.getLocalName(i), attrs
.getValue(i), n, null, false));
} else {
if (jspAttrIndex < jspAttrSize) {
jspAttrs[jspAttrIndex++] = getJspAttribute(null,
attrs.getQName(i), attrs.getURI(i),
attrs.getLocalName(i), attrs.getValue(i), n,
null, false);
}
}
}
if (n.getNameAttribute() == null) {
err.jspError(n, "jsp.error.jspelement.missing.name");
}
// Process named attributes
for (int i = 0; i < namedAttrs.size(); i++) {
Node.NamedAttribute na = (Node.NamedAttribute) namedAttrs
.getNode(i);
jspAttrs[jspAttrIndex++] = new Node.JspAttribute(na, null,
false);
}
n.setJspAttributes(jspAttrs);
visitBody(n);
}
@Override
public void visit(Node.JspOutput n) throws JasperException {
JspUtil.checkAttributes("jsp:output", n, jspOutputAttrs, err);
if (n.getBody() != null) {
err.jspError(n, "jsp.error.jspoutput.nonemptybody");
}
String omitXmlDecl = n.getAttributeValue("omit-xml-declaration");
String doctypeName = n.getAttributeValue("doctype-root-element");
String doctypePublic = n.getAttributeValue("doctype-public");
String doctypeSystem = n.getAttributeValue("doctype-system");
String omitXmlDeclOld = pageInfo.getOmitXmlDecl();
String doctypeNameOld = pageInfo.getDoctypeName();
String doctypePublicOld = pageInfo.getDoctypePublic();
String doctypeSystemOld = pageInfo.getDoctypeSystem();
if (omitXmlDecl != null && omitXmlDeclOld != null
&& !omitXmlDecl.equals(omitXmlDeclOld)) {
err.jspError(n, "jsp.error.jspoutput.conflict",
"omit-xml-declaration", omitXmlDeclOld, omitXmlDecl);
}
if (doctypeName != null && doctypeNameOld != null
&& !doctypeName.equals(doctypeNameOld)) {
err.jspError(n, "jsp.error.jspoutput.conflict",
"doctype-root-element", doctypeNameOld, doctypeName);
}
if (doctypePublic != null && doctypePublicOld != null
&& !doctypePublic.equals(doctypePublicOld)) {
err.jspError(n, "jsp.error.jspoutput.conflict",
"doctype-public", doctypePublicOld, doctypePublic);
}
if (doctypeSystem != null && doctypeSystemOld != null
&& !doctypeSystem.equals(doctypeSystemOld)) {
err.jspError(n, "jsp.error.jspoutput.conflict",
"doctype-system", doctypeSystemOld, doctypeSystem);
}
if (doctypeName == null && doctypeSystem != null
|| doctypeName != null && doctypeSystem == null) {
err.jspError(n, "jsp.error.jspoutput.doctypenamesystem");
}
if (doctypePublic != null && doctypeSystem == null) {
err.jspError(n, "jsp.error.jspoutput.doctypepulicsystem");
}
if (omitXmlDecl != null) {
pageInfo.setOmitXmlDecl(omitXmlDecl);
}
if (doctypeName != null) {
pageInfo.setDoctypeName(doctypeName);
}
if (doctypeSystem != null) {
pageInfo.setDoctypeSystem(doctypeSystem);
}
if (doctypePublic != null) {
pageInfo.setDoctypePublic(doctypePublic);
}
}
@Override
public void visit(Node.InvokeAction n) throws JasperException {
JspUtil.checkAttributes("Invoke", n, invokeAttrs, err);
String scope = n.getTextAttribute("scope");
JspUtil.checkScope(scope, n, err);
String var = n.getTextAttribute("var");
String varReader = n.getTextAttribute("varReader");
if (scope != null && var == null && varReader == null) {
err.jspError(n, "jsp.error.missing_var_or_varReader");
}
if (var != null && varReader != null) {
err.jspError(n, "jsp.error.var_and_varReader");
}
}
@Override
public void visit(Node.DoBodyAction n) throws JasperException {
JspUtil.checkAttributes("DoBody", n, doBodyAttrs, err);
String scope = n.getTextAttribute("scope");
JspUtil.checkScope(scope, n, err);
String var = n.getTextAttribute("var");
String varReader = n.getTextAttribute("varReader");
if (scope != null && var == null && varReader == null) {
err.jspError(n, "jsp.error.missing_var_or_varReader");
}
if (var != null && varReader != null) {
err.jspError(n, "jsp.error.var_and_varReader");
}
}
/*
* Make sure the given custom action does not have any invalid
* attributes.
