All Downloads are FREE. Search and download functionalities are using the official Maven repository.

org.biojava.bio.program.sax.NeedleAlignmentSAXParser Maven / Gradle / Ivy

There is a newer version: 1.9.7
Show newest version
/*
 *                    BioJava development code
 *
 * This code may be freely distributed and modified under the
 * terms of the GNU Lesser General Public Licence.  This should
 * be distributed with the code.  If you do not have a copy,
 * see:
 *
 *      http://www.gnu.org/copyleft/lesser.html
 *
 * Copyright for this code is held jointly by the individual
 * authors.  These should be listed in @author doc comments.
 *
 * For more information on the BioJava project and its aims,
 * or to join the biojava-l mailing list, visit the home page
 * at:
 *
 *      http://www.biojava.org/
 *
 */
package org.biojava.bio.program.sax;

import java.io.BufferedReader;
import java.io.IOException;
import java.util.ArrayList;
import java.util.HashMap;
import java.util.StringTokenizer;

import org.xml.sax.Attributes;
import org.xml.sax.InputSource;
import org.xml.sax.SAXException;
import org.xml.sax.helpers.AttributesImpl;

/**
 * A SAX2 parser for dealing with a pairwise sequence
 * alignment as produced by Needle (EMBOSS) outputing .needle format.
 * For example,
 * 
TGFBG4_frame2

TGFB1           136      NTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR 180

TGFBG4_frame2

TGFB1           181      YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRG.............. 211
                                                       |
TGFBG4_frame2   1                                     LGELHSQTGFPLATPT 16

TGFB1           212      GEIEGFRLSAHCSCDSRDNTLQVDIN................... 237
                         ||||||||||||||||||||||||||
TGFBG4_frame2   17       GEIEGFRLSAHCSCDSRDNTLQVDINGEACFPGHAQLRVCVCVFP 61

TGFB1           238      ........................GFTTGRRGDLATIHGMNRPFL 258
                                                 |||||||||||||||||||||
TGFBG4_frame2   62       SAPRPTYLSLECVCMSPIPLPHKAGFTTGRRGDLATIHGMNRPFL 106

TGFB1           259      LLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFR 303
                         |||||||||||||||||||||||||||| :
TGFBG4_frame2   107      LLMATPLERAQHLQSSRHRRALDTNYCFRALP............. 138

TGFB1           304      KDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNP 348
                            ||:    |    |
TGFBG4_frame2   139      ...GWR....PSRLGAL                             148

TGFB1           349      GASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS    390

TGFBG4_frame2
 * 
*

* Please note, this parser reads the whole alignment in to * core memory and thus does not scale to work with very large * alignments on low-end hardware. *

* Please also note that this class has not been tested with * many version of Needle. * * WARNING: The parser currently assumes a line length of 45 * This restriction is easy to remove, just haven't done it. * * Copyright © 2001,2002 Cambridge Antibody Technology. * *

