
demo.NCBIQBlastServiceDemo Maven / Gradle / Ivy
Go to download
Show more of this group Show more artifacts with this name
Show all versions of biojava-ws Show documentation
Show all versions of biojava-ws Show documentation
This module deals with bioinformatics web services that could be used to process Biojava objects in a useful manner.
/*
* BioJava development code
*
* This code may be freely distributed and modified under the
* terms of the GNU Lesser General Public Licence. This should
* be distributed with the code. If you do not have a copy,
* see:
*
* http://www.gnu.org/copyleft/lesser.html
*
* Copyright for this code is held jointly by the individual
* authors. These should be listed in @author doc comments.
*
* For more information on the BioJava project and its aims,
* or to join the biojava-l mailing list, visit the home page
* at:
*
* http://www.biojava.org/
*
*/
package demo;
import org.biojava.nbio.core.sequence.io.util.IOUtils;
import org.biojava.nbio.ws.alignment.qblast.BlastProgramEnum;
import org.biojava.nbio.ws.alignment.qblast.NCBIQBlastAlignmentProperties;
import org.biojava.nbio.ws.alignment.qblast.NCBIQBlastOutputProperties;
import org.biojava.nbio.ws.alignment.qblast.NCBIQBlastService;
import java.io.*;
import static org.biojava.nbio.ws.alignment.qblast.BlastAlignmentParameterEnum.ENTREZ_QUERY;
/**
* A simple demo showing {@link NCBIQBlastService} usage
*
* @author Gediminas Rimsa
*/
public class NCBIQBlastServiceDemo {
private static final String BLAST_OUTPUT_FILE = "blastOutput.xml";
private static final String SEQUENCE = "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKS";
public static void main(String[] args) {
NCBIQBlastService service = null;
if (args.length == 1) {
service = new NCBIQBlastService(args[0]);
} else {
service = new NCBIQBlastService();
}
// set alignment options
NCBIQBlastAlignmentProperties props = new NCBIQBlastAlignmentProperties();
props.setBlastProgram(BlastProgramEnum.blastp);
props.setBlastDatabase("swissprot");
props.setAlignmentOption(ENTREZ_QUERY, "\"serum albumin\"[Protein name] AND mammals[Organism]");
// set output options
NCBIQBlastOutputProperties outputProps = new NCBIQBlastOutputProperties();
// Example of two possible ways of setting output options (in this case, it was already set by constructor)
// outputProps.setAlignmentNumber(100);
// outputProps.setOutputOption(BlastOutputParameterEnum.ALIGNMENTS, "100");
String rid = null;
FileWriter writer = null;
BufferedReader reader = null;
try {
// send blast request and save request id
rid = service.sendAlignmentRequest(SEQUENCE, props);
while (!service.isReady(rid)) {
System.out.println("Waiting for results. Sleeping for 5 seconds");
Thread.sleep(5000);
}
// read results when they are ready
InputStream in = service.getAlignmentResults(rid, outputProps);
reader = new BufferedReader(new InputStreamReader(in));
File f = new File(BLAST_OUTPUT_FILE);
System.out.println("Saving query results in file " + f.getAbsolutePath());
writer = new FileWriter(f);
String line;
while ((line = reader.readLine()) != null) {
writer.write(line + System.getProperty("line.separator"));
}
} catch (Exception e) {
System.out.println(e.getMessage());
e.printStackTrace();
} finally {
IOUtils.close(writer);
IOUtils.close(reader);
service.sendDeleteRequest(rid);
}
}
}
© 2015 - 2025 Weber Informatics LLC | Privacy Policy