*
* A custom action and its declared attributes always belong to the same
* namespace, which is identified by the prefix name of the custom tag
* invocation. For example, in this invocation:
*
* tagDataAttrs)
throws JasperException {
TagInfo tagInfo = n.getTagInfo();
TagAttributeInfo[] tldAttrs = tagInfo.getAttributes();
Attributes attrs = n.getAttributes();
for (int i = 0; attrs != null && i < attrs.getLength(); i++) {
boolean found = false;
boolean runtimeExpression = ((n.getRoot().isXmlSyntax() && attrs.getValue(i).startsWith("%="))
|| (!n.getRoot().isXmlSyntax() && attrs.getValue(i).startsWith("<%=")));
boolean elExpression = false;
boolean deferred = false;
double libraryVersion = Double.parseDouble(
tagInfo.getTagLibrary().getRequiredVersion());
boolean deferredSyntaxAllowedAsLiteral =
pageInfo.isDeferredSyntaxAllowedAsLiteral() ||
libraryVersion < 2.1;
String xmlAttributeValue = attrs.getValue(i);
ELNode.Nodes el = null;
if (!runtimeExpression && !pageInfo.isELIgnored()) {
el = ELParser.parse(xmlAttributeValue,
deferredSyntaxAllowedAsLiteral);
Iterator nodes = el.iterator();
while (nodes.hasNext()) {
ELNode node = nodes.next();
if (node instanceof ELNode.Root) {
if (((ELNode.Root) node).getType() == '$') {
if (elExpression && deferred) {
err.jspError(n,
"jsp.error.attribute.deferredmix");
}
elExpression = true;
} else if (((ELNode.Root) node).getType() == '#') {
if (elExpression && !deferred) {
err.jspError(n,
"jsp.error.attribute.deferredmix");
}
elExpression = true;
deferred = true;
}
}
}
}
boolean expression = runtimeExpression || elExpression;
// When attribute is not an expression,
// contains its textual value with \$ and \# escaping removed.
String textAttributeValue;
if (!elExpression && el != null) {
// Should be a single Text node
Iterator it = el.iterator();
if (it.hasNext()) {
textAttributeValue = ((ELNode.Text) it.next())
.getText();
} else {
textAttributeValue = "";
}
} else {
textAttributeValue = xmlAttributeValue;
}
for (int j = 0; tldAttrs != null && j < tldAttrs.length; j++) {
if (attrs.getLocalName(i).equals(tldAttrs[j].getName())
&& (attrs.getURI(i) == null
|| attrs.getURI(i).length() == 0 || attrs
.getURI(i).equals(n.getURI()))) {
TagAttributeInfo tldAttr = tldAttrs[j];
if (tldAttr.canBeRequestTime()
|| tldAttr.isDeferredMethod() || tldAttr.isDeferredValue()) { // JSP 2.1
if (!expression) {
String expectedType = null;
if (tldAttr.isDeferredMethod()) {
// The String literal must be castable to what is declared as type
// for the attribute
String m = tldAttr.getMethodSignature();
if (m != null) {
m = m.trim();
int rti = m.indexOf(' ');
if (rti > 0) {
expectedType = m.substring(0, rti).trim();
}
} else {
expectedType = "java.lang.Object";
}
if ("void".equals(expectedType)) {
// Can't specify a literal for a
// deferred method with an expected type
// of void - JSP.2.3.4
err.jspError(n,
"jsp.error.literal_with_void",
tldAttr.getName());
}
}
if (tldAttr.isDeferredValue()) {
// The String literal must be castable to what is declared as type
// for the attribute
expectedType = tldAttr.getExpectedTypeName();
}
if (expectedType != null) {
Class expectedClass = String.class;
try {
expectedClass = JspUtil.toClass(expectedType, loader);
} catch (ClassNotFoundException e) {
err.jspError
(n, "jsp.error.unknown_attribute_type",
tldAttr.getName(), expectedType);
}
// Check casting - not possible for all types
if (String.class.equals(expectedClass) ||
expectedClass == Long.TYPE ||
expectedClass == Double.TYPE ||
expectedClass == Byte.TYPE ||
expectedClass == Short.TYPE ||
expectedClass == Integer.TYPE ||
expectedClass == Float.TYPE ||
Number.class.isAssignableFrom(expectedClass) ||