* Primary author -

    *
  • Simon Brocklehurst (CAT) *
* Other authors -
    *
  • Neil Benn (CAT) *
  • Lawrence Bower (CAT) *
  • Derek Crockford (CAT) *
  • Tim Dilks (CAT) *
  • Colin Hardman (CAT) *
  • Stuart Johnston (CAT) *
* * @author Cambridge Antibody Technology (CAT) * @author Greg Cox * @version 1.0 * */ class NeedleAlignmentSAXParser extends AbstractNativeAppSAXParser { private AttributesImpl oAtts = new AttributesImpl(); private QName oAttQName = new QName(this); private char[] aoChars; private String oSeqName; private String oTmpSeq; private StringBuffer oSeq = new StringBuffer(); private HashMap oAlignment = new HashMap(); private ArrayList oSeqNameList = new ArrayList(); private static final int STARTUP = 0; private static final int IN_STREAM = 1; /** * Initialises internal state * Sets namespace prefix to "biojava" */ public NeedleAlignmentSAXParser() { iState = STARTUP; this.setNamespacePrefix("biojava"); } /** * Describe 'parse' method here. * * @param nil - */ public void parse(InputSource poSource ) throws IOException,SAXException { BufferedReader oContents; String oLine = null; //Use method form superclass oContents = this.getContentStream(poSource); // loop over file try { // loop over file oLine = oContents.readLine(); while (oLine != null) { //System.out.println(oLine); this.interpret(oContents,oLine); oLine = oContents.readLine(); } // end while } catch (java.io.IOException x) { System.out.println(x.getMessage()); System.out.println("Stream read interupted"); } // end try/catch //at end of stream... //at this point, alignment is parsed - nibble back extraneous end //gaps this.nibbleEndGaps(); // now cycle through and emit elements for (int i = 0; i < oSeqNameList.size(); i++) { oSeqName = (String) oSeqNameList.get(i); this.emitSequence(oSeqName, (String) oAlignment.get(oSeqName)); } this.endElement(new QName(this, this.prefix("SequenceCollection"))); oContents.close(); } /** * Describe interpret method here. * * @param poContents a BufferedReader value * @param poLine a String value * @exception SAXException if an error occurs */ private void interpret(BufferedReader poContents, String poLine) throws SAXException { if (iState == STARTUP) { oAtts.clear(); this.startElement( new QName(this, this.prefix("SequenceCollection")), (Attributes)oAtts); this.changeState(IN_STREAM); } if (iState == IN_STREAM) { if (this.lineIsRelevant(poLine)) { //build aligment in memory this.appendToAlignment(poLine); } } } /** * Parse a relevant line i.e. alignment line, and add to alignment * * @param poLine a String value */ private void appendToAlignment(String poLine) { //System.out.println(poLine); StringTokenizer oSt = new StringTokenizer(poLine,"\n\t\r "); //First token is sequence name oSeqName = oSt.nextToken(); //System.out.println(oSeqName); oSeq.setLength(0); //Take from particular positions - assumes default output //line length etc. //Postions 25 to 69 oTmpSeq = poLine.substring(25,70).replace('.','-').replace(' ','-'); oSeq.append(oTmpSeq); //System.out.println(oSeq); //At this point, have name of sequence, and a segment of the sequence //Update object... if (oAlignment.get(oSeqName) == null) { //Here if on first occurence of this sequence //Add to alignment oAlignment.put(oSeqName,oSeq.substring(0)); //maintain ordered list of sequence names oSeqNameList.add(oSeqName); } else { //Here if building up an existing sequence oTmpSeq = (String) oAlignment.get(oSeqName); oAlignment.put(oSeqName,oTmpSeq.concat(oSeq.substring(0))); } } /** * Only interested in lines that are part of the alignment. * Returns true if line is in alignment, false if not. * * @param poLine a String value * @return a boolean value */ private boolean lineIsRelevant(String poLine) { //blank lines not relevant //lines that starts with a space not relevant (consensus line) //lines that start with "Needle(" not relevant (title) if ( (poLine.trim().equals("")) || (poLine.startsWith(" ")) || (poLine.startsWith("Global: ")) || (poLine.startsWith("Score: ")) || (poLine.startsWith("%id = ")) || (poLine.startsWith("Overall %id = ")) ) { //System.out.println("Irrelevant|"+poLine+"|"); return false; } //if here,line is part of alignment, so return true return true; } /** * Emit a sequence element * * @param poSequenceName a String value * @param poSequence a String value * @exception SAXException if an error occurs */ private void emitSequence(String poSequenceName, String poSequence) throws SAXException { oAtts.clear(); oAttQName.setQName("sequenceName"); oAtts.addAttribute(oAttQName.getURI(), oAttQName.getLocalName(), oAttQName.getQName(), "CDATA",poSequenceName); this.startElement( new QName(this, this.prefix("Sequence")), (Attributes)oAtts); aoChars = poSequence.toCharArray(); this.characters(aoChars,0,aoChars.length); this.endElement(new QName(this,this.prefix("Sequence"))); } /** * After the alignment is parsed, the ends of the sequences are * padded out with blanks to the end of the last line: * * e.g. * GCACACA--------------------------------- * CAC------------------------------------- * * This method removes extraneous gaps to produce * * GCACACA * CAC---- * */ private void nibbleEndGaps() { //first get length of alignment String oSeqName1 = (String) oSeqNameList.get(0); String oSeqName2 = (String) oSeqNameList.get(1); String oSeq1 = (String) oAlignment.get(oSeqName1); String oSeq2 = (String) oAlignment.get(oSeqName2); int iLength = oSeq1.length(); int iNibbles = 0; boolean tNibble = true; //index position of last character in String int iPos = iLength-1; //System.out.println("Seq1 length = " + oSeq1.length()); //System.out.println("Seq2 length = " + oSeq2.length()); while (tNibble) { //System.out.println("-->iPos = " + iPos); if ( (oSeq1.charAt(iPos) == '-') && (oSeq2.charAt(iPos) == '-') ) { iNibbles++; iPos--; } else { tNibble = false; } } //System.out.println("----------->NIBBLE " + iNibbles); if (iNibbles > 0) { oAlignment.put(oSeqName1,oSeq1.substring(0,iLength-iNibbles)); oAlignment.put(oSeqName2,oSeq2.substring(0,iLength-iNibbles)); } } }




© 2015 - 2025 Weber Informatics LLC | Privacy Policy