Character.class.equals(expectedClass) ||
Character.TYPE == expectedClass ||
Boolean.class.equals(expectedClass) ||
Boolean.TYPE == expectedClass ||
expectedClass.isEnum()) {
try {
expressionFactory.coerceToType(textAttributeValue, expectedClass);
} catch (Exception e) {
err.jspError
(n, "jsp.error.coerce_to_type",
tldAttr.getName(), expectedType, textAttributeValue);
}
}
}
jspAttrs[i] = new Node.JspAttribute(tldAttr,
attrs.getQName(i), attrs.getURI(i),
attrs.getLocalName(i),
textAttributeValue, false, null, false);
} else {
if (deferred && !tldAttr.isDeferredMethod() && !tldAttr.isDeferredValue()) {
// No deferred expressions allowed for this attribute
err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr",
tldAttr.getName());
}
if (!deferred && !tldAttr.canBeRequestTime()) {
// Only deferred expressions are allowed for this attribute
err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr",
tldAttr.getName());
}
// EL or Runtime expression
jspAttrs[i] = getJspAttribute(tldAttr,
attrs.getQName(i), attrs.getURI(i),
attrs.getLocalName(i),
xmlAttributeValue, n, el, false);
}
} else {
// Attribute does not accept any expressions.
// Make sure its value does not contain any.
if (expression) {
err.jspError(n, "jsp.error.attribute.custom.non_rt_with_expr",
tldAttr.getName());
}
jspAttrs[i] = new Node.JspAttribute(tldAttr,
attrs.getQName(i), attrs.getURI(i),
attrs.getLocalName(i),
textAttributeValue, false, null, false);
}
if (expression) {
tagDataAttrs.put(attrs.getQName(i),
TagData.REQUEST_TIME_VALUE);
} else {
tagDataAttrs.put(attrs.getQName(i),
textAttributeValue);
}
found = true;
break;
}
}
if (!found) {
if (tagInfo.hasDynamicAttributes()) {
jspAttrs[i] = getJspAttribute(null, attrs.getQName(i),
attrs.getURI(i), attrs.getLocalName(i),
xmlAttributeValue, n, el, true);
} else {
err.jspError(n, "jsp.error.bad_attribute", attrs
.getQName(i), n.getLocalName());
}
}
}
}
/*
* Make sure the given custom action does not have any invalid named
* attributes
*/
private void checkNamedAttributes(Node.CustomTag n,
Node.JspAttribute[] jspAttrs, int start,
Hashtable tagDataAttrs)
throws JasperException {
TagInfo tagInfo = n.getTagInfo();
TagAttributeInfo[] tldAttrs = tagInfo.getAttributes();
Node.Nodes naNodes = n.getNamedAttributeNodes();
for (int i = 0; i < naNodes.size(); i++) {
Node.NamedAttribute na = (Node.NamedAttribute) naNodes
.getNode(i);
boolean found = false;
for (int j = 0; j < tldAttrs.length; j++) {
/*
* See above comment about namespace matches. For named
* attributes, we use the prefix instead of URI as the match
* criterion, because in the case of a JSP document, we'd
* have to keep track of which namespaces are in scope when
* parsing a named attribute, in order to determine the URI
* that the prefix of the named attribute's name matches to.
*/
String attrPrefix = na.getPrefix();
if (na.getLocalName().equals(tldAttrs[j].getName())
&& (attrPrefix == null || attrPrefix.length() == 0 || attrPrefix
.equals(n.getPrefix()))) {
jspAttrs[start + i] = new Node.JspAttribute(na,
tldAttrs[j], false);
NamedAttributeVisitor nav = null;
if (na.getBody() != null) {
nav = new NamedAttributeVisitor();
na.getBody().visit(nav);
}
if (nav != null && nav.hasDynamicContent()) {
tagDataAttrs.put(na.getName(),
TagData.REQUEST_TIME_VALUE);
} else {
tagDataAttrs.put(na.getName(), na.getText());
}
found = true;
break;
}
}
if (!found) {
if (tagInfo.hasDynamicAttributes()) {
jspAttrs[start + i] = new Node.JspAttribute(na, null,
true);
} else {
err.jspError(n, "jsp.error.bad_attribute",
na.getName(), n.getLocalName());
}
}
}
}
/**
* Preprocess attributes that can be expressions. Expression delimiters
* are stripped.
*
* If value is null, checks if there are any NamedAttribute subelements
* in the tree node, and if so, constructs a JspAttribute out of a child
* NamedAttribute node.
*
* @param el EL expression, if already parsed by the caller (so that we
* can skip re-parsing it)
*/
private Node.JspAttribute getJspAttribute(TagAttributeInfo tai,
String qName, String uri, String localName, String value,
Node n, ELNode.Nodes el, boolean dynamic)
throws JasperException {
Node.JspAttribute result = null;
// XXX Is it an error to see "%=foo%" in non-Xml page?
// (We won't see "<%=foo%> in xml page because '<' is not a
// valid attribute value in xml).
if (value != null) {
if (n.getRoot().isXmlSyntax() && value.startsWith("%=")) {
result = new Node.JspAttribute(tai, qName, uri, localName,
value.substring(2, value.length() - 1), true, null,
dynamic);
} else if (!n.getRoot().isXmlSyntax()
&& value.startsWith("<%=")) {
result = new Node.JspAttribute(tai, qName, uri, localName,
value.substring(3, value.length() - 2), true, null,
dynamic);
} else {
if (!pageInfo.isELIgnored()) {
// The attribute can contain expressions but is not a
// scriptlet expression; thus, we want to run it through
// the expression interpreter
// validate expression syntax if string contains
// expression(s)
if (el == null) {
el = ELParser.parse(value,
pageInfo.isDeferredSyntaxAllowedAsLiteral());
}
if (el.containsEL()) {
validateFunctions(el, n);
} else {
// Get text with \$ and \# escaping removed.
// Should be a single Text node
Iterator it = el.iterator();
if (it.hasNext()) {
value = ((ELNode.Text) it.next()).getText();
} else {
value = "";
}
el = null;
}
}
if (n instanceof Node.UninterpretedTag &&
n.getRoot().isXmlSyntax()) {
// Attribute values of uninterpreted tags will have been
// XML un-escaped during parsing. Since these attributes
// are part of an uninterpreted tag the value needs to
// be re-escaped before being included in the output.
// The wrinkle is that the output of any EL must not be
// re-escaped as that must be output as is.
if (el != null) {
XmlEscapeNonELVisitor v = new XmlEscapeNonELVisitor(
pageInfo.isDeferredSyntaxAllowedAsLiteral());
el.visit(v);
value = v.getText();
} else {
value = xmlEscape(value);
}
}
result = new Node.JspAttribute(tai, qName, uri, localName,
value, false, el, dynamic);
if (el != null) {
ELContextImpl ctx =
new ELContextImpl(expressionFactory);
ctx.setFunctionMapper(getFunctionMapper(el));
try {
result.validateEL(this.pageInfo
.getExpressionFactory(), ctx);
} catch (ELException e) {
this.err.jspError(n.getStart(),
"jsp.error.invalid.expression", value, e
.toString());
}
}
}
} else {
// Value is null. Check for any NamedAttribute subnodes
// that might contain the value for this attribute.
// Otherwise, the attribute wasn't found so we return null.
Node.NamedAttribute namedAttributeNode = n
.getNamedAttributeNode(qName);
if (namedAttributeNode != null) {
result = new Node.JspAttribute(namedAttributeNode, tai,
dynamic);
}
}
return result;
}
private static class XmlEscapeNonELVisitor extends ELParser.TextBuilder {
protected XmlEscapeNonELVisitor(
boolean isDeferredSyntaxAllowedAsLiteral) {
super(isDeferredSyntaxAllowedAsLiteral);
}
@Override
public void visit(Text n) throws JasperException {
output.append(ELParser.escapeLiteralExpression(
xmlEscape(n.getText()),
isDeferredSyntaxAllowedAsLiteral));
}
}
/*
* Return an empty StringBuilder [not thread-safe]
*/
private StringBuilder getBuffer() {
this.buf.setLength(0);
return this.buf;
}
/*
* Checks to see if the given attribute value represents a runtime or EL
* expression.
*/
private boolean isExpression(Node n, String value, boolean checkDeferred) {
boolean runtimeExpression = ((n.getRoot().isXmlSyntax() && value.startsWith("%="))
|| (!n.getRoot().isXmlSyntax() && value.startsWith("<%=")));
boolean elExpression = false;
if (!runtimeExpression && !pageInfo.isELIgnored()) {
Iterator nodes = ELParser.parse(value,
pageInfo.isDeferredSyntaxAllowedAsLiteral()).iterator();
while (nodes.hasNext()) {
ELNode node = nodes.next();
if (node instanceof ELNode.Root) {
if (((ELNode.Root) node).getType() == '$') {
elExpression = true;
break;
} else if (checkDeferred && !pageInfo.isDeferredSyntaxAllowedAsLiteral()
&& ((ELNode.Root) node).getType() == '#') {
elExpression = true;
break;
}
}
}
}
return runtimeExpression || elExpression;
}
/*
* Throws exception if the value of the attribute with the given name in
* the given node is given as an RT or EL expression, but the spec
* requires a static value.
*/
private void throwErrorIfExpression(Node n, String attrName,
String actionName) throws JasperException {
if (n.getAttributes() != null
&& n.getAttributes().getValue(attrName) != null
&& isExpression(n, n.getAttributes().getValue(attrName), true)) {
err.jspError(n,
"jsp.error.attribute.standard.non_rt_with_expr",
attrName, actionName);
}
}
private static class NamedAttributeVisitor extends Node.Visitor {
private boolean hasDynamicContent;
@Override
public void doVisit(Node n) throws JasperException {
if (!(n instanceof Node.JspText)
&& !(n instanceof Node.TemplateText)) {
hasDynamicContent = true;
}
visitBody(n);
}
public boolean hasDynamicContent() {
return hasDynamicContent;
}
}
private String findUri(String prefix, Node n) {
for (Node p = n; p != null; p = p.getParent()) {
Attributes attrs = p.getTaglibAttributes();
if (attrs == null) {
continue;
}
for (int i = 0; i < attrs.getLength(); i++) {
String name = attrs.getQName(i);
int k = name.indexOf(':');
if (prefix == null && k < 0) {
// prefix not specified and a default ns found
return attrs.getValue(i);
}
if (prefix != null && k >= 0
&& prefix.equals(name.substring(k + 1))) {
return attrs.getValue(i);
}
}
}
return null;
}
/**
* Validate functions in EL expressions
*/
private void validateFunctions(ELNode.Nodes el, Node n)
throws JasperException {
class FVVisitor extends ELNode.Visitor {
private Node n;
FVVisitor(Node n) {
this.n = n;
}
@Override
public void visit(ELNode.Function func) throws JasperException {
String prefix = func.getPrefix();
String function = func.getName();
String uri = null;
if (n.getRoot().isXmlSyntax()) {
uri = findUri(prefix, n);
} else if (prefix != null) {
uri = pageInfo.getURI(prefix);
}
if (uri == null) {
if (prefix == null) {
err.jspError(n, "jsp.error.noFunctionPrefix",
function);
} else {
err.jspError(n, "jsp.error.attribute.invalidPrefix",
prefix);
}
}
TagLibraryInfo taglib = pageInfo.getTaglib(uri);
FunctionInfo funcInfo = null;
if (taglib != null) {
funcInfo = taglib.getFunction(function);
}
if (funcInfo == null) {
err.jspError(n, "jsp.error.noFunction", function);
}
// Skip TLD function uniqueness check. Done by Schema ?
func.setUri(uri);
func.setFunctionInfo(funcInfo);
processSignature(func);
}
}
el.visit(new FVVisitor(n));
}
private void prepareExpression(ELNode.Nodes el, Node n, String expr)
throws JasperException {
validateFunctions(el, n);
// test it out
ELContextImpl ctx = new ELContextImpl(expressionFactory);
ctx.setFunctionMapper(this.getFunctionMapper(el));
ExpressionFactory ef = this.pageInfo.getExpressionFactory();
try {
ef.createValueExpression(ctx, expr, Object.class);
} catch (ELException e) {
}
}
private void processSignature(ELNode.Function func)
throws JasperException {
func.setMethodName(getMethod(func));
func.setParameters(getParameters(func));
}
/**
* Get the method name from the signature.
*/
private String getMethod(ELNode.Function func) throws JasperException {
FunctionInfo funcInfo = func.getFunctionInfo();
String signature = funcInfo.getFunctionSignature();
int start = signature.indexOf(' ');
if (start < 0) {
err.jspError("jsp.error.tld.fn.invalid.signature", func
.getPrefix(), func.getName());
}
int end = signature.indexOf('(');
if (end < 0) {
err.jspError(
"jsp.error.tld.fn.invalid.signature.parenexpected",
func.getPrefix(), func.getName());
}
return signature.substring(start + 1, end).trim();
}
/**
* Get the parameters types from the function signature.
*
* @return An array of parameter class names
*/
private String[] getParameters(ELNode.Function func)
throws JasperException {
FunctionInfo funcInfo = func.getFunctionInfo();
String signature = funcInfo.getFunctionSignature();
ArrayList params = new ArrayList<>();
// Signature is of the form
// S ( ',' )* )? ')'
int start = signature.indexOf('(') + 1;
boolean lastArg = false;
while (true) {
int p = signature.indexOf(',', start);
if (p < 0) {
p = signature.indexOf(')', start);
if (p < 0) {
err.jspError("jsp.error.tld.fn.invalid.signature", func
.getPrefix(), func.getName());
}
lastArg = true;
}
String arg = signature.substring(start, p).trim();
if (!"".equals(arg)) {
params.add(arg);
}
if (lastArg) {
break;
}
start = p + 1;
}
return params.toArray(new String[params.size()]);
}
private FunctionMapper getFunctionMapper(ELNode.Nodes el)
throws JasperException {
class ValidateFunctionMapper extends FunctionMapper {
private HashMap fnmap = new HashMap<>();
@Override
public void mapFunction(String prefix, String localName,
Method method) {
fnmap.put(prefix + ":" + localName, method);
}
@Override
public Method resolveFunction(String prefix, String localName) {
return this.fnmap.get(prefix + ":" + localName);
}
}
class MapperELVisitor extends ELNode.Visitor {
private ValidateFunctionMapper fmapper;
MapperELVisitor(ValidateFunctionMapper fmapper) {
this.fmapper = fmapper;
}
@SuppressWarnings("null") // c can't be null after catch block
@Override
public void visit(ELNode.Function n) throws JasperException {
Class c = null;
Method method = null;
try {
c = loader.loadClass(n.getFunctionInfo()
.getFunctionClass());
} catch (ClassNotFoundException e) {
err.jspError("jsp.error.function.classnotfound", n
.getFunctionInfo().getFunctionClass(), n
.getPrefix()
+ ':' + n.getName(), e.getMessage());
}
String paramTypes[] = n.getParameters();
int size = paramTypes.length;
Class params[] = new Class[size];
int i = 0;
try {
for (i = 0; i < size; i++) {
params[i] = JspUtil.toClass(paramTypes[i], loader);
}
method = c.getDeclaredMethod(n.getMethodName(), params);
} catch (ClassNotFoundException e) {
err.jspError("jsp.error.signature.classnotfound",
paramTypes[i], n.getPrefix() + ':'
+ n.getName(), e.getMessage());
} catch (NoSuchMethodException e) {
err.jspError("jsp.error.noFunctionMethod", n
.getMethodName(), n.getName(), c.getName());
}
fmapper.mapFunction(n.getPrefix(), n.getName(),
method);
}
}
ValidateFunctionMapper fmapper = new ValidateFunctionMapper();
el.visit(new MapperELVisitor(fmapper));
return fmapper;
}
} // End of ValidateVisitor
/**
* A visitor for validating TagExtraInfo classes of all tags
*/
private static class TagExtraInfoVisitor extends Node.Visitor {
private final ErrorDispatcher err;
/*
* Constructor
*/
TagExtraInfoVisitor(Compiler compiler) {
this.err = compiler.getErrorDispatcher();
}
@Override
public void visit(Node.CustomTag n) throws JasperException {
TagInfo tagInfo = n.getTagInfo();
if (tagInfo == null) {
err.jspError(n, "jsp.error.missing.tagInfo", n.getQName());
}
@SuppressWarnings("null") // tagInfo can't be null here
ValidationMessage[] errors = tagInfo.validate(n.getTagData());
if (errors != null && errors.length != 0) {
StringBuilder errMsg = new StringBuilder();
errMsg.append("");
errMsg.append(Localizer.getMessage(
"jsp.error.tei.invalid.attributes", n.getQName()));
errMsg.append("
");
for (int i = 0; i < errors.length; i++) {
errMsg.append("");
if (errors[i].getId() != null) {
errMsg.append(errors[i].getId());
errMsg.append(": ");
}
errMsg.append(errors[i].getMessage());
errMsg.append("
");
}
err.jspError(n, errMsg.toString());
}
visitBody(n);
}
}
public static void validateDirectives(Compiler compiler, Node.Nodes page)
throws JasperException {
page.visit(new DirectiveVisitor(compiler));
}
public static void validateExDirectives(Compiler compiler, Node.Nodes page)
throws JasperException {
// Determine the default output content type
PageInfo pageInfo = compiler.getPageInfo();
String contentType = pageInfo.getContentType();
if (contentType == null || contentType.indexOf("charset=") < 0) {
boolean isXml = page.getRoot().isXmlSyntax();
String defaultType;
if (contentType == null) {
defaultType = isXml ? "text/xml" : "text/html";
} else {
defaultType = contentType;
}
String charset = null;
if (isXml) {
charset = "UTF-8";
} else {
if (!page.getRoot().isDefaultPageEncoding()) {
charset = page.getRoot().getPageEncoding();
}
}
if (charset != null) {
pageInfo.setContentType(defaultType + ";charset=" + charset);
} else {
pageInfo.setContentType(defaultType);
}
}
/*
* Validate all other nodes. This validation step includes checking a
* custom tag's mandatory and optional attributes against information in
* the TLD (first validation step for custom tags according to
* JSP.10.5).
*/
page.visit(new ValidateVisitor(compiler));
/*
* Invoke TagLibraryValidator classes of all imported tags (second
* validation step for custom tags according to JSP.10.5).
*/
validateXmlView(new PageDataImpl(page, compiler), compiler);
/*
* Invoke TagExtraInfo method isValid() for all imported tags (third
* validation step for custom tags according to JSP.10.5).
*/
page.visit(new TagExtraInfoVisitor(compiler));
}
// *********************************************************************
// Private (utility) methods
/**
* Validate XML view against the TagLibraryValidator classes of all imported
* tag libraries.
*/
private static void validateXmlView(PageData xmlView, Compiler compiler)
throws JasperException {
StringBuilder errMsg = null;
ErrorDispatcher errDisp = compiler.getErrorDispatcher();
for (Iterator iter =
compiler.getPageInfo().getTaglibs().iterator(); iter.hasNext();) {
Object o = iter.next();
if (!(o instanceof TagLibraryInfoImpl))
continue;
TagLibraryInfoImpl tli = (TagLibraryInfoImpl) o;
ValidationMessage[] errors = tli.validate(xmlView);
if ((errors != null) && (errors.length != 0)) {
if (errMsg == null) {
errMsg = new StringBuilder();
}
errMsg.append("");
errMsg.append(Localizer.getMessage(
"jsp.error.tlv.invalid.page", tli.getShortName(),
compiler.getPageInfo().getJspFile()));
errMsg.append("
");
for (int i = 0; i < errors.length; i++) {
if (errors[i] != null) {
errMsg.append("");
errMsg.append(errors[i].getId());
errMsg.append(": ");
errMsg.append(errors[i].getMessage());
errMsg.append("
");
}
}
}
}
if (errMsg != null) {
errDisp.jspError(errMsg.toString());
}
}
protected static String xmlEscape(String s) {
if (s == null) {
return null;
}
int len = s.length();
/*
* Look for any "bad" characters, Escape "bad" character was found
*/
// ASCII " 34 & 38 ' 39 < 60 > 62
for (int i = 0; i < len; i++) {
char c = s.charAt(i);
if (c >= '\"' && c <= '>' &&
(c == '<' || c == '>' || c == '\'' || c == '&' || c == '"')) {
// need to escape them and then quote the whole string
StringBuilder sb = new StringBuilder((int) (len * 1.2));
sb.append(s, 0, i);
int pos = i + 1;
for (int j = i; j < len; j++) {
c = s.charAt(j);
if (c >= '\"' && c <= '>') {
if (c == '<') {
if (j > pos) {
sb.append(s, pos, j);
}
sb.append("<");
pos = j + 1;
} else if (c == '>') {
if (j > pos) {
sb.append(s, pos, j);
}
sb.append(">");
pos = j + 1;
} else if (c == '\'') {
if (j > pos) {
sb.append(s, pos, j);
}
sb.append("'"); // '
pos = j + 1;
} else if (c == '&') {
if (j > pos) {
sb.append(s, pos, j);
}
sb.append("&");
pos = j + 1;
} else if (c == '"') {
if (j > pos) {
sb.append(s, pos, j);
}
sb.append("""); // "
pos = j + 1;
}
}
}
if (pos < len) {
sb.append(s, pos, len);
}
return sb.toString();
}
}
return s;
}
}